1. Recombinant Proteins
  2. Recombinant Mouse Ephrin-B2/EFNB2, Fc-His (HEK293-expressed)

Recombinant Mouse Ephrin-B2/EFNB2, Fc-His (HEK293-expressed)

Cat. No.: HY-P70378
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $50 Ask For Quote & Lead Time
50 μg $150 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuEphrin-B2/EFNB2, Fc-His; Ephrin-B2; ELF-2; EPH-related receptor tyrosine kinase ligand 5; HTK ligand; Elf2; Epl5; Eplg5; Htkl; Lerk5.
Species

Mouse

Source

HEK 293

Accession

P52800

Gene ID

13642

Molecular Weight

Approximately 63.0 kDa

AA Sequence

RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSE

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Mouse Ephrin-B2/EFNB2, Fc-His (HEK293-expressed) (rMuEphrin-B2/EFNB2, Fc-His) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Mouse Ephrin-B2/EFNB2, Fc-His (HEK293-expressed) (rMuEphrin-B2/EFNB2, Fc-His) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Ephrin-B2/EFNB2, Fc-His (HEK293-expressed)
Cat. No.:
HY-P70378
Quantity:
MCE Japan Authorized Agent: