SKP2 Protein, Human (His-SUMO)

SKP2 serves as a substrate recognition component in the SCF E3 ubiquitin-protein ligase complex, directing ubiquitination and proteasomal degradation of key proteins in the cell cycle, signaling, and transcription. It crucially recognizes phosphorylated CDKN1B/p27kip and regulates the G1/S transition. SKP2 Protein, Human (His-SUMO) is the recombinant human-derived SKP2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of SKP2 Protein, Human (His-SUMO) is 424 a.a., with molecular weight of ~63.8 kDa.

SKP2 serves as the substrate recognition component within the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex, orchestrating the ubiquitination and subsequent proteasomal degradation of target proteins pivotal in cell cycle progression, signal transduction, and transcription. It specifically recognizes phosphorylated CDKN1B/p27kip, playing a crucial role in the regulation of the G1/S transition. SKP2's substrate spectrum encompasses proteins like ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9, RAG2, FOXO1, UBP43, YTHDF2, MYC, TOB1, and TAL1, among others. Additionally, SKP2 is involved in the ubiquitin-mediated proteasomal degradation of hepatitis C virus non-structural protein 5A, displaying antiviral activity against the virus. The complex nature of SKP2's interactions underscores its significance in governing diverse cellular processes through targeted protein degradation.

Human

E. coli

N-SUMO;N-6*His

Q13309 (M1-L424)

6502  [NCBI]

MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQKPSCL

Approximately 63.8 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.