1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. TNF Superfamily NK Cell CD Proteins
  4. TNF Superfamily Ligands CD253/TRAIL
  5. TRAIL Proteins
  6. TRAIL/TNFSF10 Protein, Mouse (His,Solution)

TRAIL/TNFSF10 Protein, Mouse (His,Solution)

Cat. No.: HY-P7089
COA Handling Instructions

TRAIL Protein (TNFSF10), a member of the TNF superfamily, is a type II transmembrane protein. TRAIL Protein mainly interacts with TRAIL-R1 and TRAIL-R2, and induces apoptosis in tumor or infected cells. TRAIL Protein also binds with DR4, DR5, and OPG. TRAIL Protein can recruit FADD and further recruit and activates caspase-8 after binding to DR4 or DR5. Besides, TRAIL may also trigger nonapoptotic signaling through activating pro-inflammatory pathways. TRAIL protein is mainly expressed on surface of immune cells, such as cytotoxic T cells and natural killer (NK) cell. TRAIL/TNFSF10 Protein, Mouse (His) is a recombinant mouse TRAIL (P118-N291) with N-terminal His tag, which is expressed in E.coli.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
50 μg $365 Ask For Quote & Lead Time
100 μg $620 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TRAIL Protein (TNFSF10), a member of the TNF superfamily, is a type II transmembrane protein. TRAIL Protein mainly interacts with TRAIL-R1 and TRAIL-R2, and induces apoptosis in tumor or infected cells. TRAIL Protein also binds with DR4, DR5, and OPG. TRAIL Protein can recruit FADD and further recruit and activates caspase-8 after binding to DR4 or DR5. Besides, TRAIL may also trigger nonapoptotic signaling through activating pro-inflammatory pathways[1][2]. TRAIL protein is mainly expressed on surface of immune cells, such as cytotoxic T cells and natural killer (NK) cell[1]. TRAIL/TNFSF10 Protein, Mouse (His) is a recombinant mouse TRAIL (P118-N291) with N-terminal His tag, which is expressed in E.coli.

Background

TRAIL Protein (TNFSF10), a member of the TNF superfamily, is a type II transmembrane protein. TRAIL Protein is expressed in various tissues, especially in the spleen, lung, and prostate. TRAIL protein is mainly expressed on surface of immune cells, such as cytotoxic T cells and natural killer (NK) cell. TRAIL proteins on NK and T cells is critical for controlling virus infections and tumor immune surveillance[1][2].
Mouse TRAIL consists of cytoplasmic domain (M1-R17), helical domain (M18-T38), and extracellular domain (Y39-N291).Mouse TRAIL Protein shares < 70% common aa identity with human. Mouse TRAIL Protein shares 86.94% common aa identity with rat.
TRAIL Protein mainly interacts with two agonistic TRAIL receptors (TRAIL-R1 and TRAIL-R2) and induces apoptosis in tumor or infected cells. TRAIL Protein also binds with DR4, DR5, and OPG. When binding to DR4 or DR5, TRAIL Protein can recruit FADD and further recruit and activates caspase-8. Besides, TRAIL may also trigger nonapoptotic signaling through activating pro-inflammatory pathways, such as NF-κB, PI3K/Akt, and MAPK pathway[1][2].
TRAIL induces apoptosis of tumor cells in a p53 independent manner. TRAIL-based therapies has high anti-tumor potential[3].

In Vitro

TRAIL (mouse, -3 ng/mL, 6 d) results in the release of substantial amounts of IL-13 and IL-5 from PBLN cells isolated from mice[4].

In Vivo

TRAIL (mouse, 1 μg, i.n.) induces the accumulation of both mDCs (MHCIIlow) and CD4+ T cells in Wild-type mice[4].

Species

Mouse

Source

E. coli

Tag

N-His

Accession

P50592 (P118-N291)

Gene ID

22035  [NCBI]

Molecular Construction
N-term
His
TRAIL (P118-N291)
Accession # P50592
C-term
Synonyms
rMuTRAIL/TNFSF10; TNF-related apoptosis-inducing ligand; Tumor necrosis factor ligand superfamily member 10
AA Sequence

PRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Molecular Weight

Approximately 22.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAIL/TNFSF10 Protein, Mouse (His,Solution)
Cat. No.:
HY-P7089
Quantity:
MCE Japan Authorized Agent: