TXNDC17 Protein, Human

TXNDC17 Protein is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. And it inhibits the pathways of NF-κB, mitogen-activated protein kinases, and apoptosis in cells stimulated with TNF-alpha. Furthermore, TXNDC17 is an efficient S-denitrosylase. TXNDC17 Protein, Human is the recombinant human-derived TXNDC17 protein, expressed by E. coli , with tag free. The total length of TXNDC17 Protein, Human is 123 a.a., with molecular weight of ~13.9 kDa.

Thioredoxin domain-containing protein 17 (TXNDC17) is a novel 14-kDa disul-fide reductase of the TXN (thioredoxin) family. It has peroxidase activity and protein-disulfide reductase (NAD(P)) activity. TXNDC17 is involved in the TNF (tumor necrosis factor) signaling pathway. TXNDC17 inhibits the pathways of nuclear factor-kappaB (NF-kappaB), mitogen-activated protein kinases, and apoptosis in cells stimulated with tumor necrosis factor-alpha (TNF-alpha). In addition, TXNDC17 is an efficient S-denitrosylase with similar efficiency as Trx1 in catalyzing TrxR1-dependent denitrosylation of S-nitrosylated glutathione or of HEK293 cell-derived S-nitrosoproteins^[1][2].

Human

E. coli

Tag Free

A0A140VJY7 (M1-D123)

84817  [NCBI]

MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Approximately 13.9 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.