1. Recombinant Proteins
  2. Recombinant Mouse Interleukin-10 (CHO-expressed)

Recombinant Mouse Interleukin-10 (CHO-expressed)

Cat. No.: HY-P7074A
Handling Instructions

Recombinant Mouse Interleukin-10 (CHO-expressed) is a potent CHO cell derived anti-inflammatory cytokine results in increased immune-mediated demyelination in mice infected with a neurotropic coronavirus.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $620 In-stock
Estimated Time of Arrival: December 31
100 μg $1050 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-10; CSIF
Species

Mouse

Source

CHO

Accession

P18893

Gene ID

16153

Molecular Weight

21-23 kDa

AA Sequence

SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS

Biological Activity
The ED50 is <0.2 ng/mL as measured by MC/9 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Interleukin-10 (CHO-expressed) (rMuIL-10) to 100 µg/mL using ddH2O or diluted with PBS.

Storage & Stability

Lyophilized recombinant Murine Interleukin-10 (CHO-expressed) (rMuIL-10) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The anti-inflammatory cytokine interleukin-10 (IL-10) is a pleiotropic cytokine that is produced in abundant quantities during most parasitic, bacterial, viral, and fungal diseases. IL-10 functions by dampening the innate or very early T cell immune response. Treatment with IL-10 may be useful adjunct therapy in some types of viral encephalitis. IL-10 primarily acts to suppress macrophages and dendritic cell (DC) function by inhibiting expression of major histocompatibility complex (MHC) class II and costimulatory molecules such as CD80/CD86 and production of proinflammatory cytokines and chemokines, including IL-12. IL-10 also has direct effects on T cells, inhibiting activation and cytokine expression. Production of IL-10 by highly activated virus-specific T cells raises the possibility that IL-10 functions via both autocrine and paracrine signaling to limit inflammation during acute phases of the disease[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Interleukin-10 (CHO-expressed)
Cat. No.:
HY-P7074A
Quantity:
MCE Japan Authorized Agent: