1. Recombinant Proteins
  2. Recombinant Human Oncostatin-M, 209a.a.

Recombinant Human Oncostatin-M, 209a.a.

Cat. No.: HY-P7052A
Handling Instructions

Recombinant Human Oncostatin-M, 209a.a. is a polypeptide chain containing 209 amino acids. Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 Get quote
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuOSM; OSM
Species

Human

Source

E. coli

Accession

P13725

Gene ID

5008

Molecular Weight

Approximately 23.8 kDa

AA Sequence

MAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR

Biological Activity
The ED50 is <10 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >1.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Oncostatin-M, 209a.a. (rHuOSM, 209a.a.) to 100 μg/mL using ddH2O or PBS.

Storage & Stability

Lyophilized recombinant Human Oncostatin-M, 209a.a. (rHuOSM, 209a.a.) is stored at -20°C. After reconstitution, it is stable at 4°C for 2 weeks or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Oncostatin M is a cytokine belonging to the IL-6 family that has multiple functions in hematopoiesis, mesenchymal stem cell differentiation, liver regeneration, heart remodeling, nociception, inflammation and metabolism. The full-length Oncostatin M proteins contain between 239 and 263 amino acids which fold into a long-chain four helix-bundle protein with an up-up-down-down topology representative of all other IL-6 family cytokines. Human Oncostatin-M can bind to either the type I receptor complex consisting of gp130 and the LIFR (gp130/LIFRb) or the type II receptor complex consisting of gp130 and the OSMR (gp130/OSMRb). In the murine system Oncostatin-M has been shown to bind with high affinity only to the type II gp130/OSMRb complex[1][2]. Oncostatin-M binds to specific receptor complexes, then activates two major signaling pathways: Janus Kinase-Signal Transducers and Activators of Transcription (JAK-STAT) and Mitogen-Activated Protein Kinase (MAPK), to regulate downstream events[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Oncostatin-M, 209a.a.
Cat. No.:
HY-P7052A
Quantity:
MCE Japan Authorized Agent: