1. Recombinant Proteins
  2. Recombinant Mouse Interleukin-1 alpha

Recombinant Mouse Interleukin-1 alpha

Cat. No.: HY-P7072
Handling Instructions

Recombinant Murine Interleukin-1 alpha, a potent immuno-modulator that mediates a wide range of immune and inflammatory responses.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $560 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-1α; Hematopoietin-1; IL1A; IL1F1; IL-1 alpha
Species

Mouse

Source

E. coli

Accession

P01582

Gene ID

16175

Molecular Weight

Approximately 17.9 kDa

AA Sequence

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Biological Activity
The ED50 is <2 pg/mL as measured by murine D10S cells, corresponding to a specific activity of >5.0 × 108 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Interleukin-1 alpha (rMuIL-1α) to 0.1-1.0 mg/mL using sterile distilled water or aqueous buffer containing 0.1 % BSA.

Storage & Stability

Lyophilized recombinant Murine Interleukin-1 alpha (rMuIL-1α) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-1 (IL-1) is a family of related peptides that are produced by mononuclear phagocytes and other cell types that have been stimulated by microbes or various microbial products. IL-1 has been shown to initiate or augment a number of biological responses that are proinflammatory in nature. Recombinant Murine Interleukin-1 alpha is a non-glycosylated polypeptide chain containing 156 amino acids and having a molecular mass of 17.9 kDa. Treatment with recombinant murine interleukin-1 alpha (rIL-1 alpha) significantly enhances the resistance of mice to infection by the facultative intracellular pathogen Listeria monocytogenes[1]. Members of the IL-1 family such as IL-1α and IL-1β are pro-inflammatory cytokines. Increased IL-1α and IL-1β levels have been detected separately in cigarette smoke (CS)-treated animals and inhibition of the respective signaling pathways result in anti-inflammatory activity[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Interleukin-1 alpha
Cat. No.:
HY-P7072
Quantity:
MCE Japan Authorized Agent: