1. Recombinant Proteins
  2. Recombinant Mouse Granulocyte Colony-stimulating Factor (CHO-expressed)

Recombinant Mouse Granulocyte Colony-stimulating Factor (CHO-expressed)

Cat. No.: HY-P7068
Handling Instructions

Recombinant Mouse Granulocyte Colony-stimulating Factor (CHO-expressed) is a polypeptide growth factor that regulates the production of neutrophilic granulocytes.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuG-CSF; CSF-3; MGI-1G; Pluripoietin; Molgramostin; Sargramostim
Species

Mouse

Source

CHO

Accession

P09920

Gene ID

12985

Molecular Weight

22-24 kDa

AA Sequence

VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Biological Activity
The ED50 is <0.02 ng/mL as measured by NFS-60 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Granulocyte Colony-stimulating Factor (CHO-expressed) (rMuG-CSF) to 100 µg/mL using ddH2O or diluted with PBS.

Storage & Stability

Lyophilized recombinant Murine Granulocyte Colony-stimulating Factor (CHO-expressed) (rMuG-CSF) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Granulocyte Colony Stimulating Factor (G-CSF) is a cytokine that normally acts in the bone marrow microenvironment to stimulate blood cell formation. It selectively promotes growth and maturation of neutrophil progenitor cells. Granulocyte Colony Stimulating Factor receptors are present on precursor cells in the bone marrow. By binding to these receptors, Granulocyte Colony Stimulating Factor initiates proliferation and differentiation into mature granulocytes, and also stimulates bone marrow cell release into the circulation. In addition to growth promotion, Granulocyte Colony Stimulating Factor also effects phagocytosis, motility, bactericidal activity and surface molecule expression of neutrophils and monocytes[1][2]. G-CSF production is induced by several inflammatory stimuli that become rapidly elevated during infection such as interleukin-1β (IL-1β), tumor necrosis factor-alpha (TNFα) and lipopolysaccaride (LPS). Therefore, pathogen-mediated activation of host pattern recognition receptors via LPS, and the host cytokine response to infection, serve to induce circulating levels of G-CSF[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Granulocyte Colony-stimulating Factor (CHO-expressed)
Cat. No.:
HY-P7068
Quantity:
MCE Japan Authorized Agent: