1. Recombinant Proteins
  2. Recombinant Mouse Interleukin-22

Recombinant Mouse Interleukin-22

Cat. No.: HY-P7079
Handling Instructions

Recombinant Mouse Interleukin-22 plays a prominent role in epithelial regeneration and dampening of chronic inflammatory responses by protecting intestinal stem cells from immune-mediated tissue damage.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $220 In-stock
Estimated Time of Arrival: December 31
50 μg $690 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuIL-22; Cytokine Zcyto 18; IL-TIF
Species

Mouse

Source

E. coli

Accession

Q9JJY9

Gene ID

50929

Molecular Weight

Approximately 16.8 kDa

AA Sequence

LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

Biological Activity
The ED50 is <0.5 ng/mL as measured by Colo205 cells.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

Reconstitute the lyophilized recombinant Murine Interleukin-22 (rMuIL-22) to 100 µg/mL using ddH2O or PBS.

Storage & Stability

Lyophilized recombinant Murine Interleukin-22 (rMuIL-22) is stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Interleukin-22 (IL-22) is a member of the IL-10 family of cytokines, expressed predominantly by subsets of innate lymphoid cells (ILCs) and activated T cells, including T helper 1 (TH1) cells, TH17 cells and TH22 cells. IL-22 can be recognized by a heterodimeric receptor complex that consists of two transmembrane subunits: IL-22R1 and IL-10R2. The binding of IL-22 to its receptor activates the JAK/STAT and MAPK signaling pathway, resulting in gene expression or repression. Since the IL-10R2 is shared by five cytokines (IL-10, IL-22, IL-26, IL-28, and IL-29) and is widely expressed in most cells, the expression of the IL-22R1 determines whether a cell is the target of IL-22. IL-22 has a considerable therapeutic potential in graft-versus-host disease (GVHD), which is a frequent and challenging complication following allogeneic stem cell transplantation[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Recombinant Mouse Interleukin-22
Cat. No.:
HY-P7079
Quantity:
MCE Japan Authorized Agent: