1. Recombinant Proteins
  2. Recombinant Mouse Epidermal Growth Factor

Recombinant Mouse Epidermal Growth Factor

Cat. No.: HY-P7067
Handling Instructions

Recombinant Mouse Epidermal Growth Factor is a small polypeptide that stimulates the proliferation of the epidermis and several epithelial tissues.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
50 μg $70 In-stock
Estimated Time of Arrival: December 31
100 μg $120 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuEGF; Pro-epidermal growth factor; Urogastrone
Species

Mouse

Source

E. coli

Accession

P01132

Gene ID

13645

Molecular Weight

Approximately 6.2 kDa

AA Sequence

MNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

Biological Activity
The ED50 is <0.1ng/mL as measured by BALB/c 3T3 cells, corresponding to a specific activity of >1.0 × 107 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Epidermal Growth Factor (rMuEGF) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Murine Epidermal Growth Factor (rMuEGF) is stored at -20°C. After reconstitution, it is stable at 4°C for 2 weeks or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Epidermal growth factor (EGF) binds to epidermal growth factor receptor and stimulates an intracellular signal transduction cascade, leading to activation of genes that regulate cell proliferation, angiogenesis, motility, and metastasis[1]. Epidermal growth factor (EGF) is initially synthesized as a large precursor of 1217 amino acids that is glycosylated and can be secreted by cells. Epidermal growth factor (EGF) mRNA and protein are expressed in a number of adult tissues, especially in epithelial cells in the gastrointestinal tract. Predominant sites of synthesis of this peptide are the submandibular glands, the Brunner glands in the small intestine and the kidney[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Epidermal Growth Factor
Cat. No.:
HY-P7067
Quantity:
MCE Japan Authorized Agent: