1. Recombinant Proteins
  2. Recombinant Human KRAS-G12V, His

Recombinant Human KRAS-G12V, His

Cat. No.: HY-P7805
Handling Instructions

Recombinant Human KRAS-G12V, His is a 25-30 kDa human KRAS protein with G12V mutation and N-terminal His-tag. K-Ras belongs to the small GTPase superfamily, Ras family[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $130 Ask For Quote & Lead Time
50 μg $400 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
Ki-Ras; c-K-ras; KRAS2; RASK2
Source

E. coli

Accession

AAH13572.1

Gene ID

3845

Molecular Weight

25-30 kDa, observed by reducing SDS-PAGE

AA Sequence

HHHHHHTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human KRAS-G12V, His (rHuKRAS-G12V, His) to a concentration not less than 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human KRAS-G12V, His (rHuKRAS-G12V, His) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human KRAS-G12V, His
Cat. No.:
HY-P7805
Quantity:
MCE Japan Authorized Agent: