1. Recombinant Proteins
  2. Recombinant Mouse Interleukin-11/IL-11, Fc (HEK293-expressed)

Recombinant Mouse Interleukin-11/IL-11, Fc (HEK293-expressed)

Cat. No.: HY-P70356
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $120 Ask For Quote & Lead Time
50 μg $360 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuInterleukin-11/IL-11, Fc ; Interleukin-11; Il11; IL-11
Species

Mouse

Source

HEK 293

Accession

P47873

Gene ID

16156

Molecular Weight

50-60 kDa

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mMHAc-NaAc, 150 mM NaCl, 0.004 Tween80, 5% Mannitol, pH 4.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Mouse Interleukin-11/IL-11, Fc (HEK293-expressed) (rMuInterleukin-11/IL-11, Fc) to 100 µg/mL using ddH2O.

Storage & Stability

Lyophilized recombinant Mouse Interleukin-11/IL-11, Fc (HEK293-expressed) (rMuInterleukin-11/IL-11, Fc) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Interleukin-11/IL-11, Fc (HEK293-expressed)
Cat. No.:
HY-P70356
Quantity:
MCE Japan Authorized Agent: