1. Recombinant Proteins
  2. TRAIL/TNFSF10 Protein, Mouse (His)

TRAIL/TNFSF10 Protein, Mouse (His)

Cat. No.: HY-P7089
Handling Instructions

TRAIL/TNFSF10 Protein, Mouse, also called Apo2L, is a member of the tumor necrosis factor (TNF) family of ligands which can innitiate apoptosis through engagement of its death receptors.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuTRAIL/TNFSF10; TNF-related apoptosis-inducing ligand; Tumor necrosis factor ligand superfamily member 10
Species

Mouse

Source

E. coli

Accession

P50592 (P118-N291)

Gene ID

22035

Molecular Weight

Approximately 22.0 kDa

AA Sequence

MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.5.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

TNF-related apoptosis-inducing Ligand (TRAIL, Apo-2L) is a 281-amino acid protein, related most closely to Fas/Apo-1 ligand. Soluble Apo-2L induces extensive apoptosis in lymphoid as well as non-lymphoid tumor cell lines[1]. TRAIL induces apoptosis through interacting with its receptors. Four homologous human receptors for TRAIL have been identified, including DR4, KILLER/DR5, TRID/DcR1/TRAIL-R3, and TRAIL-R4/DcR2, as well as a fifth soluble receptor called osteoprotegerin (OPG), which was identified initially as a receptor for RANKL/OPGL and was shown later to bind TRAIL. TRAIL selectively induces apoptosis of a variety of tumor cells and transformed cells, but not most normal cells, and therefore has garnered intense interest as a promising agent for cancer therapy. TRAIL is expressed on different cells of the immune system and plays a role in both T-cell- and natural killer cell-mediated tumor surveillance and suppression of suppressing tumor metastasis[2]. Apo2L/TRAIL initiates apoptosis upon binding to its cognate death receptors by inducing the recruitment of specific cytoplasmic proteins to the intracellular death domain of the receptor, which form the death-inducing signaling complex[3].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRAIL/TNFSF10 Protein, Mouse (His)
Cat. No.:
HY-P7089
Quantity:
MCE Japan Authorized Agent: