1. Recombinant Proteins
  2. Recombinant Human Keratinocyte Growth Factor-2/FGF-10

Recombinant Human Keratinocyte Growth Factor-2/FGF-10

Cat. No.: HY-P7048
Handling Instructions

Recombinant Human Keratinocyte Growth Factor-2/FGF-10 is a heparin-binding protein that binds to FGF2 IIIb and FGFR1III-b receptors, promotes the growth, proliferation, and differentiation of epithelial cells and can enhance corneal wound healing.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg $600 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuKGF-2/FGF-10; Fibroblast Growth Factor-10
Species

Human

Source

E. coli

Accession

O15520

Gene ID

2255

Molecular Weight

Approximately 19.3 kDa

AA Sequence

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Biological Activity
The ED50 is <20 ng/mL as measured by 4 MBr-5 cells, corresponding to a specific activity of >5.0 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Keratinocyte Growth Factor-2/FGF-10 (rHuKGF-2/FGF-10) to 100 µg/mL using ddH2.

Storage & Stability

Lyophilized recombinant Human Keratinocyte Growth Factor-2/FGF-10 (rHuKGF-2/FGF-10) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Keratinocyte growth factor-2 (KGF-2), also called fibroblast growth factor-10 (FGF-10), is a soluble 170-amino-acid polypeptide secreted by fibroblasts and endothelial cells acting primarily on epithelial cells. Its functions mainly mediated by FGF-2 IIIb receptor, a transmembrane receptor, expressed exclusively by epithelial cells. KGF-2 promotes the growth, proliferation, and differentiation of epithelial cells, with promising effects in treating epithelial damage. KGF-2 enhances corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury[1]. Keratinocyte growth factor-2 (KGF-2) is a 20-kD heparin-binding protein, and also binds to FGFR1III-b, which may explain the severely impaired lung development of FGF-10 null mice[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Keratinocyte Growth Factor-2/FGF-10
Cat. No.:
HY-P7048
Quantity:
MCE Japan Authorized Agent: