1. Recombinant Proteins
  2. Recombinant Human Keratinocyte Growth Factor 1/FGF-7

Recombinant Human Keratinocyte Growth Factor 1/FGF-7

Cat. No.: HY-P7047
Handling Instructions

Recombinant Human Keratinocyte Growth Factor 1/FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. Recombinant Human Keratinocyte Growth Factor 1/FGF-7 and its receptor are important for normal wound healing.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuKGF-1/FGF-7; Keratinocyte Growth Factor; Fibroblast Growth Factor-7; HBGF-7
Species

Human

Source

E. coli

Accession

P21781

Gene ID

2252

Molecular Weight

Approximately 19.0 kDa

AA Sequence

MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Biological Activity
The ED50 is <2 ng/mL as measured by 4MBr-5 cells, corresponding to a specific activity of >5.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Keratinocyte Growth Factor 1/FGF-7 (rHuKGF-1/FGF-7) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Keratinocyte Growth Factor 1/FGF-7 (rHuKGF-1/FGF-7) is stored at -20°C. After reconstitution, it is stable at 4°C for 2 weeks or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Keratinocyte growth factor 1 or FGF-7 is a polypeptide mitogen that belongs to the family of fibroblast growth factors, binds only to a splice variant of FGFR2 (FGFR2 IIIb) and is a highly specific paracrine growth factor for epithelial cells. FGF-7 and its receptor are believed to be important for normal wound healing[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Keratinocyte Growth Factor 1/FGF-7
Cat. No.:
HY-P7047
Quantity:
MCE Japan Authorized Agent: