1. Recombinant Proteins
  2. TGFB1, Mouse/Rat (HEK293)

TGFB1, Mouse/Rat (HEK293)

Cat. No.: HY-P70648
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $350 In-stock
Estimated Time of Arrival: December 31
50 μg $1050 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP; latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1; TGF-β1; TGF beta1; TGFbeta 1; TGF-beta 1; TGFbeta
Species

Mouse

Source

HEK 293

Accession

P04202

Gene ID

21803

Molecular Weight

Approximately 13.0 kDa

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
The ability to inhibit IL-4-dependent proliferation of TF-1 human erythroleukemic cells has an ED50 value of 5-25 pg/mL.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Reconstitute at 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TGFB1, Mouse/Rat (HEK293)
Cat. No.:
HY-P70648
Quantity:
MCE Japan Authorized Agent: