1. Recombinant Proteins
  2. Recombinant Human Osteoprotegerin

Recombinant Human Osteoprotegerin

Cat. No.: HY-P7053
Handling Instructions

Recombinant Human Osteoprotegerin is a decoy receptor for the Receptor Activator of Nuclear Factor-kB ligand (RANKL). It is a member of the TNF receptor superfamily.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $590 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuOPG; Tumor necrosis factor receptor superfamily member 11B; TNFRSF11B; OCIF
Species

Human

Source

CHO

Accession

O00300

Gene ID

4982

Molecular Weight

Approximately 20.7 kDa

AA Sequence

ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Osteoprotegerin (rHuOPG) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Osteoprotegerin (rHuOPG) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Recombinant Human Osteoprotegerin can act as a soluble factor in the regulation of bone mass. It inhibits osteoclast maturation and protects bone from both normal osteoclast remodeling and ovariectomy-associated bone loss[1]. Osteoprotegerin acts as a decoy receptor, binding to RANKL and blocking its interaction with RANK, inhibiting osteoclast development[2]. Osteoprotegerin can promote cell survival, cell proliferation and facilitates migration by binding TNF-related apoptosis inducing ligand (TRAIL), glycosaminoglycans or proteoglycans. A large number of in vitro, pre-clinical and clinical studies provide evidences of Osteoprotegerin involvement in vascular, bone, immune and tumor biology[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Osteoprotegerin
Cat. No.:
HY-P7053
Quantity:
MCE Japan Authorized Agent: