1. Recombinant Proteins
  2. TNF-alpha/TNFSF2 Protein, Mouse (156a.a, His)

TNF-alpha/TNFSF2 Protein, Mouse (156a.a, His)

Cat. No.: HY-P7090B
Handling Instructions

TNF-alpha/TNFSF2 Protein, Mouse (156a.a, His) is a strong pro-inflammatory cytokine, effective in the immune system during inflammation, cell proliferation, differentiation and apoptosis.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
2 μg $50 In-stock
Estimated Time of Arrival: December 31
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $440 In-stock
Estimated Time of Arrival: December 31
100 μg $750 In-stock
Estimated Time of Arrival: December 31
250 μg   Get quote  

* Please select Quantity before adding items.

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TNF-alpha/TNFSF2 Protein, Mouse (156a.a, His) is a strong pro-inflammatory cytokine, effective in the immune system during inflammation, cell proliferation, differentiation and apoptosis.

Background

Tumor necrosis factor α (TNF-α, also known as cachectin) is a strong pro-inflammatory cytokine playing an important role in the immune system during inflammation, cell proliferation, differentiation and apoptosis. TNF-α is type II transmembrane protein that can be expressed in both membrane-bound and secreted forms. Receptors for TNF-a are part of TNF receptor (TNFR) superfamily, with characteristic intracellular segment, a transmembrane domain, and an extracellular ligand-binding domain. They are type I transmembrane glycoproteins characterized by a cysteinerich motif (up to 40 aminoacids) repeated 2-6 times in the extracellular N-terminal domain[1].

Biological Activity
Measured by its binding ability in a cytotoxicity assay using L‑929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D.The ED50 for this effect is 53.92 pg/mL.
Species

Mouse

Source

E. coli

Accession

P06804 (L80-L235)

Gene ID
Synonyms
rMuTNF-α/TNFSF2; TNF-alpha; Cachectin; DIF; TNFA; Differentiation-inducing factor
AA Sequence

LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Molecular Weight

Approximately 19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01%Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-alpha/TNFSF2 Protein, Mouse (156a.a, His)
Cat. No.:
HY-P7090B
Quantity:
MCE Japan Authorized Agent: