1. Recombinant Proteins
  2. Recombinant Human Pigment Epithelium-derived Factor

Recombinant Human Pigment Epithelium-derived Factor

Cat. No.: HY-P7054
Handling Instructions

Recombinant Human Pigment Epithelium-derived Factor is a secreted glycoprotein and a non-inhibitory member of the serine protease inhibitor (serpin) family.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuPEDF; SerpinF1; EPC-1
Species

Human

Source

E. coli

Accession

P36955

Gene ID

5176

Molecular Weight

Approximately 44.4 kDa

AA Sequence

QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

Biological Activity
The ED50 is <2 ng/mL as measured by human Saos2 cells, corresponding to a specific activity of >5.0 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 150 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Pigment Epithelium-derived Factor (rHuPEDF) to 0.1-1.0 mg/mL using sterile distilled water or aqueous buffer containing 0.1 % BSA.

Storage & Stability

Lyophilized recombinant Human Pigment Epithelium-derived Factor (rHuPEDF) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Pigment Epithelium-derived Factor belongs to the serine protease inhibitor (serpin) family. The Pigment Epithelium-derived Factor gene contains a typical signalpeptide sequence, initiator methionine codon, and polyadenylylation signal and matches the size of other members of the serpin superfamily. Pigment Epithelium-derived Factor is a neurotrophic agent[1]. It is widely expressed in human fetal and adult tissues but its expression decreases with age and in malignant tissues. The main anticancer activities of Pigment Epithelium-derived Factor derive from its dual effects, either indirectly on the tumor microenvironment (indirect antitumor action) or directly on the tumor itself (direct antitumor influence)[2]. Pigment Epithelium-derived Factor has complex neurotrophic, neuroprotective, anti-angiogenic, anti-oxidative, and anti-inflammatory properties, and could potentially be exploited as a therapeutic option for the treatment of vascular complications in diabetes[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Pigment Epithelium-derived Factor
Cat. No.:
HY-P7054
Quantity:
MCE Japan Authorized Agent: