1. Recombinant Proteins
  2. Recombinant Human Interleukin-21

Recombinant Human Interleukin-21

Cat. No.: HY-P7038
Handling Instructions

Recombinant Human Interleukin-21 is a class 1 cytokine, which is produced by activated CD4+ T cells. Recombinant Human Interleukin-21 stimulation of T cells, B cells and NK cells leads to enhanced proliferation and mature effector function.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-21; Za11; IL21
Species

Human

Source

E. coli

Accession

Q9HBE4

Gene ID

59067

Molecular Weight

Approximately 15.4 kDa

AA Sequence

MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Biological Activity
The ED50 is <0.5 ng/mL as measured by Mino cells, corresponding to a specific activity of >2.0 × 106 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Interleukin-21 (rHuIL-21) to 100 µg/mL using ddH2O or diluted with PBS.

Storage & Stability

Lyophilized recombinant Human Interleukin-21 (rHuIL-21) is stored at -20°C. After reconstitution, it is stable at 4°C for 2 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-21 (IL-21) is a pleiotropic cytokine that has key functions in both the innate and adaptive immunity and the regulation of autoimmunity. IL-21 has a range of activities likely to potentiate antitumor immunoresponses. IL-21 has a role as a single agent in the treatment of melanoma. IL-21 also has significant activity against various types of cancer in combination with monoclonal antibodies or signaling inhibitors[1]. Recombinant human interleukin-21 (rIL-21), a human recombinant interleukin, with Cetuximab, a monoclonal antibody, targeting the epidermal growth factor receptor[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Interleukin-21
Cat. No.:
HY-P7038
Quantity:
MCE Japan Authorized Agent: