1. Recombinant Proteins
  2. Recombinant Human Interleukin-22

Recombinant Human Interleukin-22

Cat. No.: HY-P7039
Handling Instructions

Recombinant Human Interleukin-22 produced in E. coli, is a cytokine protein and intricate member of the immune response.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 Get quote
100 μg $1050 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuIL-22; Cytokine Zcyto 18; IL-TIF
Species

Human

Source

E. coli

Accession

Q9GZX6

Gene ID

50616

Molecular Weight

Approximately 16.9 kDa

AA Sequence

MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Biological Activity
The ED50 is <1 ng/mL as measured by COLO 205 (human colon carcinoma cells).
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Interleukin-22 (rHuIL-22) to 100 μg/mL using ddH2O or PBS.

Storage & Stability

Lyophilized recombinant Human Interleukin-22 (rHuIL-22) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-22 (IL-10-related T cell-derived inducible factor/IL-TIF/IL-22) is a novel cytokine belonging to the IL-10 family. Recombinant humanIL-22 (hIL-22) is found to activate the signal transducers and activators of transcription factors 1 and 3 as well as acute phase reactants in several hepatoma cell lines, suggesting its involvement in the inflammatory response. IL-22 is a member of interleukin-10 family of cytokines, which also includes IL-19, IL-20, and IL-24 in addition to IL-10 and a number of its viral homologs[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Interleukin-22
Cat. No.:
HY-P7039
Quantity:
MCE Japan Authorized Agent: