1. Recombinant Proteins
  2. Recombinant Human Noggin (CHO-expressed)

Recombinant Human Noggin (CHO-expressed)

Cat. No.: HY-P7051A
Handling Instructions

Recombinant Human Noggin (CHO-expressed) is an antagonist of bone morphogenetic proteins (BMPs), binds with high affinity to hBMP-4, and with lower affinity to hBMP-7; Recombinant Human Noggin is essential for proper skeletal development.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE Recombinant Human Noggin (CHO-expressed)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuNoggin; NOG
Species

Human

Source

CHO

Accession

Q13253

Gene ID

9241

Molecular Weight

29-31 kDa

AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Biological Activity
The ED50 is <2.5 ng/mL as measured by ATDC5 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Noggin (CHO-expressed) (rHuNoggin) to 100 µg/mL using ddH2O or diluted with PBS.

Storage & Stability

Lyophilized recombinant Human Noggin (CHO-expressed) (rHuNoggin) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human Noggin protein has 205 amino acids (residues 28-232) after removal of its signal sequence (residues 1-27) and is secreted as a glycosylated, covalently linked homodimer, binds with high affinity to hBMP-4, and with lower affinity to hBMP-7 and acts as an antagonist of bone morphogenetic proteins (BMPs)[1]. Noggin is essential for proper skeletal development; excess BMP activity in the Noggin null mutant results in excess cartilage and failure to initiate joint formation[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Noggin (CHO-expressed)
Cat. No.:
HY-P7051A
Quantity:
MCE Japan Authorized Agent: