1. Recombinant Proteins
  2. Recombinant Human Stem Cell Factor (P.pastoris-expressed)

Recombinant Human Stem Cell Factor (P.pastoris-expressed)

Cat. No.: HY-P7056
Handling Instructions

Recombinant Human Stem Cell Factor (P.pastoris-expressed), the c-kit ligand, is a two disulfide bridge-containing cytokine in the regulation of the development and function of hematopoietic cell lineages and other cells such as mast cells, germ cells, and melanocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
2 μg $70 In-stock
Estimated Time of Arrival: December 31
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $270 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuSCF; Hematopoietic growth factor KL; MGF; Mast Cell Growth Factor
Species

Human

Source

P. pastoris

Accession

P21583

Gene ID

4254

Molecular Weight

Approximately 20 kDa

AA Sequence

MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Biological Activity
The ED50 is <2 ng/mL as measured by human TF-1 cells, corresponding to a specific activity of 5 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 10 mM acetic acid.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Human Stem Cell Factor (P.pastoris-expressed) (rHuSCF) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Human Stem Cell Factor (P.pastoris-expressed) (rHuSCF) is stored at -20°C. After reconstitution, it is stable at 4°C for 4 weeks or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The recombinant human stem cell factor (rhSCF) protein specifically enhances the viability of human myeloid leukemia cell line TF-1 and the proliferation and maturation of human mast cell line LAD2 cell. Recombinant human SCF (rhSCF) can maintain hematopoietic stem cells and mast cell in culture, and it is widely tested in research into differentiation from embryonic stem cell (ESC)/induced pluripotent stem cell (iPSC)[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Human Stem Cell Factor (P.pastoris-expressed)
Cat. No.:
HY-P7056
Quantity:
MCE Japan Authorized Agent: