1. Recombinant Proteins
  2. Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)

Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)

Cat. No.: HY-P7069
Handling Instructions

Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed) is a hematopoietic growth factor and immune modulator.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Publications Citing Use of MCE Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuGM-CSF; CSF-2; MGI-1GM; Pluripoietin-alpha; Molgramostin; Sargramostim
Species

Mouse

Source

CHO

Accession

P01587

Gene ID

12981

Molecular Weight

15-19 kDa

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK

Biological Activity
The ED50 is <0.05 ng/mL as measured by mouse FDC-P1 cells, corresponding to a specific activity of >2 × 107 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed) (rMuGM-CSF) to 100 µg/mL using ddH2O or diluted with PBS.

Storage & Stability

Lyophilized recombinant Murine Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed) (rMuGM-CSF) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Granulocyte-macrophage colony-stimulating factor (GM-CSF) is produced by a variety of cell types including T cells, macrophages, endothelial cells and fibroblasts upon receiving immune stimuli. It is an important hematopoietic growth factor and immune modulator. GM-CSF also has profound effects on the functional activities of various circulating leukocytes. GM-CSF stimulates multipotent progenitor cells depending on its concentration, the proliferation of macrophage progenitors at the lowest doses, followed by granulocyte, erythroid, eosinophil, megakaryocyte and multipotent progenitors. It also stimulates the differentiation of myeloid leukemic cells and controls eosinophil function in some instances[1][2]. GM-CSF also enhances the functionality of mature cells, such as neutrophils. In neutrophils, GM-CSF potentiates degranulation, the release of oxygen and nitrogen radical ions, phagocytosis, and inhibits apoptosis[3]. GM-CSF inhibition in some animal models of autoimmune diseases showed significant beneficial effects[4]. GM-CSF also has many pro-inflammatory functions and recent data implicates GM-CSF as a key factor in Th17 driven autoimmune inflammatory conditions[5].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Granulocyte-Macrophage Colony Stimulating Factor (CHO-expressed)
Cat. No.:
HY-P7069
Quantity:
MCE Japan Authorized Agent: