1. Recombinant Proteins
  2. Somatotropin/GH Protein, Mouse

Somatotropin/GH Protein, Mouse

Cat. No.: HY-P70261
Handling Instructions

Somatotropin/GH Protein, Mouse is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the growth disorders research.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $120 In-stock
Estimated Time of Arrival: December 31
50 μg $360 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuSomatotropin/GH; Somatotropin; Growth Hormone; Gh1; Gh
Species

Mouse

Source

E. coli

Accession

P06880 (F27-F216)

Gene ID

14599

Molecular Weight

Approximately 20.0 kDa

AA Sequence

FPAMPLSSLFSNAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRVGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Growth Hormone (Somatotropin) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration, which can be used for the treatment of growth disorders in children[1]. Growth Hormone is a stress hormone that stimulates production of IGF-1 and raises the concentration of glucose and free fatty acids[2]. Growth Hormone exerts some of its effects by binding to receptors on target cells, where it activates the MAPK/ERK pathway[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Somatotropin/GH Protein, Mouse
Cat. No.:
HY-P70261
Quantity:
MCE Japan Authorized Agent: