1. Search Result

Search Result

Results for "A-Kinase-Anchoring Proteins Peptides Inhibitors" in MCE Product Catalog:

9441

Inhibitors & Agonists

61

Screening Libraries

77

Dye Reagents

24

Biochemical Assay Reagents

1070

Peptides

22

MCE Kits

12

Inhibitory Antibodies

1436

Natural
Products

Cat. No. Product Name Target Research Areas
  • HY-U00439
    Protein kinase inhibitors 1

    DYRK Cancer
    Protein kinase inhibitors 1 is a novel inhibitor of HIPK2 with an IC50 of 74 nM and Kd of 9.5 nM.
  • HY-70027A
    p53 and MDM2 proteins-interaction-inhibitor dihydrochloride

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor dihydrochloride is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-P1376
    G-Protein antagonist peptide

    mAChR Adrenergic Receptor Endocrinology
    G-Protein antagonist peptide is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide competitively and reversibly inhibits M2 muscarinic receptor activation of Gi or Go and inhibits Gs activation by β-adrenoceptors.
  • HY-70027
    p53 and MDM2 proteins-interaction-inhibitor (chiral)

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor (chiral) (Compound 32) is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-P1376A
    G-Protein antagonist peptide TFA

    mAChR Adrenergic Receptor Endocrinology
    G-Protein antagonist peptide TFA is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide TFA competitively and reversibly inhibits M2 muscarinic receptor activation of Gi or Go and inhibits Gs activation by β-adrenoceptors.
  • HY-70028
    p53 and MDM2 proteins-interaction-inhibitor (racemic)

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor (racemic) (Compound 2j) is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-P1344A
    DAPK Substrate Peptide TFA

    DAPK Cancer
    DAPK Substrate Peptide TFA is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM.
  • HY-125586
    β-Amanitin

    DNA/RNA Synthesis ADC Cytotoxin Cancer
    β-Amanitin is a cyclic peptide toxin in the poisonous Amanita phalloides mushroom. β-Amanitin inhibits inhibits eukaryotic RNA polymerase II and III. β-Amanitin inhibits protein synthesis. β-Amanitin can be used as a cytotoxic component of antibody-drug conjugates (ADCs).
  • HY-P0281A
    TAT TFA

    HIV Infection
    TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins.
  • HY-P0281
    TAT

    HIV Infection
    TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins.
  • HY-U00439A
    Protein kinase inhibitors 1 hydrochloride

    (E)-5-((2-Oxo-6'-(piperazin-1-yl)-1,2-dihydro-[3,3'-bipyridin]-5-yl)methylene)thiazolidine-2,4-dione hydrochloride

    DYRK Cancer
    Protein kinase inhibitors 1 hydrochloride is a potent HIPK2 inhibitor, with IC50s of 136 and 74 nM for HIPK1 and HIPK2, and a Kd of 9.5 nM for HIPK2.
  • HY-P1247
    Calcineurin autoinhibitory peptide

    Phosphatase Neurological Disease
    Calcineurin autoinhibitory peptide is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide could protect neurons from excitatory neuronal death.
  • HY-P1289
    [Ala113]MBP(104-118)

    PKC Others
    [Ala113]MBP(104-118) is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 28-62 μM.
  • HY-P1289A
    [Ala107]MBP(104-118)

    PKC Others
    [Ala107]MBP(104-118) is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 46-145 μM.
  • HY-107024
    Osteogenic Growth Peptide (10-14)

    OGP(10-14); Historphin

    Src Others
    Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor.
  • HY-P1289C
    [Ala113]MBP(104-118) TFA

    PKC Others
    [Ala113]MBP(104-118) TFA is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 28-62 μM.
  • HY-P1289B
    [Ala107]MBP(104-118) TFA

    PKC Others
    [Ala107]MBP(104-118) TFA is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 46-145 μM.
  • HY-P1247A
    Calcineurin autoinhibitory peptide TFA

    Phosphatase Neurological Disease
    Calcineurin autoinhibitory peptide TFA is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide TFA could protect neurons from excitatory neuronal death.
  • HY-P1045
    187-1, N-WASP inhibitor

    Arp2/3 Complex Others
    187-1, N-WASP inhibitor, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein.
  • HY-P1045A
    187-1, N-WASP inhibitor TFA

    Arp2/3 Complex Others
    187-1, N-WASP inhibitor TFA, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor TFA potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor TFA prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein.
  • HY-P2457
    rCRAMP (rat)

    Bacterial Infection Inflammation/Immunology
    rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS.
  • HY-114174
    Fmoc-Ala-Glu-Asn-Lys-NH2

    Amyloid-β Neurological Disease
    Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing and mediates APP proteolytic processing.
  • HY-P1051
    β-amyloid (12-28)

    Amyloid β-Protein (12-28)

    Amyloid-β Neurological Disease
    β-amyloid (12-28) is a peptide fragment of β-amyloid protein (β1-42). β1–42 a 42 amino acid protein , is the major component of senile plaque cores. β-amyloid (12-28) shows aggregation properties. β-amyloid (12-28) has the potential for Alzheimer’s disease research.
  • HY-P1051A
    β-amyloid (12-28) (TFA)

    Amyloid β-Protein (12-28) (TFA)

    Amyloid-β Neurological Disease
    β-amyloid (12-28) TFA is a peptide fragment of β-amyloid protein (β1-42). β1–42 a 42 amino acid protein , is the major component of senile plaque cores. β-amyloid (12-28) shows aggregation properties. β-amyloid (12-28) has the potential for Alzheimer’s disease research.
  • HY-P0274
    PGLa

    Bacterial Antibiotic Infection
    PGLa, a 21-residue peptide, is an antimicrobial peptide. PGLa is a member of the magainin family of antibiotic peptides found in frog skin and its secretions.
  • HY-P0274A
    PGLa TFA

    Bacterial Antibiotic Infection
    PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of antibiotic peptides found in frog skin and its secretions.
  • HY-P3108
    Alamandine

    Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through anti-hypertensive actions.
  • HY-B0239
    Chloramphenicol

    Bacterial Antibiotic Infection
    Chloramphenicol, a broad-spectrum antibiotic, acts as a potent inhibitor of bacterial protein biosynthesis. Chloramphenicol acts primarily on the 50S subunit of bacterial 70S rihosomes and inhibits peptide bond formation by suppressing peptidyl transferase activity.
  • HY-P1481
    β-Casomorphin, human

    Human β-casomorphin 7

    Opioid Receptor Metabolic Disease
    is an opioid peptide, acts as an agonist of opioid receptor.
  • HY-W015977
    Prion Protein 106-126 (human)

    PrP 106-126 (human)

    Apoptosis Neurological Disease
    Prion Protein 106-126 (human), a peptide fragment of prion, and can induct neuronal apoptosis, antiproteinase K digestion, fiber formation, and mediate the conversion of normal cellular prion protein (PrP c) into pathogenic isoform (PrP Sc). Prion Protein 106-126 (human) is generally used as the model to investigate neural degeneration of prion disease.
  • HY-131005
    Ehp inhibitor 2

    Ephrin Receptor Cancer
    Ehp inhibitor 2 is a Eph family tyrosine kinase inhibitor.
  • HY-P2244A
    YAP-TEAD-IN-1 TFA

    YAP Cancer
    YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM).
  • HY-19313
    LLY-507

    Histone Methyltransferase Cancer
    LLY-507 is a potent and selective inhibitor of protein-lysine methyltransferase SMYD2. LLY-507 potently inhibits the ability of SMYD2 to methylate p53 peptide with an IC50 <15 nM. LLY-507 serves as a valuable chemical probe to aid in the dissection of SMYD2 function in cancer and other biological processes.
  • HY-131092
    H-Asn-Arg-OH

    Others Others
    H-Asn-Arg-OH is used for the solid-phase peptide synthesis.
  • HY-P1401
    Protein Kinase C (19-36)

    PKC Metabolic Disease
    Protein Kinase C (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (PKC), with an IC50 of 0.18 μM. Protein Kinase C (19-36) markedly attenuated vascular hyperproliferation and hypertrophy as well as glucose-induced suppression of natriuretic peptide receptor response.
  • HY-131094
    H-Gly-D-Tyr-OH

    Others Others
    H-Gly-D-Tyr-OH is used for the the solid-phase peptide synthesis.
  • HY-103374
    Phenserine

    (-)-Eseroline phenylcarbamate; (-)-Phenserine

    AChE Amyloid-β Neurological Disease
    Phenserine ((-)-Eseroline phenylcarbamate) is a derivative of Physostigmine and is a potent, noncompetitive, long-acting and selective AChE inhibitor. Phenserine reduces β-amyloid precursor protein (APP) and β-amyloid peptide (Aβ) formation. Phenserine improves cognitive performance and attenuates the progression of Alzheimer's disease.
  • HY-18962
    AMI-1

    Histone Methyltransferase Cancer
    AMI-1 is a potent, cell-permeable and reversible inhibitor of protein arginine N-methyltransferases (PRMTs), with IC50s of 8.8 μM and 3.0 μM for human PRMT1 and yeast-Hmt1p, respectively. AMI-1 exerts PRMTs inhibitory effects by blocking peptide-substrate binding.
  • HY-P1746A
    Protein Kinase C (19-31) (TFA)

    PKC (19-31) (TFA)

    PKC Inflammation/Immunology
    Protein Kinase C (19-31) TFA, a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31) with a serine at position 25 replacing the wild-type alanine, is used as protein kinase C substrate peptide for testing the protein kinase C activity. Protein kinase C (PKC) TFA is involved in controlling the function of other proteins through the phosphorylation of hydroxyl groups of serine and threonine amino acid residues on these proteins.
  • HY-P1746
    Protein Kinase C (19-31)

    PKC (19-31)

    PKC Inflammation/Immunology
    Protein Kinase C (19-31), a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31) with a serine at position 25 replacing the wild-type alanine, is used as protein kinase C substrate peptide for testing the protein kinase C activity. Protein kinase C (PKC) is involved in controlling the function of other proteins through the phosphorylation of hydroxyl groups of serine and threonine amino acid residues on these proteins.
  • HY-P1481A
    β-Casomorphin, human TFA

    Human β-casomorphin 7 TFA

    Opioid Receptor Metabolic Disease Neurological Disease
    β-Casomorphin, human TFA (Human β-casomorphin 7 TFA) is an opioid peptide, acts as an agonist of opioid receptor.
  • HY-18962A
    AMI-1 free acid

    Histone Methyltransferase Cancer
    AMI-1 free acid is a potent, cell-permeable and reversible inhibitor of protein arginine N-methyltransferases (PRMTs), with IC50s of 8.8 μM and 3.0 μM for human PRMT1 and yeast-Hmt1p, respectively. AMI-1 free acid exerts PRMTs inhibitory effects by blocking peptide-substrate binding.
  • HY-P2203
    SAHM1

    Notch
    SAHM1 is a Notch pathway inhibitor. SAHM1 stabilizes hydrocarbon-stapled alpha helical peptide. SAHM1 targets the protein-protein interface and prevents Notch complex assembly.
  • HY-W013478
    PTP inhibitor 1

    Phosphatase Cancer
    PTP inhibitor 1 is a protein tyrosine phosphatase (PTP) inhibitor, with anti-angiogenic effect.
  • HY-P1929
    Bivalirudin

    Thrombin Cardiovascular Disease
    Bivalirudin, a peptide anticoagulant, is a direct thrombin inhibitor for anticoagulation in the setting of invasive cardiology, particularly percutaneous coronary intervention.
  • HY-P0179
    β-Casomorphin, bovine

    β-Casomorphin-7 (bovine); Bovine β-casomorphin-7

    Opioid Receptor Metabolic Disease Neurological Disease
    β-Casomorphin, bovine (β-Casomorphin-7 (bovine) ) is a opioid peptide with an IC50 of 14 μM in an Opioid receptors binding assay.
  • HY-121879
    SHP836

    Phosphatase Cancer
    SHP836 is a SHP2 allosteric inhibitor, with an IC50 of 12 μM for the full length SHP2.
  • HY-P1486
    Angiotensinogen (1-14), human

    Endogenous Metabolite Cardiovascular Disease
    Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides.
  • HY-P0179A
    β-Casomorphin, bovine TFA

    β-Casomorphin-7 (bovine) (TFA); Bovine β-casomorphin-7 TFA

    Opioid Receptor Metabolic Disease Neurological Disease
    β-Casomorphin, bovine TFA (β-Casomorphin-7 (bovine) TFA) is a opioid peptide with an IC50 of 14 μM in an Opioid receptors binding assay.
  • HY-125837A
    MS31 trihydrochloride

    Epigenetic Reader Domain Cancer
    MS31 trihydrochloride is a potent, highly affinity and selective fragment-like methyllysine reader protein spindlin 1 (SPIN1) inhibitor. MS31 trihydrochloride potently inhibits the interactions between SPIN1 and H3K4me3 (IC50=77 nM, AlphaLISA; 243 nM, FP). MS31 trihydrochloride selectively binds Tudor domain II of SPIN1 (Kd=91 nM). MS31 trihydrochloride potently inhibits binding of trimethyllysine-containing peptides to SPIN1, and is not toxic to nontumorigenic cells.
  • HY-P0222
    PKI(5-24)

    PKA Others
    PKI(5-24) is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor.
  • HY-15847
    HS38

    DAPK Cardiovascular Disease
    HS38 is a potent, selective, and ATP-competitive inhibitor of death-associated protein kinase 1 (DAPK1) and zipper-interacting protein kinase (ZIPK, also called DAPK3), with Kds of 300 nM and 280 nM, respectively. HS38 is also a PIM3 inhibitor with an IC50 of 200 nM. HS38 can be used for the research of smooth muscle related disorders.
  • HY-P2292A
    Omiganan-FITC TFA

    Bacterial Fungal Infection
    Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
  • HY-128113
    AG-09/1

    Others Inflammation/Immunology
    AG-09/1 is a specific formyl peptide receptor 1 (FPR1) agonist. N-formyl peptide receptors (FPR) are important in host defense.
  • HY-P2244
    YAP-TEAD-IN-1

    YAP Cancer
    YAP-TEAD-IN-1 is a potent and competitive inhibitor of YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM).
  • HY-N2403
    Dihydrolycorine

    Others Neurological Disease
    Dihydrolycorine, isolated from Lycoris radiate Herb, is an inhibitor of protein synthesis in eukarytic cells by inhibiting the peptide bone formation step.
  • HY-P0136
    SAMS

    AMPK Metabolic Disease
    SAMS peptide is a specific substrate for the AMP-activated protein kinase (AMPK).
  • HY-131083
    ε-Amanitin

    DNA/RNA Synthesis ADC Cytotoxin Cancer
    ε-Amanitin, a cyclic peptide isolated from a variety of mushroom species, potently binds to and inhibits the activity of RNA polymerase II.
  • HY-P2260
    Tat-beclin 1

    Autophagy HIV Infection
    Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
  • HY-103700B
    (Rac)-Azide-phenylalanine

    Others Others
    (Rac)-Azide-phenylalanine is a racemate of Azide-phenylalanine. Azide-phenylalanine is a phenylalanine derivative and a non-natural amino acid. Azide-phenylalanine can be site-specifically incorporated into proteins and used to label proteins.
  • HY-P0222A
    PKI(5-24) TFA

    PKA Others
    PKI(5-24) TFA is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) TFA corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor.
  • HY-P2292
    Omiganan-FITC

    Bacterial Fungal Infection
    Omiganan-FITC is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines.
  • HY-129167
    Menin-MLL inhibitor 4

    Epigenetic Reader Domain Cancer
    Menin-MLL inhibitor 4 is an inhibitor of Menin- MLL (mixed-lineage leukemia protein) interaction extracted from patent WO2017214367, compound example 1. Menin-MLL inhibitor 4 has antitumor activity.
  • HY-131326
    DOTA-tris(tBu)ester NHS ester

    Others Cancer
    DOTA-tris(tBu)ester NHS ester is a derivative of DOTA for the labeling of peptides and antibodies.
  • HY-P2283
    Amyloid β-Peptide (1-37) (human)

    Amyloid-β
    Amyloid β-Peptide (1-37) (human) is an amyloid β-protein fragment cleaved from amyloid precursor protein (APP).
  • HY-P3147
    IYPTNGYTR

    Drug Metabolite Others
    IYPTNGYTR, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR can be used to monitor in vivo Trastuzumab metabolism.
  • HY-P3147A
    IYPTNGYTR acetate

    Drug Metabolite Others
    IYPTNGYTR acetate, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR acetate can be used to monitor in vivo Trastuzumab metabolism.
  • HY-P3149B
    LEESGGGLVQPGGSMK acetate

    TNF Receptor Inflammation/Immunology
    LEESGGGLVQPGGSMK acetate, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK acetate can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
  • HY-P3149
    LEESGGGLVQPGGSMK

    TNF Receptor Inflammation/Immunology
    LEESGGGLVQPGGSMK, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
  • HY-P1271
    Catestatin

    nAChR Cardiovascular Disease
    Catestatin is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin is an endogenous peptide that regulates cardiac function and blood pressure. Catestatin is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release.
  • HY-P0154
    Epsilon-V1-2

    ε-V1-2; EAVSLKPT

    PKC Inflammation/Immunology
    Epsilon-V1-2 (ε-V1-2), a PKCε-derived peptide, is a selective PKCε inhibitor. Epsilon-V1-2 inhibits the translocationof PKCε, but not α-, β-, and δPKC.
  • HY-12523
    Peptide M

    Others Others
    Peptide M is a 50 aa synthetic peptide derived from a streptococcal M protein containing an additional C-terminal cysteine residue.
  • HY-P3146
    FTISADTSK

    Drug Metabolite Cancer
    FTISADTSK is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
  • HY-P3146A
    FTISADTSK acetate

    Drug Metabolite Cancer
    FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
  • HY-B0178A
    Guanidine hydrochloride

    Guanidinium chloride; Aminoformamidine hydrochloride

    Endogenous Metabolite Metabolic Disease
    Guanidine hydrochloride (Guanidinium chloride) a strong chaotrope, is also a strong denaturant of proteins.
  • HY-P3149A
    LEESGGGLVQPGGSMK TFA

    TNF Receptor Inflammation/Immunology
    LEESGGGLVQPGGSMK TFA, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK TFA can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
  • HY-15890
    C-7280948

    Histone Methyltransferase Cancer
    C-7280948 is a selective and potent protein methyltransferase1 (PRMT1) inhibitor with an IC50 value of 12.75 μM.
  • HY-P1191
    JIP-1(153-163)

    T1-JIP

    JNK Others
    JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide).
  • HY-P1271A
    Catestatin TFA

    nAChR Cardiovascular Disease
    Catestatin TFA is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin TFA is an endogenous peptide that regulates cardiac function and blood pressure. Catestatin TFA is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release.
  • HY-B0843
    Metalaxyl

    Fungal Infection
    Metalaxyl is a fungicide that inhibits protein synthesis in fungi. Metalaxyl inhibits the growth of potato blight (P. infestans) fungal isolates from Serbian potato fields (EC50s=0.3-3.9 μg/mL).
  • HY-122872
    MKK7-COV-9

    p38 MAPK Cancer
    MKK7-COV-9 is a potent and selective covalent inhibitor of MKK7 and targets a specific protein–protein interaction of MKK7. MKK7-COV-9 blocks primary B cell activation in response to LPS with an EC50 of 4.98 μM.
  • HY-P1420
    TAT-cyclo-CLLFVY

    HIF/HIF Prolyl-Hydroxylase Cancer
    TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM.
  • HY-P1774
    Hepatitis B Virus Core (128-140)

    HBV Infection
    Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
  • HY-N7122
    Thymopentin

    Endogenous Metabolite Inflammation/Immunology Cancer
    Thymopentin is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs).
  • HY-N7122A
    Thymopentin acetate

    Endogenous Metabolite Cancer Inflammation/Immunology
    Thymopentin acetate is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin acetate is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin acetate enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs).
  • HY-19373
    RWJ-445167

    3DP-10017

    Thrombin Factor Xa Cardiovascular Disease
    RWJ-445167 (3DP-10017) is a dual inhibitor of thrombin and factor Xa with Ki of 4.0 nM and 230 nM, respectively, exhibiting potent antithrombotic activity.
  • HY-17561
    G-418 disulfate

    Geneticin sulfate; Antibiotic G-418 sulfate

    Bacterial Antibiotic Infection
    G-418 disulfate (Geneticin sulfate), is an aminoglycoside antibiotic, inhibits protein synthesis in eukaryotes and prokaryotes. G-418 disulfate is commonly used as a selective agent for eukaryotic cells.
  • HY-P1191A
    JIP-1(153-163) TFA

    T1-JIP TFA

    JNK Others
    JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide).
  • HY-P1113
    Phospho-Glycogen Synthase Peptide-2(substrate)

    GSK-3 Others
    Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases.
  • HY-P1113A
    Phospho-Glycogen Synthase Peptide-2(substrate) TFA

    GSK-3 Others
    Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases.
  • HY-P1178
    Cyclotraxin B

    Trk Receptor Neurological Disease
    Cyclotraxin B, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B non-competitively inhibits BDNF-induced TrkB activity with an IC50  of  0.30 nM. Cyclotraxin B can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects.
  • HY-138192
    Octyl glucose neopentyl glycol

    OGNG

    Others Others
    Octyl glucose neopentyl glycol (OGNG) is a neopentyl glycol detergent that can be used to maintain the stability of membrane proteins.
  • HY-126245
    Keap1-Nrf2-IN-1

    Keap1-Nrf2 Metabolic Disease Inflammation/Immunology
    Keap1-Nrf2-IN-1 is a Keap1 (Kelch-like ECH-associated protein 1)-Nrf2 (nuclear factor erythroid 2-related factor 2) protein-protein interaction inhibitor, and with an IC50 of 43 nM for Keap1 protein. Keap1-Nrf2-IN-1 activates Nrf2-regulated cytoprotective response and antagonizes Acetaminophen-induced liver injury.
  • HY-P1895
    β-Amyloid (33-40)

    Amyloid-β Neurological Disease
    β-Amyloid (33-40) is a peptide consisting of amino acid of 33 to 40 of beta amyloid protein.
  • HY-P1903
    β-Amyloid (35-42)

    Amyloid-β Neurological Disease
    β-Amyloid (35-42) is a peptide consisting of amino acid of 35 to 42 of beta amyloid protein.
  • HY-P1333
    Dynorphin A

    Opioid Receptor Neurological Disease
    Dynorphin A, an endogenous opioid peptide, is a highy potent kappa opioid receptor (KOR) activator. Dynorphin A also serve as an agonist for other opioid receptors,  such as mu (MOR) and delta (DOR).
  • HY-136217
    PU 23

    Others Cancer
    PU 23 is a non-carboxylic multidrug resistance protein 4 (MRP4) inhibitor as an active agent reducing resistance to anticancer agent 6-Mercaptopurine.
  • HY-P1075
    CALP3

    Calcium Channel Cancer Neurological Disease
    CALP3, a Ca 2+-like peptide, is a potent Ca 2+ channel blocker that activates EF hand motifs of Ca 2+-binding proteins. CALP3 can functionally mimic increased [Ca 2+]i by modulating the activity of Calmodulin (CaM), Ca 2+ channels and pumps. CALP3 has the potential in controlling apoptosis in diseases such as AIDS or neuronal loss due to ischemia.
  • HY-15435
    CHAPS

    Others Others
    CHAPS, a derivative of Cholic acid, is a zwitterionic detergent for solubilizing membrane proteins. CHAPS is used for stabilization of various protein-DNA complexes and can retain biochemical activity of proteins in solution.
  • HY-131091
    Boc-Glu(OBzl)-OSu

    Others Others
    Boc-Glu(OBzl)-OSu can be used for the solid-phase peptide synthesis containing glutamate benzyl ester residues.
  • HY-P1508A
    Bactenecin TFA

    Bactenecin, bovine TFA

    Bacterial Fungal Infection
    Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei.
  • HY-133014
    RIP2 kinase inhibitor 1

    RIP kinase Inflammation/Immunology
    RIP2 kinase inhibitor 1 (compound 11) is a potent and selective receptor interacting protein 2 (RIP2) kinase inhibitor with an IC50 of 0.03 μM for RIP2 FP. RIP2 kinase inhibitor 1 is used for autoinflammatory disorders.
  • HY-P1580
    PA (224-233), Influenza

    Influenza Virus Infection
    PA (224-233), Influenza is a 10-aa peptide, a fragment of polymerase 2 protein in influenza A virus.
  • HY-P1053
    Amyloid β-Protein 10-20

    Amyloid-β Neurological Disease
    Amyloid β-Protein (10-20) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
  • HY-P0291
    Kemptide Phospho-Ser5

    PKA Others
    Kemptide (Phospho-Ser5) is a phosphate acceptor peptide that serves as a specific substrate for cAMP-dependent protein kinase (PKA).
  • HY-P0315
    Crosstide

    Akt Others
    Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
  • HY-P1508
    Bactenecin

    Bactenecin, bovine

    Bacterial Fungal Infection
    Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei.
  • HY-P1052
    Myelin Basic Protein(87-99)

    Others Inflammation/Immunology
    Myelin Basic Protein(87-99) is an encephalitogenic peptide that induces basic protein-specific T cell proliferation. Myelin Basic Protein(87-99) causes a Th1 polarization in peripheral blood mononuclear cells with is implicated of multiple sclerosis (MS).
  • HY-P1290
    PKA Inhibitor Fragment (6-22) amide

    PKI-(6-22)-amide

    PKA Neurological Disease
    PKA Inhibitor Fragment (6-22) amide is an inhibitor of cAMP-dependent protein kinase A (PKA), with a Ki of 2.8 nM. PKA Inhibitor Fragment (6-22) amide can significantly reverse low-level morphine antinociceptive tolerance in mice.
  • HY-P2251
    T-peptide

    Microtubule/Tubulin
    T-peptide is a peptide derived from microtubule binding repeat of Tau protein. T-peptide self-assembles into 30-55 nm paired helical filaments (PHFs) even in the absense of inducers. T-peptide is cytotoxic in multiple cell lines including cortical neurons, cerebellar granular neurons, neuroblastoma cells, kidney fibroblasts and HEK293 cells. T-peptide co-localizes with pathological hyperphosphorylated forms of tau in vitro.
  • HY-P0271
    Syntide 2

    CaMK Calcium Channel Autophagy Neurological Disease
    Syntide 2, a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected.
  • HY-P0228
    Calcineurin substrate

    Autophagy Neurological Disease
    Calcineurin substrate is a peptide from the regulatory RII subunit of cAMP-dependent protein kinase. It can be used in the calcineurin activity assay.
  • HY-W012037
    8-Hydroxyquinoline hemisulfate

    8-Quinolinol hemisulfate

    Bacterial Antibiotic Infection
    8-Hydroxyquinoline hemisulfate (8-Quinolinol hemisulfate) is a monoprotic bidentate chelating agent, exhibits antiseptic, disinfectant, and pesticide properties, functioning as a transcription inhibitor.
  • HY-115467
    MitoBloCK-10

    Others Metabolic Disease
    MitoBloCK-10 (MB-10) is the first small molecule modulator to attenuate protein-associated motor (PAM) complex activity. MitoBloCK-10 (MB-10) inhibits Tim44 (C-terminal domain) binding to the precursor and to Hsp70.
  • HY-P1290A
    PKA Inhibitor Fragment (6-22) amide TFA

    PKI-(6-22)-amide TFA

    PKA Neurological Disease
    PKA Inhibitor Fragment (6-22) amide TFA is an inhibitor of cAMP-dependent protein kinase A (PKA), with a Ki of 2.8 nM. PKA Inhibitor Fragment (6-22) amide TFA can significantly reverse low-level morphine antinociceptive tolerance in mice.
  • HY-16062
    ARQ 621

    Kinesin Cancer
    ARQ 621 is an allosteric, potent and selective inhibitor of Eg5, a microtubule-based ATPase motor protein involved in cell division. Anti-tumor activity. ARQ 621 is a kinesin inhibitor.
  • HY-P0271A
    Syntide 2 TFA

    CaMK Calcium Channel Neurological Disease
    Syntide 2 (TFA), a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected.
  • HY-50730
    Asparagusic acid

    Parasite Infection
    Asparagusic acid is a sulfur-containing flavor component produced by asparagus plants, with anti-parasitic effect. Asparagusic acid is a plant growth inhibitor.
  • HY-18979
    Lactimidomycin

    Influenza Virus Cancer Infection
    Lactimidomycin is a glutarimide-containing compound isolated from Streptomyces. Lactimidomycin is a potent inhibitor of eukaryotic translation elongation. Lactimidomycin has a potent antiproliferative effect on tumor cell lines and selectively inhibit protein translation. Lactimidomycin inhibits protein synthesis with an IC50 value of 37.82 nM. Lactimidomycin is also a potent and non-toxic inhibitor of dengue virus 2 and other RNA viruses. Anticancer and antiviral activities.
  • HY-105077A
    Nemifitide diTFA

    INN 00835 diTFA

    5-HT Receptor Neurological Disease
    Nemifitide diTFA (INN 00835 diTFA) is a synthetic pentapeptide antidepressant with a potential for rapid onset of action. Nemifitide diTFA is a peptide analog of melanocyte-inhibiting factor (MIF). Nemifitide diTFA can cross the blood-brain barrier.
  • HY-108136A
    Bisindolylmaleimide X hydrochloride

    BIM-X hydrochloride; Ro31-8425 hydrochloride

    PKC CDK Cardiovascular Disease
    Bisindolylmaleimide X hydrochloride (BIM-X hydrochloride) is a potent and selective protein kinase C (PKC) inhibitor. Bisindolylmaleimide X hydrochloride is a potent cyclin-dependent kinase 2 (CDK2) antagonist with an IC50 of 200 nM.
  • HY-115292
    Simvastatin hydroxy acid sodium

    Tenivastatin sodium; Simvastatin Impurity A sodium

    HMG-CoA Reductase (HMGCR) Cancer
    Simvastatin hydroxy acid sodium (Tenivastatin sodium; Simvastatin Impurity A sodium) is an active hydrolytic metabolite of Simvastatin (HY-17502). Simvastatin shows a inhibition of HMG-CoA reductase with a Ki value of 0.12 nM.
  • HY-117737A
    RRD-251

    Raf Apoptosis Cancer
    RRD-251 is an inhibitor of retinoblastoma tumor suppressor protein (Rb)-Raf-1 interaction, with potent anti-proliferative, anti-angiogenic and anti-tumor activities.
  • HY-106244A
    DOTATATE acetate

    Others Cancer
    DOTATATE acetate is a DOTA-conjugated peptide. DOTATATE acetate can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide therapy (PRRT).
  • HY-P0225
    Autocamtide 2

    Autocamtide II

    CaMK Autophagy Neurological Disease
    Autocamtide 2 is a highly selective peptide substrate of calcium/calmodulin-dependent protein kinase II (CaMKII). It can be used in the CaMKII activity assay.
  • HY-P1019A
    [Ala1,​3,​11,​15]​-​Endothelin (53-63) (TFA)

    Endothelin Receptor Cardiovascular Disease Endocrinology
    [Ala1,3,11,15]-Endothelin (53-63) (TFA), a linear peptide analog of endothelin (ET)-1, is a highly selective endothelin B (ETB) receptor.
  • HY-138193
    Lauryl maltose neopentyl glycol

    LMNG

    Others Others
    Lauryl maltose neopentyl glycol (LMNG) is a detergent that can solubilize and stabilize membrane proteins. Lauryl maltose neopentyl glycol extracts integral membrane proteins from membranes, and improves substantially the stability of various membrane proteins, including G protein-coupled receptors and respiratory complexes.
  • HY-125974
    HM03

    HSP Cancer
    HM03 is a potent and selective HSPA5 (Heat shock 70kDa protein 5, also known as Bip, Grp78) inhibitor. HM03 has anticancer activity.
  • HY-125974A
    HM03 trihydrochloride

    HSP Cancer
    HM03 trihydrochloride is a potent and selective HSPA5 (Heat shock 70kDa protein 5, also known as Bip, Grp78) inhibitor. HM03 trihydrochloride has anticancer activity.
  • HY-136304
    NHS-PEG1-SS-PEG1-NHS

    Others Cancer Metabolic Disease Cardiovascular Disease
    NHS-PEG1-SS-PEG1-NHS is a reversible linker for biomacromolecule link with active small molecule. NHS-PEG1-SS-PEG1-NHS can be used in proteins liposomes or nanoparticles.
  • HY-P0313
    CEF6

    Influenza Virus Infection
    CEF6 is a 9-aa-long peptide corresponding to aa 418-426 of the influenza A virus (H1N1) nucleocapsid protein.
  • HY-P1179
    Guanylin(human)

    Guanylate Cyclase Endogenous Metabolite Cancer Endocrinology
    Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism.
  • HY-P0269
    Magainin 1

    Magainin I

    Bacterial Fungal Antibiotic Infection
    Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria.
  • HY-116677
    Tris(benzyltriazolylmethyl)amine

    TBTA

    Others Others
    Tris(benzyltriazolylmethyl)amine (TBTA) is a ligand that acts as a biochemical tool for the tagging of proteins and enzymes.
  • HY-P1179A
    Guanylin(human) TFA

    Guanylate Cyclase Endogenous Metabolite Metabolic Disease
    Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism.
  • HY-12048
    Chelerythrine chloride

    PKC Bcl-2 Family Apoptosis Autophagy Cancer Metabolic Disease Inflammation/Immunology
    Chelerythrine chloride is a potent, cell-permeable inhibitor of protein kinase C, with an IC50 of 660 nM. Chelerythrine chloride inhibits the Bcl-XL-Bak BH3 peptide binding with IC50 of 1.5 μM and displaces Bax from Bcl-XL. Chelerythrine chloride induces apoptosis and autophagy.
  • HY-10392
    Sutezolid

    PNU-100480; U-100480; PF-02341272

    Bacterial Antibiotic Infection
    Sutezolid (PNU-100480), an orally active oxazolidinone antimicrobial agent, acts by inhibiting bacterial protein synthesis. Sutezolid has potent activity against mycobacteria, and is used for the research of drug-resistant tuberculosis.
  • HY-138364
    YUM70

    HSP Apoptosis Cancer
    YUM70 is a potent and selective inhibitor of glucose-regulated protein 78 (GRP78), with an IC50 of 1.5 μM for inhibiting GRP78 ATPase activity of the full-length protein. YUM70 induces endoplasmic reticulum (ER) stress-mediated apoptosis in pancreatic cancer. YUM70 also has in vivo efficacy in a pancreatic cancer xenograft model.
  • HY-135813
    LtaS-IN-1

    Bacterial Infection
    LtaS-IN-1 (compound 1771) is a potent small-molecule inhibitor of Lipoteichoic acid (LTA) synthesis in multidrug-resistant (MDR) E. faecium and by altering the cell wall morphology. LtaS-IN-1 alone inhibits Enterococcus.spp 28 strains with varying MIC values ranging from 0.5 μg/mL to 64 μg/mL. LtaS-IN-1 combination with antibiotics abolishs multidrug-resistant E. faecium growth almost completely.
  • HY-B0470
    Neomycin sulfate

    Bacterial Antibiotic Phospholipase Infection
    Neomycin sulfate, an aminoglycoside antibiotic, exerts antibacterial activity through irreversible binding of the nuclear 30S ribosomal subunit, thereby blocking bacterial protein synthesis. Neomycin sulfate is a known phospholipase C (PLC) inhibitor. Neomycin sulfate potently inhibits both nuclear translocation of angiogenin and angiogenin-induced cell proliferation and angiogenesis.
  • HY-P0269A
    Magainin 1 TFA

    Magainin I TFA

    Bacterial Fungal Antibiotic Infection
    Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria.
  • HY-P1136B
    TAT-Gap19

    Gap Junction Protein Inflammation/Immunology Cardiovascular Disease
    TAT-Gap19, a Cx mimetic peptide, is a specific connexin43 hemichannel (Cx43 HC) inhibitor. TAT-Gap19 does not inhibits the corresponding Cx43 GJCs. TAT-Gap19 traverses the blood-brain barrier and alleviate liver fibrosis in mice.
  • HY-15756
    PTP1B-IN-4

    Phosphatase Metabolic Disease
    PTP1B-IN-4 is a non-competitive allosteric inhibitor of the protein tyrosine phosphatase PTP1B, with an IC50 of 8 μM. PTP1B-IN-4 is potentail for the research of obesity and diabetes.
  • HY-130994
    Aeruginosin 865

    NF-κB ADC Cytotoxin Cancer Inflammation/Immunology
    Aeruginosin 865, isolated from terrestrial cyanobacterium Nostoc sp. Lukešová 30/93, is the first aeruginosin-type peptide containing both a fatty acid and a carbohydrate moiety. Aeruginosin 865 inhibits translocation of NF-kB to the nucleus. Aeruginosin 865 has anti-inflammatory effect
  • HY-129337
    Reveromycin A

    Antibiotic Fungal Apoptosis Cancer Infection
    Reveromycin A, a benzoquinoid antibiotic isolated from the genus Streptomyces, is a selective inhibitor of protein synthesis in eukaryotic cells. Reveromycin A inhibits bone resorption by inducing apoptosis specifically in osteoclasts. Reveromycin A has antiproliferative activity against tumor cell lines and antifungal activity.
  • HY-13259
    MG-132

    Z-Leu-Leu-Leu-al; MG132

    Proteasome Autophagy Apoptosis Cancer
    MG-132 (Z-Leu-Leu-Leu-al) is a potent proteasome and calpain inhibitor with IC50s of 100 nM and 1.2 μM, respectively. MG-132 effectively blocks the proteolytic activity of the 26S proteasome complex. MG-132, a peptide aldehyde, also is an autophagy activator. MG-132 also induces apoptosis.
  • HY-P0228A
    Calcineurin substrate TFA

    Autophagy Metabolic Disease
    Calcineurin substrate (TFA) is a peptide from the regulatory RII subunit of cAMP-dependent protein kinase. Calcineurin substrate (TFA) can be used in the calcineurin activity assay.
  • HY-P1801
    Cys-TAT(47-57)

    Cys-[HIV-Tat (47-57)]

    HIV Infection
    Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
  • HY-101918
    DS-1040 Tosylate

    Others Cardiovascular Disease
    DS-1040 Tosylate is an orally active, selective inhibitor of activated thrombin-activatable fibrinolysis inhibitor (TAFIa) with IC50s of 5.92 nM and 8.01 nM for human and rat TAFIa. DS-1040 Tosylate is a fibrinolysis enhancer for thromboembolic diseases.
  • HY-P1345
    TLQP-21

    Complement System Endocrinology Neurological Disease
    TLQP-21, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor 1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8 μM). TLQP-21 activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 is used for the research in regulation of nociception and other relevant physiologic functions.
  • HY-P2315
    Human β-defensin-1

    HβD-1

    Antibiotic Bacterial Infection
    Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria.
  • HY-P0082A
    Glucagon (1-29), bovine, human, porcine hydrochloride

    Porcine glucagon hydrochloride

    Glucagon Receptor Metabolic Disease
    Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation.
  • HY-115688
    TXNIP-IN-1

    Others Metabolic Disease Inflammation/Immunology Cardiovascular Disease
    TXNIP-IN-1 is TXNIP-TRX (thioredoxin-interacting protein- thioredoxin) complex inhibitor extracted from patent US20200085800A1, Compound 1. TXNIP-IN-1 can be used in the research of TXNIP-TRX complex associated metabolic disorder (diabetes), cardiovascular disease, or inflammatory disease.
  • HY-15187
    Filanesib

    ARRY-520

    Kinesin Apoptosis Cancer
    Filanesib (ARRY-520) is a selective and noncompetitive kinesin spindle protein (KSP) inhibitor, with an IC50 of 6 nM for human KSP. Filanesib induces cell death by apoptosis in vitro. Filanesib has potent anti-proliferative activity.
  • HY-A0162A
    Quinupristin mesylate

    Bacterial Infection
    Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits.
  • HY-16787
    ICA-121431

    Sodium Channel Cardiovascular Disease
    ICA-121431 is a nanomolar potent and broad-spectrum voltage-gated sodium channel (Nav) blocker, shows equipotent selectivity for human Nav1.1 and Nav1.3 subtypes with IC50 values of 13 nM and 23 nM, respectively. ICA-121431 shows less potent inhibition of Nav1.2 (IC50=240 nM) and 1,000 fold selectivity against Nav1.4, Nav1.6, and the TTX-resistant human Nav1.5 and Nav1.8 channels (IC50s >10 µM).
  • HY-14165
    Veliflapon

    BAY X 1005; DG-031

    FLAP Leukotriene Receptor Inflammation/Immunology Cardiovascular Disease
    Veliflapon (BAY X 1005; DG-031) is an orally active and selective 5-lipoxygenase activating protein (FLAP) inhibitor. Veliflapon inhibits the synthesis of the leukotrienes B4 and C4.
  • HY-P2136
    COG1410

    Apoptosis Inflammation/Immunology Neurological Disease
    COG1410 is an apolipoprotein E-derived peptide. COG1410 exerts neuroprotective and antiinflammatory effects in a murine model of traumatic brain injury (TBI). COG1410 can be used for the research of neurological disease.
  • HY-18728
    STF-31

    GLUT Autophagy Cancer
    STF-31 is a selective inhibitor of glucose transporter 1 (GLUT1), with an IC50 of 1μM[1][2].
  • HY-P1345A
    TLQP-21 TFA

    Complement System Endocrinology Neurological Disease
    TLQP-21 TFA, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8μM). TLQP-21 TFA activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 TFA is used for the research in regulation of nociception and other relevant physiologic functions.
  • HY-P1115A
    AKTide-2T TFA

    Akt Others
    AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position.
  • HY-W004056
    4-Methoxyphenethyl alcohol

    DNA/RNA Synthesis Infection
    4-Methoxyphenethyl alcohol, an aromatic alcohol, is the major component in the anise-like odour produced by A. albispathus Hett. 4-Methoxyphenethyl alcohol can inhibits the protein, RNA and DNA synthesis in Escherichia coli.
  • HY-116144
    Picaridin

    Lcaridin

    Parasite Infection
    Picaridin (Lcaridin) is a broad spectrum arthropod repellent. The repellent and deterrent activities of Picaridin involve olfactory sensing in mosquitoes, and ticks, via their interactions with odorant receptor proteins.
  • HY-P1446
    Cholera toxin

    Choleragen

    Adenylate Cyclase Inflammation/Immunology
    Cholera toxin (Choleragen), an AB(5)-subunit toxin, enters host cells by binding the ganglioside GM1 at the plasma membrane (PM) and travels retrograde through the trans-Golgi Network into the endoplasmic reticulum (ER). Choleragen activates adenylate cyclase by catalyzing ADP-ribosylation of Gs alpha, the stimulatory guanine nucleotide-binding protein.
  • HY-125957
    A-3 hydrochloride

    PKA Casein Kinase CaMK PKC Others
    A-3 hydrochloride is a potent, cell-permeable, reversible, ATP-competitive non-selective antagonist of various kinases. It against PKA (Ki=4.3 µM), casein kinase II (Ki=5.1 µM) and myosin light chain kinase (MLCK) (Ki=7.4 µM). A-3 hydrochloride also inhibits PKC and casein kinase I with Ki values of 47 µM and 80 µM, respectively.
  • HY-15187B
    Filanesib TFA

    ARRY-520 TFA

    Kinesin Cancer
    Filanesib TFA (ARRY-520 TFA) is a selective kinesin spindle protein (KSP) inhibitor, with an IC50 of 6 nM for human KSP. Filanesib TFA induces cell death by apoptosis in vitro. Filanesib TFA has potent anti-proliferative activity.
  • HY-17389
    Genipin

    (+)-Genipin

    Autophagy Cancer Metabolic Disease Inflammation/Immunology Neurological Disease
    Genipin ((+)-Genipin) is a natural crosslinking reagent derived from Gardenia jasminoides Ellis fruits. Genipin inhibits UCP2 (uncoupling protein 2) in cells. Genipin has a variety of bioactivities, including modulation on proteins, antitumor, anti-inflammation, immunosuppression, antithrombosis, and protection of hippocampal neurons. Genipin also can be used for type 2 diabetes research.
  • HY-P1468
    β-Amyloid (1-28)

    Amyloid β-Protein (1-28)

    Amyloid-β Neurological Disease
    β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
  • HY-P1466
    β-Amyloid 1-16

    Amyloid β-Protein (1-16)

    Amyloid-β Neurological Disease
    β-Amyloid (1-16) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
  • HY-B0275
    Oxytetracycline

    Bacterial HSV Endogenous Metabolite Antibiotic Infection
    Oxytetracycline is an antibiotic belonging to the tetracycline class. Oxytetracycline potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline also possesses anti-HSV-1 activity.
  • HY-B0275A
    Oxytetracycline hydrochloride

    Bacterial HSV Antibiotic Endogenous Metabolite Infection
    Oxytetracycline hydrochloride is an antibiotic belonging to the tetracycline class. Oxytetracycline hydrochloride potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline hydrochloride is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline hydrochloride also possesses anti-HSV-1 activity.
  • HY-12993
    RSV604

    A-60444

    RSV Infection
    RSV604 (A-60444) is an inhibitor of respiratory syncytial virus (RSV) replication. RSV604 targets the nucleocapsid protein, with a Kd of 1.6 μM. RSV604 displays submicromolar activity against numerous clinical isolates of both the A and B subtypes of RSV (average EC50s=0.8 μM).
  • HY-P1280
    Margatoxin

    Potassium Channel Neurological Disease
    Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
  • HY-113025A
    L-hydroxylysine dihydrochloride

    (2S,5R)-5-Hydroxylysine dihydrochloride

    Endogenous Metabolite Others
    L-hydroxylysine dihydrochloride ((2S,5R)-5-Hydroxylysine dihydrochloride), an amino acid, is exclusive to collagen protein, which is formed by posttranslational hydroxylation of some lysine residues.
  • HY-P0082
    Glucagon (1-29), bovine, human, porcine

    Porcine glucagon

    Glucagon Receptor Metabolic Disease
    Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation.
  • HY-19614
    BMS-795311

    CETP Cardiovascular Disease
    BMS-795311 is a potent and orally bioavailable inhibitor of cholesteryl ester transfer protein (CETP), with IC50s of 4 nM in an enzyme-based scintillation proximity assay (SPA) and 0.22 μM in a human whole plasma assay (hWPA), respectively.
  • HY-43722
    Lenalidomide-Br

    Ligand for E3 Ligase Cancer
    Lenalidomide-Br (Compound 41) is an analog of cereblon (CRBN) ligand Lenalidomide for E3 ubiquitin ligase, and is used in the recruitment of CRBN protein. Lenalidomide-Br can be connected to the ligand for protein by a linker to form PROTACs, such as the PROTAC STAT3 degrader SD-36 (HY-129602).
  • HY-W008990
    Xanthosine 5'-monophosphate sodium salt

    5'-Xanthylic acid sodium salt

    Others Metabolic Disease
    Xanthosine 5'-monophosphate sodium salt (5'-Xanthylic acid sodium salt) is an intermediate in purine metabolism. Xanthosine 5'-monophosphate sodium salt can be used for genetic code, nucleic acid structure, and DNA, RNA and protein synthesis research.
  • HY-113952
    Actinonin

    (-)-Actinonin

    Aminopeptidase Bacterial MMP Apoptosis Antibiotic Cancer Infection
    Actinonin ((-)-Actinonin) is a naturally occurring antibacterial agent produced by Actinomyces. Actinonin inhibits aminopeptidase M, aminopeptidase N and leucine aminopeptidase. Actinonin is a potent reversible peptide deformylase (PDF) inhibitor with a Ki of 0.28 nM. Actinonin also inhibits MMP-1, MMP-3, MMP-8, MMP-9, and hmeprin α with Ki values of 300 nM, 1,700 nM, 190 nM, 330 nM, and 20 nM, respectively. Actinonin is an apoptosis inducer. Actinonin has antiproliferative and antitumor activities.
  • HY-A0162
    Quinupristin

    Bacterial Infection
    Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits .
  • HY-P1318
    Ac-RYYRIK-NH2

    Opioid Receptor Neurological Disease
    Ac-RYYRIK-NH2 is a potent and partial agonist on ORL1 transfected in CHO cells (Kd=1.5 nM) and behaves as a endogenous ligand of ORL1. Ac-RYYRIK-NH2 is a specific antagonist for the activation of G protein and competitively antagonizes the stimulation of [ 35S]-GTPgS binding to G proteins by nociceptin/orphanin FQ (noc/OFQ) in membranes and sections of rat brain.
  • HY-P1369
    DynaMin inhibitory peptide, myristoylated

    Dynamin Neurological Disease
    DynaMin inhibitory peptide, myristoylated is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated is a membrane-permeant form of the peptide that prevents endocytosis.
  • HY-P2497
    Exendin (5-39)

    Glucagon Receptor Neurological Disease
    Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
  • HY-P1098
    Ac2-26

    NF-κB Inflammation/Immunology
    Ac2-26, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue.
  • HY-B0275B
    Oxytetracycline dihydrate

    Bacterial HSV Antibiotic Endogenous Metabolite Infection
    Oxytetracycline dihydrate is an antibiotic belonging to the tetracycline class. Oxytetracycline dihydrate potent inhibits Gram-negative and Gram-positive bacteria. Oxytetracycline dihydrate is a protein synthesis inhibitor and prevents the binding from aminoacil-tRNA to the complex m-ribosomal RNA. Oxytetracycline dihydrate also possesses anti-HSV-1 activity.
  • HY-124806
    TTP-8307

    Enterovirus DNA/RNA Synthesis HCV Infection
    TTP-8307 is a potent inhibitor of the replication of several rhino- and enteroviruses. TTP-8307 inhibits coxsackievirus B3 (CVB3; EC50=1.2 μM) and poliovirus by interfering with the synthesis of viral RNA. TTP-8307 exerts antiviral activity through oxysterol-binding protein (OSBP).
  • HY-P2458
    CAP18 (rabbit)

    Bacterial Infection
    CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
  • HY-126810A
    NP213 TFA

    Fungal Infection
    NP213 TFA is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide (AMP), has anti-fungal activities. NP213 TFA targets the fungal cytoplasmic membrane and plays it role via membrane perturbation and disruption. NP213 TFA is effective and well-tolerated in resolving nail fungal infections.
  • HY-P1318A
    Ac-RYYRIK-NH2 TFA

    Opioid Receptor Neurological Disease
    Ac-RYYRIK-NH2 TFA is a potent and partial agonist on ORL1 transfected in CHO cells (Kd=1.5 nM) and behaves as a endogenous ligand of ORL1. Ac-RYYRIK-NH2 is a specific antagonist for the activation of G protein and competitively antagonizes the stimulation of [ 35S]-GTPgS binding to G proteins by nociceptin/orphanin FQ (noc/OFQ) in membranes and sections of rat brain.
  • HY-P1115
    AKTide-2T

    Akt Others
    AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position.
  • HY-N4136
    Lonicerin

    Bacterial Apoptosis Infection
    Lonicerin is an anti-algE (alginate secretion protein) flavonoid with inhibitory activity for P. aeruginosa. Lonicerin prevents inflammation and apoptosis in LPS-induced acute lung injury.
  • HY-W048688
    Fmoc-Trp(Me)-OH

    Others Others
    Fmoc-Trp(Me)-OH is synthesized by N-(9-Fluorenylmethoxycarbonyloxy)succinimide (Fmoc-ONSu) and 1-Methyl-Ltrypthophan and can be used for protein or peptide synthesis.
  • HY-17480
    Bendazac

    Others Inflammation/Immunology
    Bendazac is an oxyacetic acid with anti-inflammatory, antinecrotic, choleretic and antilipidaemic properties. Bendazac acts by preventing protein denaturation and delays the cataractogenic process.
  • HY-P1369A
    DynaMin inhibitory peptide, myristoylated TFA

    Dynamin Neurological Disease
    DynaMin inhibitory peptide, myristoylated TFA is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated TFA is a membrane-permeant form of the peptide that prevents endocytosis.
  • HY-15583
    Auristatin F

    Microtubule/Tubulin ADC Cytotoxin Cancer
    Auristatin F is a potent cytotoxin. Auristatin F, a potent microtubule inhibitor and vascular damaging agent (VDA), can be used in antibody-drug conjugates (ADC).
  • HY-120072
    PF-3450074

    PF-74

    HIV Infection
    PF-3450074 (PF-74) is a specifical inhibitor of HIV-1 capsid protein (CA) and displays a broad-spectrum inhibition of HIV isolates with submicromolar potency (EC50=8-640 nM). PF-3450074 (PF-74) acts at an early stage of HIV-1 infection, inhibits viral replication by directly competing with the binding of CPSF6 and NUP153, and blocks the uncoating, assembly, and the reverse transcription steps of the viral life cycle. CPSF6: nuclear host factors cleavage and polyadenylation specific factor 6; NUP153: nucleoporin 153.
  • HY-B0220
    Erythromycin

    Bacterial Antibiotic Infection
    Erythromycin is a macrolide antibiotic produced by actinomycete Streptomyces erythreus with a broad spectrum of antimicrobial activity. Erythromycin acts by binding to bacterial 50S ribosomal subunits and inhibits RNA-dependent protein synthesis by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid.
  • HY-P1098A
    Ac2-26 TFA

    NF-κB Inflammation/Immunology
    Ac2-26 TFA, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue.
  • HY-P1471
    Adrenomedullin (AM) (22-52), human

    22-52-Adrenomedullin (human)

    CGRP Receptor Cardiovascular Disease
    Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
  • HY-W087383
    Thalidomide 5-fluoride

    Ligand for E3 Ligase Cancer
    Thalidomide 5-fluoride is Thalidomide-based cereblon ligand that incorporates to the ligand for IRAK4 protein by a linker to form PROTAC IRAK4 degrader-1.
  • HY-P1416
    Foxy-5

    Wnt Cancer
    Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model.
  • HY-18572A
    2,4-D sodium salt

    Sodium 2,4-dichlorophenoxyacetate; 2,4-Dichlorophenoxyacetic acid sodium salt

    DNA/RNA Synthesis Others
    2,4-D sodium salt (Sodium 2,4-dichlorophenoxyacetate) is a selective systemic herbicide for the control of broad-leaved weeds. 2,4-D sodium salt acts as a plant hormone, causing uncontrolled growth in the meristematic tissues. 2,4-D sodium salt inhibits DNA and protein synthesis and thereby prevents normal plant growth and development.
  • HY-18572
    2,4-D

    2,4-Dichlorophenoxyacetic acid

    DNA/RNA Synthesis Others
    2,4-D (2,4-Dichlorophenoxyacetic acid) is a selective systemic herbicide for the control of broad-leaved weeds. 2,4-D acts as a plant hormone, causing uncontrolled growth in the meristematic tissues. 2,4-D inhibits DNA and protein synthesis and thereby prevents normal plant growth and development.
  • HY-122470
    Stampidine

    Reverse Transcriptase HIV Infection
    Stampidine is a nucleoside reverse transcriptase inhibitor (NRTI) with potent and broad-spectrum anti-HIV activity. Stampidine inhibits the laboratory HIV-1 strain HTLVIIIB (B-envelope subtype) and primary clinical isolates with IC50s of 1 nM and 2 nM, respectively. Stampidine also inhibits NRTI-resistant primary clinical isolates and NNRTI-resistant clinical isolates with IC50s of 8.7 nM and 11.2 nM, respectively.
  • HY-17571A
    Oxytocin acetate

    α-Hypophamine acetate; Oxytocic hormone acetate

    Oxytocin Receptor Endocrinology
    Oxytocin acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma.
  • HY-129624A
    Bisindolylmaleimide VIII acetate

    Ro 31-7549 acetate; Bis VIII acetate

    PKC Apoptosis Cancer Inflammation/Immunology
    Bisindolylmaleimide VIII acetate (Ro 31-7549 acetate) is a potent and selective protein kinase C (PKC) inhibitor with an IC50 of 158 nM for rat brain PKC. Bisindolylmaleimide VIII acetate has IC50s of 53, 195, 163, 213, and 175 nM for PKC-α, PKC-βI, PKC-βII, PKC-γ, PKC-ε, respectively. Bisindolylmaleimide VIII acetate facilitates Fas-mediated apoptosis and inhibits T cell-mediated autoimmune diseases.
  • HY-17571
    Oxytocin

    α-Hypophamine; Oxytocic hormone

    Oxytocin Receptor Endocrinology
    Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma.
  • HY-B0220E
    Erythromycin A dihydrate

    Bacterial Antibiotic Infection
    Erythromycin dihyrate dihydrate is a macrolide antibiotic produced by actinomycete Streptomyces erythreus with a broad spectrum of antimicrobial activity. Erythromycin dihyrate acts by binding to bacterial 50S ribosomal subunits and inhibits RNA-dependent protein synthesis by blockage of transpeptidation and/or translocation reactions, without affecting synthesis of nucleic acid.
  • HY-106443A
    Arimoclomol maleate

    BRX-220

    HSP Metabolic Disease Inflammation/Immunology Neurological Disease
    Arimoclomol maleate (BRX-220) is a co-inducer of heat shock proteins (HSP). Arimoclomol protects motor neurons by enhancing Hsp expression, thus directly affecting protein aggregation and clearance of misfolded assemblies via the proteasome-ubiquitin system.
  • HY-18669
    ML346

    HSP Cancer
    ML346 is an activator of Hsp70 expression and HSF-1 activity, with an EC50 of 4.6 μM for Hsp70. ML346 restores protein folding in conformational disease models, without significant cytotoxicity or lack of specificity. ML346 induces specific increases in genes and protein effectors of the heat shock response (HSR), including chaperones such as Hsp70, Hsp40, and Hsp27.
  • HY-P0318
    Hemorphin-7

    Opioid Receptor Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).
  • HY-P1416A
    Foxy-5 TFA

    Wnt Cancer
    Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model.
  • HY-126323
    TCMDC-135051

    Parasite Infection
    TCMDC-135051 is a highly selective and potent protein kinase PfCLK3 inhibitor with low off-target toxicity. TCMDC-135051 prevents trophozoite-to-schizont transition, disrupts transcription and reduces transmission to the mosquito vector. TCMDC-135051 has antiparasiticidal activity (EC50=320 nM).
  • HY-126323B
    TCMDC-135051 hydrochloride

    Parasite Infection
    TCMDC-135051 hydrochloride is a highly selective and potent protein kinase PfCLK3 inhibitor with low off-target toxicity. TCMDC-135051 hydrochloride prevents trophozoite-to-schizont transition, disrupts transcription and reduces transmission to the mosquito vector. TCMDC-135051 hydrochloride has antiparasiticidal activity (EC50=320 nM).
  • HY-P0316
    TP508

    Thrombin NO Synthase Cardiovascular Disease
    TP508 is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 activates endothelial cells and stem cells to revascularize and regenerate tissues.
  • HY-W042156
    Aegeline

    Fungal Neurological Disease
    Aegeline, a main alkaloid, mimics the yeast SNARE protein Sec22p in suppressing α-synuclein and Bax toxicity in yeast. Aegeline restores growth of yeast cells suppressed by either αsyn or Bax. Antioxidant activity.
  • HY-106443
    Arimoclomol

    BRX-220 free base

    HSP Metabolic Disease Inflammation/Immunology Neurological Disease
    Arimoclomol (BRX-220 free base) is a co-inducer of heat shock proteins (HSP). Arimoclomol protects motor neurons by enhancing Hsp expression, thus directly affecting protein aggregation and clearance of misfolded assemblies via the proteasome-ubiquitin system.
  • HY-120006A
    (rel)-AR234960

    ERK Cardiovascular Disease
    (rel)-AR234960 is an active relative configuration of AR234960. AR234960, a non-peptide MAS (a G protein-coupled receptor) agonist, increases both mRNA and protein levels of CTGF via ERK1/2 signaling in HEK293-MAS cells and adult human cardiac fibroblasts.
  • HY-111360
    SPL-707

    γ-secretase Inflammation/Immunology
    SPL-707 is an orally active, selective signal peptide peptidase-like 2a (SPPL2a) inhibitor with an IC50 of 77 nM for hSPPL2a. SPL-707 inhibits γ-secretase (IC50=6.1 μM) and SPP (IC50=3.7 μM). SPL-707 has the potential for autoimmune diseases research by targeting B cells and dendritic cells.
  • HY-B0509
    Amikacin hydrate

    BAY 41-6551 hydrate

    Bacterial Antibiotic Infection
    Amikacin hydrate (BAY 41-6551 hydrate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin hydrate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin hydrate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin hydrate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria.
  • HY-106443B
    Arimoclomol citrate

    BRX-220 citrate

    HSP Metabolic Disease Inflammation/Immunology Neurological Disease
    Arimoclomol citrate (BRX-220 citrate) is a co-inducer of heat shock proteins (HSP). Arimoclomol citrate protects motor neurons by enhancing Hsp expression, thus directly affecting protein aggregation and clearance of misfolded assemblies via the proteasome-ubiquitin system.
  • HY-N1347
    Robinetin

    3,3',4',5',7-Pentahydroxyflavone

    Fungal HIV Integrase Bacterial Infection
    Robinetin (3,3',4',5',7-Pentahydroxyflavone), a naturally occurring flavonoid with remarkable ‘two color’ intrinsic fluorescence properties, has antifungal, antiviral, antibacterial, antimutagenesis, and antioxidant activity. Robinetin also can inhibit lipid peroxidation and protein glycosylation.
  • HY-P0262
    Galantide

    Neuropeptide Y Receptor Metabolic Disease Inflammation/Immunology Neurological Disease Endocrinology
    Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM).
  • HY-P0316A
    TP508 TFA

    Thrombin NO Synthase Cardiovascular Disease
    TP508 TFA is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 TFA activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 TFA activates endothelial cells and stem cells to revascularize and regenerate tissues.
  • HY-P0290
    GRGDSP

    Integrin Cancer
    GRGDSP, a synthetic linear RGD peptide, is an integrin inhibitor.
  • HY-11007
    GNF-2

    Bcr-Abl SARS-CoV Cancer
    GNF-2 is a highly selective, allosteric, non-ATP competitive inhibitor of Bcr-Abl. GNF-2 inhibits Ba/F3.p210 proliferation with an IC50 of 138 nM .
  • HY-12995A
    (S)-BI 665915

    FLAP Inflammation/Immunology
    (S)-BI 665915 is an orally active oxadiazole-containing 5-lipoxygenase-activating protein (FLAP) inhibitor with an IC50 of 1.7 nM for FLAP binding. (S)-BI 665915 inhibits FLAP functional in human whole blood with an IC50 of 45 nM. (S)-BI 665915 demonstrates an excellent cross-species drug metabolism and pharmacokinetics (DMPK) profile and a dose-dependent inhibition of LTB4 production.
  • HY-121750
    CCG-222740

    Ras ROCK Cancer
    CCG-222740 is an orally active and selective Rho/myocardin-related transcription factor (MRTF) pathway inhibitor. CCG-222740 is also a potent inhibitor of alpha-smooth muscle actin protein expression. CCG-222740 effectively reduces fibrosis in skin and blocks melanoma metastasis.
  • HY-N6785
    Okadaic acid

    Phosphatase Parasite Apoptosis Infection
    Okadaic acid is extracted from black sponges of the genus Halichondria. Okadaic acid is a non-comepetitive, selective and reversible serine/threonine-specific protein phosphatases 1 (PP1), PP2A and PP3 inhibitor with IC50s of 10-15 nM, 0.5 nM and 4 nM, respectively. Okadaic acid eliminate metazoan symbionts/parasites by apoptosis.
  • HY-P1399
    Pep2m, myristoylated

    Myr-Pep2m

    PKC Neurological Disease
    Pep2m, myristoylated (Myr-Pep2m) is a cell-permeable peptide. Pep2m, myristoylated can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC).
  • HY-P1514
    Peptide YY (PYY), human

    Neuropeptide Y Receptor Metabolic Disease Neurological Disease Endocrinology
    Peptide YY (PYY) is a gut hormone that regulates appetite and inhibits pancreatic secretion. Peptide YY (PYY) can mediate its effects through the Neuropeptide Y receptors.
  • HY-106225
    Rotigaptide

    ZP123

    Gap Junction Protein Cardiovascular Disease
    Rotigaptide (ZP123) is a novel and specific modulator of connexin 43 (Cx43). Rotigaptide prevents the uncoupling of Cx43-mediated gap junction communication and normalizes cell-to-cell communication during acute metabolic stress. Rotigaptide is a potent antiarrhythmic peptide (AAP) with improved stability and has the potential for the investigation of cardiac arrhythmias-specifically atrial fibrillation.
  • HY-P3138
    (Sar1)-Angiotensin II

    Angiotensin Receptor Cardiovascular Disease
    (Sar1)-Angiotensin II, an analogue of Angiotensin II, is a specific agonist of angiotensin AT1 receptor. (Sar1)-Angiotensin II binds to brain membrane-rich particles, with a Kd of 2.7 nM. (Sar1)-Angiotensin II can stimulate protein synthesis and cell growth in embryonic chick myocytes.
  • HY-B0509B
    Amikacin disulfate

    BAY 41-6551 disulfate

    Bacterial Antibiotic Infection
    Amikacin disulfate (BAY 41-6551 dissulfate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin disulfate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin disulfate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin disulfate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria.
  • HY-107813
    Amikacin sulfate

    BAY 41-6551 sulfate

    Bacterial Antibiotic Infection
    Amikacin sulfate (BAY 41-6551 sulfate) is an aminoglycoside antibiotic and a semisynthetic analog of kanamycin. Amikacin sulfate is bactericidal, acting directly on the 30S and 50S bacerial ribosomal subunits to inhibit protein synthesis. Amikacin sulfate is very active against most Gram-negative bacteria including gentamicin- and tobramycin-resistant strains. Amikacin sulfate also inhibits the infections caused by susceptible Nocardia and nontuberculous mycobacteria.
  • HY-P1119
    WRW4

    Others Neurological Disease
    WRW4, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 specifically inhibits the increase in intracellular calcium by the FPRL1 agonists MMK-1, amyloid beta42 (Abeta42) peptide, and F peptide.
  • HY-P0215
    Autocamtide-2-related inhibitory peptide, myristoylated

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide, myristoylated is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-130354
    Dibutyryl-cGMP sodium

    Bt2cGMP sodium

    Potassium Channel Cardiovascular Disease
    Dibutyryl-cGMP sodium (Bt2cGMP sodium) is a cell-permeable cGMP analogue. Dibutyryl-cGMP sodium preferentially activates cGMP-dependent protein kinase (PKG). Dibutyryl-cGMP sodium inhibits the release of [ 3H]-arachidonic acid from γ thrombin-stimulated human platelets. Dibutyryl-cGMP sodium induces peripheral antinociception via activation of ATP-sensitive K + channels.
  • HY-103473A
    Boc-MLF TFA

    Boc-Met-Leu-Phe-OH (TFA)

    Others Inflammation/Immunology
    Boc-MLF (TFA) is a peptide, used as a specific formyl peptide receptor (FPR) antagonist, also inhibits the signaling through formyl peptide receptor like 1 (FPRL1) at higher concentrations.
  • HY-W002820
    2-Amino-5-phenylpyridine

    Endogenous Metabolite Cancer
    2-Amino-5-phenylpyridine is a mutagenic heterocyclic aromatic amine that is formed by pyrolysis of phenylalanine in proteins. 2-Amino-5-phenylpyridine is in broiled sardines and is considered as potentially carcinogenic.
  • HY-18619
    YL-109

    Aryl Hydrocarbon Receptor Cancer
    YL-109 is an antitumor agent that can induce carboxyl terminus of Hsp70-interacting protein (CHIP) expression through aryl hydrocarbon receptor (AhR) signaling. YL-109 has ability to inhibit breast cancer cell growth and invasiveness.
  • HY-P0215A
    Autocamtide-2-related inhibitory peptide, myristoylated TFA

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-P1471A
    Adrenomedullin (AM) (22-52), human TFA

    22-52-Adrenomedullin (human) (TFA)

    CGRP Receptor Cardiovascular Disease
    Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
  • HY-111285
    HAMNO

    NSC111847

    Others Cancer
    HAMNO is a novel protein interaction inhibitor of replication protein A (RPA).
  • HY-P0270
    Magainin 2

    Magainin II

    Bacterial Antibiotic Fungal Infection
    Magainin 2 (Magainin II) is an antimicrobial peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa. Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes.
  • HY-100430
    CCF642

    Others Cancer
    CCF642 is a potent protein disulfide isomerases (PDI) inhibitor with an IC50 of 2.9 μM. CCF642 causes acute endoplasmic reticulum (ER) stress in multiple myeloma cells accompanied by apoptosis-inducing calcium release. CCF642 has broad anti-multiple myeloma activity.
  • HY-P1399A
    Pep2m, myristoylated TFA

    Myr-Pep2m TFA

    PKC Neurological Disease
    Pep2m, myristoylated TFA (Myr-Pep2m TFA) is a cell-permeable peptide. Pep2m, myristoylated TFA can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC).
  • HY-P1111A
    Lyn peptide inhibitor TFA

    Src Interleukin Related Inflammation/Immunology
    Lyn peptide inhibitor TFA is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor TFA blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor TFA can be used for study of  asthma, allergic, and other eosinophilic disorders.
  • HY-P1398
    Compstatin control peptide

    Complement System Inflammation/Immunology
    Compstatin control peptide is a complement inhibitor that binds and inhibits cleavage of complement C3.
  • HY-W014102
    L-Alanyl-L-glutamine

    Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    L-Alanyl-L-glutamine, a glutamine dipeptide, is benefit for the antioxidant system, attenuating inflammation, and may modulate the heat shock protein (HSP) response in catabolic situations.
  • HY-P0069A
    L-JNKI-1

    JNK Neurological Disease
    L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
  • HY-15664
    Bivalirudin TFA

    Thrombin Cardiovascular Disease
    Bivalirudin TFA is a synthetic 20 residue peptide which reversibly inhibits thrombin.
  • HY-P0027
    Jasplakinolide

    Arp2/3 Complex Fungal Cancer Infection
    Jasplakinolide is a potent actin polymerization inducer and stabilizes pre-existing actin filaments. Jasplakinolide binds to F-actin competitively with phalloidin with a Kd of 15 nM. Jasplakinolide, a naturally occurring cyclic peptide from the marine sponge, has both fungicidal and anti-cancer activity.
  • HY-16636
    ML337

    mGluR Neurological Disease
    ML337 is a selective and brain-penetrant negative allosteric modulator of mGlu3, with an IC50 of 593 nM. ML337 possesses a favorable dystrophia myotonica protein kinase (DMPK) and ancillary pharmacology profile.
  • HY-114424A
    H-Ile-Pro-Pro-OH hydrochloride

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
  • HY-114424
    H-Ile-Pro-Pro-OH

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC50 of 5 μM. Antihypertensive tripeptides.
  • HY-136528
    RA-9

    Deubiquitinase Apoptosis Cancer
    RA-9 is a potent and selective proteasome-associated deubiquitinating enzymes (DUBs) inhibitor with favorable toxicity profile and anticancer activity. RA-9 blocks ubiquitin-dependent protein degradation without impacting 20S proteasome proteolytic activity. RA-9 selectively induces onset of apoptosis in ovarian cancer cell lines and primary cultures derived from donors. RA-9 induces endoplasmic reticulum (ER)-stress responses in ovarian cancer cells.
  • HY-107116
    MAP4343

    Microtubule/Tubulin Neurological Disease
    MAP4343 is the 3-methylether derivative of Pregnenolone. MAP4343 binds in vitro to microtubule-associated protein 2 (MAP2), stimulates the polymerization of tubulin, enhances the extension of neurites and protects neurons against neurotoxic agents.
  • HY-103080
    CMF019

    Others Cardiovascular Disease
    CMF019 is a potent and small molecule agonist at Apelin receptor (APJ) with G protein bias. CMF019 binds to APJ with pKi values of 8.58, 8.49 and 8.71 for human, rat, and mouse, respectively. CMF019 mimics the beneficial cardiovascular actions of apelin in rodents. Apelin receptor (APJ) is a G protein-coupled receptor (GPCR) activated by the endogenous peptide apelin.
  • HY-130979
    EED226-COOH

    Ligand for Target Protein for PROTAC Cancer
    EED226-COOH is an EED226-derived ligand for target protein EED ligand for PROTAC, binds to a ligand for VHL via linker to form UNC6852 (HY-130708) to degrade PRC2.
  • HY-70075
    CCG-63808

    RGS Protein Cancer
    CCG-63808 is a reversible inhibitor of regulator of G-protein signaling (RGS) proteins.
  • HY-107641
    α-Cyano-4-hydroxycinnamic acid

    α-Cyano-4-hydroxycinnamate

    Monocarboxylate Transporter Metabolic Disease
    α-Cyano-4-hydroxycinnamic acid (α-Cyano-4-hydroxycinnamate) is a potent and non-competitive inhibitor of monocarboxylate transporters (MCTs). α-Cyano-4-hydroxycinnamic acid inhibits mitochondrial pyruvate transporter with a Ki of 6.3 μM. α-Cyano-4-hydroxycinnamic acid is used as a matrix to facilitate peptide ionization in matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry applications.
  • HY-P1237
    C-Type Natriuretic Peptide (CNP) (1-22), human

    Angiotensin Receptor Cardiovascular Disease Endocrinology
    C-Type Natriuretic Peptide (CNP) (1-22), human is the 1-22 fragment of C-Type Natriuretic Peptide. C-type natriuretic peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
  • HY-101453
    Ceefourin 1

    Others Cancer
    Ceefourin 1 is a potent and highly selective multidrug resistance protein 4 (MRP4) inhibitor. Ceefourin 1 inhibits transport of a broad range of MRP4 substrates, yet is highly selective for MRP4 over other ABC transporters. Ceefourin 1 is a benzothiazol and primarily as a chemosensitizer for high-risk neuroblastoma.
  • HY-P1815
    C-Type Natriuretic Peptide (1-53), human

    Angiotensin Receptor Cardiovascular Disease Endocrinology
    C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
  • HY-16908A
    Lefamulin acetate

    BC-3781 acetate

    Bacterial Antibiotic Infection
    Lefamulin acetate (BC-3781 acetate) is an orally active antibiotic for community-acquired bacterial pneumonia (CABP) treatment. Lefamulin acetate (BC-3781 acetate) is the first semi-synthetic pleuromutilin for systemic treatment of bacterial infections in humans. Lefamulin acetate (BC-3781 acetate) inhibits protein synthesis by binding to the peptidyl transferase center of the 50S bacterial ribosome, preventing the binding of transfer RNA for peptide transfer.
  • HY-113534
    MV1

    IAP Apoptosis Others
    MV1 is an antagonist of IAP (inhibitor of apoptosis protein), leads to protein knockdown of HaloTag-fused proteins when combined with HaloTag ligand.
  • HY-109565
    ASTX660

    IAP Cancer
    ASTX660 is an orally bioavailable dual antagonist of cellular inhibitor of apoptosis protein (cIAP) and X-linked inhibitor of apoptosis protein (XIAP).
  • HY-A0122
    Plicamycin

    Mithramycin A

    DNA/RNA Synthesis Bacterial Antibiotic Cancer Infection
    Plicamycin is a selective specificity protein 1 (Sp1) inhibitor. Plicamycin inhibits the growth of various cancers by decreasing Sp1 protein.
  • HY-117015
    Purfalcamine

    Parasite Infection
    Purfalcamine is an orally active, selective Plasmodium falciparum calcium-dependent protein kinase 1 (PfCDPK1) inhibitor with an IC50 of 17 nM and an EC50 of 230 nM. Purfalcamine has antimalarial activity and causes malaria parasites developmental arrest at the schizont stage.
  • HY-P1111
    Lyn peptide inhibitor

    Src Interleukin Related Inflammation/Immunology
    Lyn peptide inhibitor is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor can be used for study of  asthma, allergic, and other eosinophilic disorders.
  • HY-P0224
    N-Formyl-Met-Leu-Phe

    fMLP; N-Formyl-MLF

    TNF Receptor Inflammation/Immunology
    N-Formyl-Met-Leu-Phe (fMLP; N-Formyl-MLF) is a chemotactic peptide and a specific ligand of N-formyl peptide receptor (FPR). N-Formyl-Met-Leu-Ph is reported to inhibit TNF-alpha secretion.
  • HY-50882
    ELN318463

    γ-secretase Neurological Disease
    ELN318463 is an amyloid precursor protein (APP) selective γ-secretase inhibitor. ELN318463 shows differential inhibition of presenilin (PS1)- and PS2-comprised γ-secretase with EC50s of 12 nM and 656 nM for PS1 and PS2, respectively. ELN318463 is 51-fold more selective for PS1.
  • HY-13313
    XL888

    HSP Cancer
    XL888 is a heat shock protein-90 (HSP90) inhibitor, with an IC50 of 24 nM.
  • HY-P0052A
    Enfuvirtide acetate

    T20 acetate; DP178 acetate

    HIV Infection
    Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
  • HY-P1452A
    RNAIII-inhibiting peptide(TFA)

    Bacterial Infection
    RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
  • HY-N5118
    Chimonanthine

    (-)-Chimonanthine

    Tyrosinase Cancer
    Chimonanthine is an alkaloid of Chimonanthus praecox, inhibits tyrosinase and tyrosine-related protein-1 mRNA expression, amd inhibits melanogenesis.
  • HY-P1548
    β-CGRP, human

    Human β-CGRP; CGRP-II (Human)

    CGRP Receptor Inflammation/Immunology Cardiovascular Disease
    β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.
  • HY-P1328
    TAT-14

    Keap1-Nrf2 Others
    TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1.
  • HY-P1548B
    β-CGRP, human acetate

    Human β-CGRP acetate; CGRP-II (Human) (acetate)

    CGRP Receptor Inflammation/Immunology Cardiovascular Disease
    β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.
  • HY-P2343
    BH3 hydrochloride

    Apoptosis Cancer
    BH3 hydrochloride, a BBB penetrated peptide, provoke apoptosis either by direct activation of pro-apoptotic Bax/Bak or by neutralizing anti-apoptotic Bcl-2 proteins (Bcl-2, Bcl-XL, Bcl-w, Mcl-1 and A-1) via their BH3 domian.
  • HY-P1872
    OV-1, sheep

    Bacterial Infection
    OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa.
  • HY-P2264
    KYL peptide

    Ephrin Receptor
    KYL peptide is an EphA4 receptor tyrosine kinase inhibitor (Kd=0.8 μM). KYL peptide inhibits EphA4-EphrinA5 interactions (IC50=6.34 μM). KYL peptide prevents AβO induced synaptic damage, dendritic spine loss and prevents the blocking of LTP in hippocampal CA3-CA1 transmissions. KYL peptide also exhibits a long half life in cell culture media (8 and 12 hours in PC3 and C2C12 media respectively).
  • HY-50882A
    ELN318463 racemate

    γ-secretase Neurological Disease
    ELN318463 racemate is the racemate of ELN318463. ELN318463 is an amyloid precursor protein (APP) selective γ-secretase inhibitor. ELN318463 shows differential inhibition of presenilin (PS1)- and PS2-comprised γ-secretase with EC50s of 12nM and 656 nM for PS1and PS2, respectively. ELN318463 is 51-fold more selective for PS1.
  • HY-P2505
    Syk Kinase Peptide Substrate

    Syk Others
    Syk Kinase Peptide Substrate is a Syk kinase peptide substrate.
  • HY-134592
    Piperidine-GNE-049-N-Boc

    Ligand for Target Protein for PROTAC Cancer
    Piperidine-GNE-049-N-Boc is a ligand for target protein for PROTAC of dCBP-1 (HY-134582). dCBP-1 is a potent and selective heterobifunctional degrader of p300/CBP.
  • HY-P1116A
    PBP10 TFA

    Bacterial Infection Inflammation/Immunology
    PBP10 is a cell permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1. PBP10 is a 10-AA peptide with rhodamine conjugated at its N terminus, exerts bactericidal activity against gram-positive and gram-negative bacteria and limits microbial-induced inflammatory effects.
  • HY-112907
    RIP2 Kinase Inhibitor 3

    RIP kinase Inflammation/Immunology
    RIP2 Kinase Inhibitor 3 is a highly potent and selective inhibitor of receptor interacting protein-2 (RIP2) Kinase with an IC50 of 1 nM .
  • HY-137331
    FAPI-46

    Others Cancer
    FAPI-46 is a quinoline-based fibroblast activation protein (FAP)-targeted radiotracer. FAPI-46 has higher tumor uptake and prolonged tumor accumulation. FAPI-46 can be used for tumor imaging of a multitude of different cancers.
  • HY-U00431
    CCG 203769

    RGS Protein Neurological Disease
    CCG 203769 is a selective G protein signaling (RGS4) inhibitor, which blocks the RGS4-Gαo protein-protein interaction in vitro with an IC50 of 17 nM.
  • HY-P1328A
    TAT-14 TFA

    Keap1-Nrf2 Others
    TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1.
  • HY-P1548A
    β-CGRP, human TFA

    Human β-CGRP TFA; CGRP-II (Human) (TFA)

    CGRP Receptor Inflammation/Immunology Cardiovascular Disease
    β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells.
  • HY-110173
    TC-G 1005

    GPCR19 Metabolic Disease
    TC-G 1005 is a potent, selective and orally active agonist of the BA receptor Takeda G protein-coupled receptor 5 (TGR5), with EC50s of 0.72 and 6.2 nM for hTGR5 and mTGR5, respectively. TC-G 1005 can reduce glucose levels in vivo.
  • HY-P0214
    Autocamtide-2-related inhibitory peptide

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-16657
    TAPI-1

    MMP Cancer Inflammation/Immunology
    TAPI-1 is a TACE (ADAM17) inhibitor and blocks the shedding of several cell surface proteins. TAPI-1 is also a metalloproteinase (MMP) inhibitor.
  • HY-129239
    ASLAN003

    Dihydroorotate Dehydrogenase DNA/RNA Synthesis Apoptosis Cancer
    ASLAN003 is an orally active and potent Dihydroorotate Dehydrogenase (DHODH) inhibitor with an IC50 of 35 nM for human DHODH enzyme. ASLAN003 inhibits protein synthesis via activation of AP-1 transcription factors. ASLAN003 induces apoptosis and substantially prolongs survival in acute myeloid leukemia (AML) xenograft mice.
  • HY-P1459
    Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide)

    Bacterial Infection
    Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
  • HY-P2268
    RAGE antagonist peptide

    Amyloid-β
    RAGE antagonist peptide is an antagonist of Receptor for advanced glycation end products (RAGE). RAGE blocks S100P, S100A4 and HMGB-1 mediated RAGE activation. RAGE antagonist peptide inhibits growth and metastasis of rat glioma tumors. RAGE antagonist peptide also reduces cell growth and RAGE-mediated NF-κB activity in human PDAC cell lines.
  • HY-112504A
    INCB054329 Racemate

    Epigenetic Reader Domain Cancer
    INCB054329 Racemate is a BET protein inhibitor.
  • HY-19406
    AE-3763

    Elastase Inflammation/Immunology Cardiovascular Disease
    AE-3763 is a peptide-based human neutrophil elastase inhibitor with an IC50 of 29 nM.
  • HY-W010986
    Fmoc-N-Me-Phe-OH

    Parasite Infection
    Fmoc-N-Me-Phe-OH is a peptide inhibitor of Malaria Parasite.
  • HY-17631A
    Edonerpic maleate

    T-817 maleate; T-817MA

    Amyloid-β Neurological Disease
    Edonerpic maleate is a novel neurotrophic agent which can inhibit amyloid-β peptides ().
  • HY-100457
    IC87201

    iGluR Neurological Disease
    IC87201, an inhibitor of PSD95-nNOS protein-protein interactions, suppresses NMDAR-dependent NO and cGMP formation.
  • HY-P0214A
    Autocamtide-2-related inhibitory peptide TFA

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide (TFA) is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-P0052
    Enfuvirtide

    T20; DP178

    HIV Infection
    Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
  • HY-P1832A
    PTD-p65-P1 Peptide TFA

    NF-κB Cancer Inflammation/Immunology
    PTD-p65-P1 Peptide TFA is a nuclear transcription factor NF-kappaB inhibitor, composed of a membrane-translocating peptide sequence generated from antennapedia (PTD) conjugated with p65-P1, which selectively inhibits activation induced by various inflammatory stimuli.
  • HY-P1546
    Bombinin-Like Peptide BLP-1

    Bacterial Infection
    Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.
  • HY-P1663A
    ATWLPPR Peptide TFA

    Complement System Metabolic Disease Cardiovascular Disease
    ATWLPPR Peptide TFA, a heptapeptide, acts as a selective neuropilin-1 inhibitor, inhibits VEGF165 binding to NRP-1, used in the research of angiogenesis. ATWLPPR Peptide TFA has potential in reducing the early retinal damage caused by diabetes.
  • HY-W015445
    SD-169

    p38 MAPK Metabolic Disease
    SD-169 is an orally active ATP-competitive inhibitor of p38α MAPK, with an IC50 of 3.2 nM. SD-169 also weakly inhibits p38β MAPK with an IC50 of 122 nM. SD-169 prevents the development and progression of diabetes by inhibiting T cell infiltration and activation.
  • HY-13760
    Tasidotin hydrochloride

    ILX651

    Microtubule/Tubulin Cancer
    Tasidotin hydrochloride is a peptide analog of the antimitotic depsipeptide dolastatin 15, as an inhibitor of microtubule assembly and microtubule dynamics.
  • HY-P0081
    Bax inhibitor peptide V5

    BIP-V5; BAX Inhibiting Peptide V5

    Bcl-2 Family Cancer
    Bax inhibitor peptide V5 (BIP-V5) is a Bax-mediated apoptosis inhibitor, used for cancer treatment.
  • HY-P1034
    DAPTA

    D-Ala-peptide T-amide; Adaptavir

    CCR HIV Infection Endocrinology
    DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
  • HY-15580
    Dolastatin 10

    DLS 10; NSC 376128

    Microtubule/Tubulin ADC Cytotoxin Cancer
    Dolastatin 10 (DLS 10) is a potent antimitotic peptide, isolated from the marine mollusk Dolabela auricularia, that inhibits tubulin polymerization.
  • HY-P2504
    Syk Kinase Peptide Substrate, Biotin labeled

    Syk Others
    Syk Kinase Peptide Substrate, Biotin labeled is a biotin-labled Syk kinase peptide substrate.
  • HY-P2547
    Tyrosine Kinase Peptide 1

    Src Others
    Tyrosine Kinase Peptide 1 is a control substrate peptide for c-Src assay.
  • HY-111904
    EHMT2-IN-2

    Histone Methyltransferase Cancer
    EHMT2-IN-2 is a potent EHMT inhibitor, with IC50s of all <100 nM for EHMT1 peptide, EHMT2 peptide and cellular EHMT2. Used in the research of blood disease or cancer.
  • HY-101503
    HTS01037

    FABP Metabolic Disease
    HTS01037 is an inhibitor of fatty acid binding; and a competitive antagonist of protein-protein interactions mediated by AFABP/aP2 with a Ki of 0.67 μM.
  • HY-P2321
    TRAP-6 amide

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    TRAP-6 amide is a PAR-1 thrombin receptor agonist peptide.
  • HY-19761
    RIP2 kinase inhibitor 2

    RIP kinase Cancer
    RIP2 kinase inhibitor 2 is a receptor interacting protein-2 (RIP2) kinase inhibitor extracted from patent WO/2014043437 A1, compound example 9.
  • HY-19541
    I-CBP112

    Histone Acetyltransferase Epigenetic Reader Domain Cancer
    I-CBP112 is a specific and potent acetyl-lysine competitive protein-protein interaction inhibitor, that inhibits the CBP/p300 bromodomains, enhances acetylation by p300.
  • HY-P1261
    Parstatin(mouse)

    Protease-Activated Receptor (PAR) Inflammation/Immunology Cardiovascular Disease
    Parstatin(mouse), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis.
  • HY-P1262
    Parstatin(human)

    Protease-Activated Receptor (PAR) Inflammation/Immunology Cardiovascular Disease
    Parstatin(human), a cell-penetrating PAR-1 thrombin receptor agonist peptide, is a potent inhibitor of angiogenesis.
  • HY-P1740
    RGD peptide (GRGDNP)

    Integrin Apoptosis Inflammation/Immunology
    RGD peptide (GRGDNP) acts as an inhibitor of integrin-ligand interactions and plays an important role in cell adhesion, migration, growth, and differentiation. RGD peptide (GRGDNP) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.
  • HY-N6680
    Virginiamycin S1

    Bacterial Antibiotic Infection
    Virginiamycin S1 is a cyclic hexadepsipeptide antibiotic, inhibits bacterial protein synthesis at the level of aminoacyl-tRNA binding and peptide bond formation. Virginiamycin S1 belongs to the type B compounds in the streptogramin family and is produced by Streptomyces virginiae, shows a strong bactericidal activity against a wide range of Gram-positive bacteria. Virginiamycin S1 together with virginiamycin M1 is more effective in treat multidrug-resistant bacterial infections[1][2].
  • HY-111872
    SNIPER(ABL)-020

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-020, conjugating Dasatinib (ABL inhibitor) to Bestatin (IAP ligand) with a linker, induces the reduction of BCR-ABL protein.
  • HY-13518
    Piceatannol

    Astringenin; trans-Piceatannol

    Syk Autophagy Apoptosis Cancer
    Piceatannol is a selective inhibitor of protein tyrosine kinase Syk.
  • HY-B0472
    Streptomycin sulfate

    Bacterial Antibiotic Infection
    Streptomycin sulfate is an aminoglycoside antibiotic, that inhibits protein synthesis.
  • HY-P1758
    IFN-α Receptor Recognition Peptide 1

    IRRP1

    IFNAR Infection
    IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions.
  • HY-P2311
    Defensin HNP-2 human

    Endogenous Metabolite
    Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
  • HY-P2321A
    TRAP-6 amide TFA

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    TRAP-6 amide TFA is a PAR-1 thrombin receptor agonist peptide.
  • HY-P1565
    Transdermal Peptide Disulfide

    TD 1 Disulfide(peptide)

    Na+/K+ ATPase Inflammation/Immunology
    Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules.
  • HY-P1116
    PBP10

    Bacterial Infection Inflammation/Immunology
    PBP10 is a cell permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1. PBP10 is a 10-AA peptide with rhodamine conjugated at its N terminus, exerts bactericidal activity against gram-positive and gram-negative bacteria and limits microbial-induced inflammatory effects.
  • HY-100862
    BRCA1-IN-2

    PARP Cancer
    BRCA1-IN-2 (compound 15) is a cell-permeable protein-protein interaction (PPI) inhibitor for BRCA1 with an IC50 of 0.31 μM and a Kd of 0.3 μM, which shows antitumor activities via the disruption of BRCA1 (BRCT)2/protein interactions.
  • HY-107597
    SU3327

    JNK Metabolic Disease Inflammation/Immunology
    SU3327 is a potent, selective and substrate-competitive JNK inhibitor with an IC50 of 0.7 μM. SU3327 also inhibits protein-protein interactions between JNK and JNK Interacting Protein (JIP) with an IC50 of 239 nM. SU3327 shows less active against p38α and Akt kinase.
  • HY-59354
    Maleic hydrazide

    DNA/RNA Synthesis Cancer
    Maleic hydrazide is extensively used as a systemic plant growth regulator and as a herbicide. Maleic hydrazide acts as an inhibitor of the synthesis of nucleic acids and proteins.
  • HY-14657
    Dantrolene sodium

    F 440

    Calcium Channel Metabolic Disease
    Dantrolene sodium is a inhibitor of calcium channel proteins, inhibiting the release of Ca2+ from the sarcoplasm.
  • HY-P2502
    Hepatitis Virus C NS3 Protease Inhibitor 2

    HCV Protease HCV Infection
    Hepatitis Virus C NS3 Protease Inhibitor 2 is a product-based peptide inhibitor of hepatitis C virus (HCV) NS3 protease, with a Ki of 41 nM.
  • HY-P1728A
    Super-TDU (1-31) (TFA)

    YAP Cancer
    Super-TDU (1-31) is a peptide of Super-TDU, which is an inhibitor of YAP-TEADs, shows potent anti-tumor activity.
  • HY-P1284
    ZIP

    PKC Neurological Disease
    ZIP is a selective peptide inhibitor of PKMζ. ZIP injections can block the impairment in morphine conditioned place preference induced.
  • HY-13443
    Exendin-4

    Exenatide

    Glucagon Receptor Metabolic Disease
    Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
  • HY-13443A
    Exendin-4 acetate

    Exenatide acetate

    Glucagon Receptor Metabolic Disease
    Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
  • HY-P0069
    D-JNKI-1

    AM-111; XG-102

    JNK Others
    D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
  • HY-P0175
    740 Y-P

    740YPDGFR; PDGFR 740Y-P

    PI3K Autophagy Cancer
    740 Y-P (740YPDGFR; PDGFR 740Y-P) is a potent and cell-permeable PI3K activator. 740 Y-P readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.
  • HY-P1740A
    RGD peptide (GRGDNP) (TFA)

    Integrin Apoptosis Inflammation/Immunology Cancer
    RGD peptide (GRGDNP) (TFA) acts as an inhibitor of integrin-ligand interactions and plays an important role in cell adhesion, migration, growth, and differentiation. RGD peptide (GRGDNP) (TFA) promote apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing.
  • HY-100984
    HA-100

    PKA PKC Myosin Cancer
    HA-100 is an inhibitor of cGMP-dependent protein kinase (PKG), cAMP-dependent protein kinase (PKA), protein kinase C (PKC) and MLC-kinase with IC50s of 4, 8, 12 and 240 μM, respectively.
  • HY-P1454
    Fz7-21

    Ac-LPSDDLEFWCHVMY-NH2

    Wnt Cancer
    Fz7-21 (Ac-LPSDDLEFWCHVMY-NH2), a peptide antagonist of Frizzled 7 (FZD 7) receptors, selectively binds to FZD7 CRD subclass. The EC50 values are 58 and 34 nM for human and mouse FZD7 CRD, respectively. Fz7-21 impairs Wnt/β-catenin signaling in HEK293 cells stimulated with exogenous WNT3A (IC50=100 nM) or transfected with a construct expressing WNT3A or WNT1. Fz7-21 also blocks WNT3A-mediated stabilization of β-catenin in mouse L cells (IC50=50 nM).
  • HY-N2600
    Kuwanon H

    Bombesin Receptor Cancer
    Kuwanon H is a flavonoid isolated from Morus bombycis, which acts as a potent non-peptide bombesin receptor antagonist. Kuwanon H selectively inhibits binding of gastrin releasing peptide CRP to GRP-preferring recepotr, with a Ki value of 290 nM in cells.
  • HY-110078
    Eeyarestatin I

    p97 Apoptosis Cancer
    Eeyarestatin I, a potent endoplasmic reticulum-associated protein degradation (ERAD) inhibitor, is a potent protein translocation inhibitor. Eeyarestatin I targets the p97-associated deubiquitinating process (PAD) and inhibits atx3-dependent deubiquitination. Eeyarestatin I induces cell death via the proapoptotic protein NOXA and has anticancer effects.
  • HY-114189
    GW284543

    UNC10225170

    MEK Cancer
    GW284543 (UNC10225170) is a selective MEK5 inhibitor. GW284543 (UNC10225170) reduces pERK5, and decreases endogenous MYC protein.
  • HY-111858
    SNIPER(ABL)-050

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-050, conjugating Imatinib (ABL inhibitor) to MV-1 (IAP ligand) with a linker, induces the reduction of BCR-ABL protein.
  • HY-P1847
    IKKγ NBD Inhibitory Peptide

    NF-κB Cancer
    IKKγ NBD Inhibitory Peptide is a NEMO-binding domain peptide (NBD peptide) corresponding to the NEMO amino-terminal alpha-helical region, which is shown to block TNF-alpha-induced NF-kB activation.
  • HY-P1565A
    Transdermal Peptide Disulfide TFA

    TD 1 Disulfide(peptide) TFA

    Na+/K+ ATPase Others
    Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules.
  • HY-P1235
    Carperitide

    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
  • HY-114161
    H-Val-Pro-Pro-OH

    Angiotensin Receptor Metabolic Disease Inflammation/Immunology Endocrinology
    H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM.
  • HY-P1362
    β-Amyloid (42-1), human

    Amyloid β Peptide (42-1)(human)

    Amyloid-β Neurological Disease
    β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Amyloid β Peptide (1-42) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
  • HY-P1847A
    IKKγ NBD Inhibitory Peptide TFA

    NF-κB Inflammation/Immunology
    IKKγ NBD Inhibitory Peptide TFA is a NEMO-binding domain peptide (NBD peptide) corresponding to the NEMO amino-terminal alpha-helical region, which is shown to block TNF-alpha-induced NF-kB activation.
  • HY-P1454A
    Fz7-21 TFA

    Ac-LPSDDLEFWCHVMY-NH2 TFA

    Wnt Cancer
    Fz7-21 (Ac-LPSDDLEFWCHVMY-NH2) TFA , a peptide antagonist of Frizzled 7 (FZD 7) receptors, selectively binds to FZD7 CRD subclass. The EC50 values are 58 and 34 nM for human and mouse FZD7 CRD, respectively. Fz7-21 impairs Wnt/β-catenin signaling in HEK293 cells stimulated with exogenous WNT3A (IC50=100 nM) or transfected with a construct expressing WNT3A or WNT1. Fz7-21 also blocks WNT3A-mediated stabilization of β-catenin in mouse L cells (IC50=50 nM).
  • HY-P1029
    MLCK inhibitor peptide 18

    Myosin CaMK Autophagy Others
    MLCK inhibitor peptide 18 is a myosin light chain kinase (MLCK) inhibitor with an IC50 of 50 nM, and inhibits CaM kinase II only at 4000-fold higher concentrations.
  • HY-P1144
    Oxyntomodulin

    Glucagon Receptor Metabolic Disease
    Oxyntomodulin, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
  • HY-14563
    VU10010

    mAChR Neurological Disease
    VU10010 is a potent, highly selective and allosteric M4 mAChR potentiator with an EC50 of 400 nM. VU10010 binds to an allosteric site on M4 mAChR and increases affinity for acetylcholine and coupling to G proteins. VU10010 increases carbachol-induced depression of transmission at excitatory but not inhibitory synapses in the hippocampus.
  • HY-114657A
    Benproperine phosphate

    Arp2/3 Complex Cancer Inflammation/Immunology
    Benproperine phosphate is an orally active, potent actin-related protein 2/3 complex subunit 2 (ARPC2) inhibitor. Benproperine phosphate attenuates the actin polymerization rate of action polymerization nucleation by impairing Arp2/3 function. Benproperine phosphate has the potential for a cough suppressant and suppresses cancer cell migration and tumor metastasis.
  • HY-14393
    Emodin

    Frangula emodin

    SARS-CoV Casein Kinase Autophagy Cancer
    Emodin (Frangula emodin), an anthraquinone derivative isolated from genus Rheum and Polygonum, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.
  • HY-U00329
    Implitapide Racemate

    Others Metabolic Disease Cardiovascular Disease
    Implitapide Racemate is the racemate of Implitapide. Implitapide is a microsomal triglyceride transfer protein (MTP) inhibitor.
  • HY-106130
    Implitapide

    AEGR 427

    Others Metabolic Disease Cardiovascular Disease
    Implitapide (AEGR 427) is a microsomal triglyceride transfer protein (MTP) inhibitor.
  • HY-10183
    Go6976

    PKC Infection
    Go6976 is a Protein Kinase C (PKC) inhibitor, with an IC50 of 20 nM.
  • HY-N0082
    Praeruptorin B

    Praeruptorin D

    Fatty Acid Synthase (FASN) Metabolic Disease
    Praeruptorin B is an inhibitor of sterol regulatory element-binding proteins (SREBPs).
  • HY-15870
    SR 11302

    Others Cancer Inflammation/Immunology
    SR 11302 is an activator protein-1 (AP-1) transcription factor inhibitor. SR 11302 is a retinoid that specifically inhibits AP-1 activity without activating the transcription of retinoic acid response element (RARE).
  • HY-P1186
    Eledoisin Related Peptide

    Eledoisin-Related Peptide; Eledoisin RP

    Neurokinin Receptor Neurological Disease
    Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
  • HY-P1497
    Bradykinin (1-3)

    Bradykinin Receptor Cardiovascular Disease Endocrinology
    Bradykinin (1-3) is a 3-amino acid residue peptide. Bradykinin (1-3) is an amino-truncated Bradykinin peptide, cleaved by Prolyl endopeptidase.
  • HY-P1144A
    Oxyntomodulin TFA

    Glucagon Receptor Metabolic Disease
    Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
  • HY-P1284A
    ZIP TFA

    PKC Neurological Disease
    ZIP TFA is a selective peptide inhibitor of PKMζ. ZIP TFA injections can block the impairment in morphine conditioned place preference induced.
  • HY-114161A
    H-Val-Pro-Pro-OH TFA

    Angiotensin Receptor Metabolic Disease Inflammation/Immunology Endocrinology
    H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM.
  • HY-P1841
    Glucagon-Like Peptide (GLP) II, human

    Endogenous Metabolite Apoptosis Metabolic Disease
    Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
  • HY-19991
    BMS-1

    PD-1/PD-L1 inhibitor 1

    PD-1/PD-L1 Apoptosis Cancer Inflammation/Immunology
    BMS-1 is an inhibitor of the PD-1/PD-L1 protein/protein interaction (IC50 between 6 and 100 nM).
  • HY-B1228
    Ribostamycin sulfate

    Vistamycin sulfate

    Bacterial Antibiotic Infection
    Ribostamycin sulfate (Vistamycin sulfate) is a broad-spectrum antimicrobial, inhibits bacterial protein synthesis at the level of 30S and 50S ribosomal subunit binding, also inhibits the chaperone activity of protein disulfide isomerase (PDI), used in pharmacokinetic and nephrotoxicity studies
  • HY-100757
    CPUY074020

    Histone Methyltransferase Cancer
    CPUY074020 is a potent and oral bioavailable inhibitor of histone methyltransferase G9a, with an IC50 of 2.18 μM. CPUY074020 possesses anti-proliferative activity.
  • HY-15979
    H-89

    PKA Autophagy Neurological Disease
    H-89 is a potent and selective inhibitor of cyclic AMP-dependent protein kinase (protein kinase A) with IC50 of 48 nM and has weak inhibition on PKG, PKC, Casein Kinase, and others kinases.
  • HY-16786
    AI-10-49

    Others Cancer
    AI-10-49 is a protein-protein interaction inhibitor that selectively binds to CBFβ-SMMHC and disrupts its binding to RUNX1 with a FRET IC50 of 0.26 uM.
  • HY-D1270
    Direct Violet 1

    SARS-CoV Infection
    Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and ACE2 inhibitor with IC50s of 1.47-2.63 µM.
  • HY-B1743A
    Puromycin dihydrochloride

    CL13900 dihydrochloride

    Bacterial Antibiotic Infection
    Puromycin dihydrochloride (CL13900 dihydrochloride), an aminonucleoside antibiotic, inhibits protein synthesis.
  • HY-50759
    Ispinesib

    SB-715992

    Kinesin Apoptosis Cancer
    Ispinesib is a specific inhibitor of kinesin spindle protein (KSP), with a Ki app of 1.7 nM.
  • HY-16706
    Remodelin

    Histone Acetyltransferase Cancer
    Remodelin is a novel potent and selective inhibitor of the acetyl-transferase protein NAT10.
  • HY-15680
    O-Propargyl-Puromycin

    Others Others
    O-Propargyl-Puromycin, an alkyne analog of puromycin, is a potent protein synthesis inhibitor.
  • HY-133248
    Daclatasvir Impurity C

    Others Others
    Daclatasvir Impurity C is the impurity of Daclatasvir. Daclatasvir is a potent HCV NS5A protein inhibitor.
  • HY-133247
    Daclatasvir Impurity B

    Others Others
    Daclatasvir Impurity B is the impurity of Daclatasvir. Daclatasvir is a potent HCV NS5A protein inhibitor.
  • HY-128347
    M‑89

    Epigenetic Reader Domain Cancer Inflammation/Immunology
    M-89 is a highly potent and specific menin inhibitor, with a Kd of 1.4 nM for binding to menin. M-89 inhibits the menin-mixed lineage leukemia (Menin-MLL) protein-protein interaction and has potential to treat MLL leukemia.
  • HY-122862
    RAS inhibitor Abd-7

    Ras Cancer
    RAS inhibitor Abd-7, a potent RAS-binding compound (Kd=51 nM), is a RAS-effector protein-protein interaction (PPI) inhibitor. RAS inhibitor Abd-7 interacts with RAS inside the cells, prevents RAS-effector interactions and inhibits endogenous RAS-dependent signaling. RAS inhibitor Abd-7 impairs the PPI of various mutant KRAS proteins with PI3K, CRAF and RALGDS as well as NRAS Q61H and HRAS G12V.
  • HY-B1358
    Lincomycin hydrochloride monohydrate

    Bacterial Antibiotic Infection
    Lincomycin hydrochloride monohydrate is a narrow-spectrum antibiotic, has similar effects to erythromycin, which has a good effect on gram-positive coccus, mainly used to inhibit the synthesis of bacterial cell protein.
  • HY-128853
    Taurodeoxycholate sodium salt

    Endogenous Metabolite Inflammation/Immunology
    Taurodeoxycholate sodium salt is a bile salt-related anionic detergent used for isolation of membrane proteins including inner mitochondrial membrane proteins. Taurodeoxycholate (TDCA) inhibits various inflammatory responses .
  • HY-112258
    IMP-1088

    DNA/RNA Synthesis Infection
    IMP-1088 is a potent human N-myristoyltransferases NMT1 and NMT2 dual inhibitor with IC50s of <1 nM for HsNMT1 and HsNMT2. IMP-1088 has a Kd of <210 pM for HsNMT1. IMP-1088 efficiently blocks rhinovirus replication by blocking rhinovirus virus-encoded protein (VP0) N-myristoylation. IMP-1088 protects host cells from the cytotoxic effects of viral infection.
  • HY-P0119A
    Lixisenatide acetate

    Glucagon Receptor Metabolic Disease
    Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
  • HY-P0119
    Lixisenatide

    Glucagon Receptor Metabolic Disease
    Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
  • HY-P2519
    Protease-Activated Receptor-3 (PAR-3) (1-6), human

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    Protease-Activated Receptor-3 (PAR-3) (1-6), human is a proteinase-activated receptor (PAR-3) agonist peptide.
  • HY-P1789
    CTTHWGFTLC, CYCLIC

    MMP Cancer Inflammation/Immunology
    CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM.
  • HY-13502
    Mitoxantrone

    mitozantrone

    Topoisomerase PKC Cancer
    Mitoxantrone is a topoisomerase II inhibitor; also inhibits protein kinase C (PKC) activity with an IC50 of 8.5 μM.
  • HY-13502A
    Mitoxantrone dihydrochloride

    mitozantrone dihydrochloride

    Topoisomerase PKC Cancer
    Mitoxantrone dihydrochloride is a topoisomerase II inhibitor; also inhibits protein kinase C (PKC) activity with an IC50 of 8.5 μM.
  • HY-111117
    3-Methyltoxoflavin

    Others Cancer
    3-Methyltoxoflavin is a potent Protein disulfide isomerase (PDI) inhibitor, with an IC50 of 170 nM.
  • HY-U00270
    CP-319340(free base)

    Others Metabolic Disease
    CP-319340 free base is a microsomal triglyceride transfer protein (MTP) inhibitor.
  • HY-N0193
    Artesunate

    STAT Ferroptosis Parasite Virus Protease Cancer
    Artesunate is an inhibitor of both STAT-3 and exported protein 1 (EXP1).
  • HY-101525
    MBP146-78

    Parasite Infection
    MBP146-78 is a potent and selective inhibitor of cGMP dependent protein kinases.
  • HY-15300
    Skepinone-L

    CBS3830

    p38 MAPK Autophagy Inflammation/Immunology
    Skepinone-L (CBS3830) is a selective p38 mitogen-activated protein kinase inhibitor.
  • HY-10499
    PH-064

    BIM-46187

    Others Neurological Disease
    PH-064 (BIM-46187) is an inhibitor of heterotrimeric G-protein complex.
  • HY-100496
    Nucleocidin

    4'-Fluoro-5'-O-sulfamoyladenosine; NSC 521007

    Bacterial Infection
    Nucleocidin is an antitrypanosomal antibiotic, inhibiting the transfer of labeled amino acid from S-RNA to protein.
  • HY-18983
    Calyculin A

    (-)-Calyculin A

    Phosphatase Cancer
    Calyculin A ((-)-Calyculin A) is a potent and cell-permeable protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) inhibitor with IC50s of 2 nM and 0.5-1 nM, respectively.
  • HY-P1046
    β-Amyloid 1-15

    Amyloid β-Protein (1-15)

    Amyloid-β Neurological Disease
    β-Amyloid (1-15) is a fragment of β-Amyloid peptide. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
  • HY-P1378
    Amyloid β-Peptide(1-43)(human)

    Amyloid-β Neurological Disease
    Amyloid β-Peptide(1-43) human, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
  • HY-P2538
    Big Endothelin-1 (1-38), human

    Vasopressin Receptor Cardiovascular Disease
    Big Endothelin-1 (1-38), human is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide.
  • HY-108391
    C8-Ceramide

    N-Octanoyl-D-erythro-sphingosine

    Apoptosis PKC Autophagy Cancer Inflammation/Immunology
    C8-Ceramide (N-Octanoyl-D-erythro-sphingosine) is a cell-permeable analog of naturally occurring ceramides. C8-Ceramide has anti-proliferation properties and acts as a potent chemotherapeutic agent. C8-Ceramide stimulates dendritic cells to promote T cell responses upon virus infections. C8-Ceramide induces slight activation of protein kinase (PKC) in vitro.
  • HY-112080
    BAY-6035

    Histone Methyltransferase Cancer
    BAY-6035 is a potent, selective and substrate-competitive inhibitor of SMYD3. BAY-6035 inhibits methylation of MEKK2 peptide with an IC50 of 88 nM.
  • HY-U00171
    SQ28603

    SQ28,603; Squibb 28603

    Neprilysin Metabolic Disease
    SQ28603 is a potent and selective inhibitor of neutral endopeptidase 3.4.24.11 (NEP), an enzyme that degrades atrial natriuretic peptide (ANP).
  • HY-16664
    SJ-172550

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    SJ-172550 is a small molecule inhibitor of MDMX; competes for the wild type p53 peptide binding to MDMX with an EC50 of 5 μM.
  • HY-W012479
    H-D-Trp-OH

    Endogenous Metabolite Metabolic Disease
    H-D-Trp-OH is a D-stereoisomer of tryptophan and occasionally found in naturally produced peptides such as the marine venom peptide.
  • HY-P1789A
    CTTHWGFTLC, CYCLIC TFA

    MMP Cancer Inflammation/Immunology
    CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM.
  • HY-N2036
    Mosloflavone

    Enterovirus Bacterial Infection
    Mosloflavone is a flavonoid isolated from Scutellaria baicalensis Georgi with  anti-EV71 activity. Mosloflavone  inhibits VP2 virus replication and protein expression during the initial stage of virus infection and inhibits viral VP2 capsid protein synthesis. Mosloflavone is a promising biocide and inhibits P. aeruginosa virulence and biofilm formation.
  • HY-129658A
    TT-OAD2

    Glucagon Receptor Metabolic Disease
    TT-OAD2 is a non-peptide glucagon-like peptide-1 (GLP-1) receptor agonist with an EC50 of 5 nM. TT-OAD2 has the potential for diabetes treatment.
  • HY-P2468
    BAD (103-127) (human)

    Bcl-2 Family Cancer
    BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL. BAD (103-127) (human) is reported to have almost 800-fold higher affinity for Bcl-XL than the 16-mer peptide.
  • HY-17640
    Nicodicosapent

    Fatty Acid Synthase (FASN) Autophagy Metabolic Disease
    Nicodicosapent is a fatty acid niacin conjugate that is also an inhibitor of the sterol regulatory element binding protein (SREBP), a key regulator of cholesterol metabolism proteins such as PCSK9, HMG-CoA reductase, ATP citrate lyase, and NPC1L1.
  • HY-P1378A
    Amyloid β-Peptide(1-43)(human) TFA

    Amyloid-β Neurological Disease
    Amyloid β-Peptide(1-43) human TFA, the Human β-amyloid peptide, is minor component of neuritic plaques found in brains of patients with Alzheimer's disease.
  • HY-P1083
    Dynamin inhibitory peptide

    Dynamin Neurological Disease
    Dynamin inhibitory peptide competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide blocks the dopamine D3 effect on GABAA receptors.
  • HY-126666
    PNU-159682 carboxylic acid

    ADC Cytotoxin Cancer Inflammation/Immunology
    PNU-159682 carboxylic acid (compound 53) is a potent ADCs cytotoxin and encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. PNU-159682 carboxylic acid has protein fold and diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response.
  • HY-102059
    MOZ-IN-2

    Histone Acetyltransferase Cancer
    MOZ-IN-2 is an inhibitor of protein MOZ, a member of histone acetyltransferases, with an IC50 of 125 μM.
  • HY-130839
    LolCDE-IN-1

    Bacterial Infection
    LolCDE-IN-1 is an inhibitor of the Lol proteins (LolCDE) complex, with antibacterial activity.
  • HY-W010128
    6-(Dimethylamino)purine

    6-Dimethylaminopurine

    CDK Others
    6-(Dimethylamino)purine is a dual inhibitor of protein kinase and CDK.
  • HY-15857
    CW-069

    Kinesin Cancer
    CW-069 is an allosteric inhibitor of microtubule motor protein HSET with an IC50 of 75 μM.
  • HY-107997
    TAP311

    CETP Cardiovascular Disease
    TAP311 is a cholesteryl ester transfer protein (CETP) inhibitor with an IC50 of 62 nM.
  • HY-12312
    TCS 401

    Phosphatase Metabolic Disease
    TCS 401 is a selective inhibitor of protein tyrosine phosphatase 1B (PTP1B).
  • HY-100025A
    HLCL-61 hydrochloride

    Histone Methyltransferase Apoptosis Cancer
    HLCL-61 hydrochloride is a first-in-class inhibitor of protein arginine methyltransferase 5 (PRMT5).
  • HY-19810
    MI-538

    Epigenetic Reader Domain Cancer
    MI-538 is an inhibitor of the interaction between menin and MLL fusion proteins with an IC50 of 21 nM.
  • HY-101295
    Pan-RAS-IN-1

    Ras Cancer
    Pan-RAS-IN-1 is a pan-Ras inhibitor that disrupts the interaction of Ras proteins and their effectors.
  • HY-B0408A
    Clindamycin hydrochloride

    Bacterial Antibiotic Infection
    Clindamycin (hydrochloride) is a semisynthetic lincosamide antibiotic, which inhibits protein synthesis by acting on the 50S ribosomal.
  • HY-128642
    FAPI-2

    Others Cancer
    FAPI-2 is a fibroblast activation protein (FAP) inhibitor for cancer research.
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Glucagon Receptor Metabolic Disease
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-P1246
    Neuropeptide AF (human)

    Neuropeptide AF (93-110), human

    Opioid Receptor Neurological Disease
    Neuropeptide AF (human) is an endogenous antiopioid peptide.
  • HY-P1229
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Glucagon Receptor Metabolic Disease
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-10340B
    Tirbanibulin Mesylate

    KX2-391 Mesylate; KX01 Mesylate

    Src Microtubule/Tubulin Cancer
    Tirbanibulin Mesylate (KX2-391 Mesylate) is an inhibitor of Src that targets the peptide substrate site of Src, with GI50 of 9-60 nM in cancer cell lines.
  • HY-12465
    Z-Ile-Leu-aldehyde

    Z-IL-CHO; GSI-XII; γ-Secretase inhibitor XII

    Notch γ-secretase Apoptosis Cancer
    Z-Ile-Leu-aldehyde (Z-IL-CHO) is a potent and competitive peptide aldehyde inhibitor of γ-secretase and notch.
  • HY-10340
    Tirbanibulin

    KX2-391; KX-01

    Src Microtubule/Tubulin Cancer
    Tirbanibulin (KX2-391) is an inhibitor of Src that targets the peptide substrate site of Src, with GI50 of 9-60 nM in cancer cell lines.
  • HY-10340A
    Tirbanibulin dihydrochloride

    KX2-391 dihydrochloride; KX-01 dihydrochloride

    Src Microtubule/Tubulin Cancer
    Tirbanibulin (dihydrochloride) (KX2-391 (dihydrochloride)) is an inhibitor of Src that targets the peptide substrate site of Src, with GI50 of 9-60 nM in cancer cell lines.
  • HY-138295
    KRAS inhibitor-10

    Ras Cancer
    KRAS inhibitor-10 selectively and effectively inhibit RAS proteins, and particularly KRAS proteins. KRAS inhibitor-10 is an orally active anti-cancer agent and can be used for cancer research, such as pancreatic cancer, breast cancer, multiple myeloma, leukemia and lung cancer. KRAS inhibitor-10 is a tetrahydroisoquinoline compound (compound 11) extracted from patent WO2021005165 A1.
  • HY-135145
    CB-103

    Notch Cancer
    CB-103 is a first-in-class, orally active protein-protein interaction (PPI) inhibitor of the NOTCH transcriptional activation complex. CB-103 has anti-tumor activity.
  • HY-133735A
    GRP-60367 hydrochloride

    Others Infection
    GRP-60367 hydrochloride is a first-in-class small-molecule rabies virus (RABV) entry inhibitor with nanomolar potency against some RABV strains. GRP-60367 hydrochloride specifically targets the RABV G protein.
  • HY-100341
    M2I-1

    Others Others
    M2I-1 is a Mad2 inhibitor targeting the binding of Mad2 to Cdc20, an essential protein-protein interaction (PPI) within the spindle assembly checkpoint (SAC).
  • HY-P0272
    Peptide T

    HIV Infection
    Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
  • HY-P2518
    Protease-Activated Receptor-1, PAR-1 Agonist

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    Protease-Activated Receptor-1, PAR-1 Agonist is a thrombin-specific, protease-activated receptor 1 (PAR-1)-specific agonist peptide.
  • HY-P2294
    pm26TGF-β1 peptide

    TGF-β Receptor Inflammation/Immunology
    pm26TGF-β1 peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction.
  • HY-111489A
    LMPTP INHIBITOR 1 hydrochloride

    Phosphatase Metabolic Disease
    LMPTP INHIBITOR 1 (hydrochloride) is a selective inhibitor of low molecular weight protein tyrosine phosphatase (LMPTP), with an IC50 of 0.8 μM LMPTP-A.
  • HY-111489B
    LMPTP INHIBITOR 1 dihydrochloride

    Phosphatase Metabolic Disease
    LMPTP INHIBITOR 1 (dihydrochloride) is a selective inhibitor of low molecular weight protein tyrosine phosphatase (LMPTP), with an IC50 of 0.8 μM LMPTP-A.
  • HY-114426
    AT-1002

    Gap Junction Protein Metabolic Disease
    AT-1002, a 6-mer synthetic peptide, is a tight junction regulator and absorption enhancer.
  • HY-P2503
    EGFR Protein Tyrosine Kinase Substrate

    EGFR Cancer
    EGFR Protein Tyrosine Kinase Substrate is a EGFR protein tyrosine kinase substrate.
  • HY-P0272A
    Peptide T TFA

    HIV Infection
    Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
  • HY-P1083A
    Dynamin inhibitory peptide TFA

    Dynamin Neurological Disease
    Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors.
  • HY-13250
    Silvestrol aglycone

    Others Cancer
    Silvestrol aglycone is a Silvestrol analogue, inhibits protein translation initiation in cancer cells, with EC50s of 10 and 200 nM for myc-LUC and tub-LUC luciferase reporter protein translation, respectively. Anti-cancer activity.
  • HY-111192
    IPR-803

    Ser/Thr Protease Cancer
    IPR-803 is a potent inhibitor of the uPAR•uPA protein-protein interaction (PPI). IPR-803 binds directly to uPAR with sub-micromolar affinity. IPR-803 displays anti-tumor activity.
  • HY-D0852
    Sodium orthovanadate

    Phosphatase Cancer
    Sodium orthovanadate is an inhibitor of protein tyrosine phosphatases, alkaline phosphatases and a number of ATPases, most likely acting as a phosphate analogue.
  • HY-N2301
    Pleuromutilin

    Drosophilin B; Mutilin 14-glycolate

    Bacterial Antibiotic Infection
    Pleuromutilin (Drosophilin B) inhibits bacterial protein synthesis by binding to the 50S ribosomal subunit of bacteria.
  • HY-16587
    Saridegib

    IPI-926; Patidegib

    Smo Cancer
    Saridegib is a potent and specific inhibitor of Smoothened (Smo), a key signaling transmembrane protein in the Hedgehog (Hh) pathway.
  • HY-16207
    FGH10019

    Fatty Acid Synthase (FASN) Metabolic Disease
    FGH10019 is a novel sterol regulatory element-binding protein (SREBP) inhibitor with IC50 of 1 μM.
  • HY-14987
    AX20017

    Bacterial Infection
    AX20017 is a small-molecule protein kinase G (PknG) inhibitor with an IC50 of 0.39 μM.
  • HY-128643
    FAPI-4

    Others Cancer
    FAPI-4 is a fibroblast activation protein (FAP) inhibitor used in cancer research.
  • HY-12762
    QS11

    Others Cancer
    QS11 is an inhibitor of ARFGAP1 (ADP-ribosylation factor GTPase-activating protein 1), with an EC50 of 1.5 µM. QS11 modulates Wnt/β-catenin signaling through an effect on protein trafficking. QS11 inhibits migration of ARFGAP overexpressing breast cancer cells.
  • HY-18982
    Anisomycin

    Flagecidin; Wuningmeisu C

    DNA/RNA Synthesis JNK Bacterial Apoptosis Antibiotic Cancer Infection
    Anisomycin is a potent protein synthesis inhibitor which interferes with protein and DNA synthesis by inhibiting peptidyl transferase or the 80S ribosome system. Anisomycin is a JNK activator, which increases phospho-JNK. Anisomycin is a bacterial antibiotic isolated from Streptomyces griseolus.
  • HY-P0014
    Liraglutide

    Glucagon Receptor Metabolic Disease
    Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus.
  • HY-112679
    GLP-1 receptor agonist 2

    Glucagon Receptor Others
    GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.
  • HY-114426A
    AT-1002 TFA

    Gap Junction Protein Metabolic Disease
    AT-1002 TFA, a 6-mer synthetic peptide, is a tight junction regulator and absorption enhancer.
  • HY-125269
    TED-347

    YAP Cancer
    TED-347 is a potent, irreversible, covalent and allosteric inhibitor at YAP-TEAD protein-protein interaction with an EC50 of 5.9 μM for TEAD4⋅Yap1 protein-protein interaction. TED-347 specifically and covalently bonds with Cys-367 within the central pocket of TEAD4 with a Ki of 10.3 μM. TED-347 blocks TEAD transcriptional activity and has antitumor activity.
  • HY-129658
    TT-OAD2 free base

    Glucagon Receptor Metabolic Disease
    TT-OAD2 free base is a non-peptide glucagon-like peptide-1 (GLP-1) receptor agonist with an EC50 of 5 nM. TT-OAD2 free base has the potential for diabetes treatment.
  • HY-W012282
    3′-Deoxyuridine

    Others Cancer Infection
    3′-Deoxyuridine is a potential anticancer and antiviral agent. 3'-deoxyuridine inhibits bovine diarrhoea virus (BVDV) production.
  • HY-P1063
    LF11

    Bacterial Antibiotic Infection
    LF11 is a peptide with antibacterial activity.
  • HY-P2466
    Bax BH3 peptide (55-74), wild type

    Apoptosis Cancer
    Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models.
  • HY-15886
    Mdivi-1

    Mitochondrial division inhibitor 1

    Dynamin Mitophagy Autophagy Apoptosis Cancer
    Mdivi-1 is a selective dynamin-related protein 1 (Drp1) inhibitor. Mdivi-1 is a mitochondrial division/mitophagy inhibitor.
  • HY-77048
    IRAK-4 protein kinase inhibitor 2

    IRAK Inflammation/Immunology
    IRAK-4 protein kinase inhibitor 2 (compound 1) is a potent inhibitor of interleukin-1 (IL-1) receptor-associated kinase-4 (IRAK-4), with an IC50 of 4 μM. IRAK-4 protein kinase inhibitor 2 can be used for the research of inflammatory and immune-related conditions or disorders.
  • HY-P2294A
    pm26TGF-β1 peptide TFA

    TGF-β Receptor Inflammation/Immunology
    pm26TGF-β1 TFA peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide TFA shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide TFA displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction.
  • HY-16592
    Brefeldin A

    BFA; Cyanein; Decumbin

    Autophagy CRISPR/Cas9 Mitophagy HSV Antibiotic Cancer Infection
    Brefeldin A (BFA) is a lactone antibiotic and a specific inhibitor of protein trafficking. Brefeldin A blocks the transport of secreted and membrane proteins from endoplasmic reticulum to Golgi apparatus. Brefeldin A is also an autophagy and mitophagy inhibitor. Brefeldin A is a CRISPR/Cas9 activator. Brefeldin A inhibits HSV-1 and has anti-cancer activity.
  • HY-15450A
    INCB 3284

    CCR Endocrinology
    INCB 3284 is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 can be used in the research of acute liver failure.
  • HY-19319
    MI-136

    Epigenetic Reader Domain Androgen Receptor Apoptosis Cancer
    MI-136 is an inhibitor of the menin-MLL protein-protein interaction (PPI), with an IC50 of 31 nM and a Kd of 23.6 nM. MI-136 shows to block AR signaling and has the potential for the study in castration-resistant tumors.
  • HY-P1731
    Tirzepatide

    LY3298176

    Glucagon Receptor Metabolic Disease
    Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes.
  • HY-P1731B
    Tirzepatide hydrochloride

    LY3298176 hydrochloride

    Glucagon Receptor Metabolic Disease
    Tirzepatide hydrochloride (LY3298176 hydrochloride) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes.
  • HY-P1495
    Small Cardioactive Peptide B SCPB

    Adenylate Cyclase Neurological Disease Cardiovascular Disease
    Small Cardioactive Peptide B (SCPB), a neurally active peptide, stimulates adenylate cyclase activity in particulate fractions of both heart and gill tissues with EC50s of 0.1 and 1.0 μM, respectively.
  • HY-P1236
    Atrial Natriuretic Peptide (ANP) (1-28), rat

    Atrial natriuretic factor (1-28) (rat)

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Atrial Natriuretic Peptide (ANP) (1-28), rat is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
  • HY-100527
    AN2718

    Fungal Infection
    AN2718 inhibits fungal growth by blocking protein synthesis using the oxaborole tRNA trapping (OBORT) mechanism.
  • HY-111744
    Deacetylanisomycin

    Others Metabolic Disease
    Deacetylanisomycin is a potent growth regulator in plants and an inactive derivative of Anisomycin. Anisomycin is a potent protein synthesis inhibitor .
  • HY-100464
    tBID

    DYRK Cancer
    tBID is a selective inhibitor of homeodomain-interacting protein kinase 2 (HIPK2) with an IC50 of  0.33 µM.
  • HY-100333
    PF-02575799

    Others Metabolic Disease
    PF-02575799 is a microsomal triglyceride transfer protein (MTP) inhibitor with an IC50 of 0.77±0.29 nM.
  • HY-P0089A
    Human growth hormone-releasing factor TFA

    Growth Hormone Releasing Factor human TFA

    GHSR Endocrinology
    Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.
  • HY-P0089
    Human growth hormone-releasing factor

    Growth Hormone Releasing Factor human

    GHSR Endocrinology
    Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.
  • HY-10542A
    (Z)-GW 5074

    Raf Neurological Disease
    (Z)-GW 5074 is a compound which interacts with both mHTT (mutant huntingtin protein) and LC3, but not but not with the wild-type HTT protein. (Z)-GW 5074 inhibits c-Raf, shows no effect on autophagy, and is effective for neurodegenerative disorder.
  • HY-12825
    BHPI

    Estrogen Receptor/ERR Cancer
    BHPI is a potent inhibitor of nuclear estrogen–ERα-regulated gene expression; elicits sustained ERα-dependent activation of the endoplasmic reticulum (EnR) stress sensor, the unfolded protein response (UPR), and persistent inhibition of protein synthesis.
  • HY-16711
    SB225002

    CXCR Inflammation/Immunology Endocrinology Cancer
    SB225002, a potent, selective and non-peptide CXCR2 antagonist, inhibits 125I-IL-8 binding to CXCR2 with an IC50 of 22 nM.
  • HY-100869
    MM-589

    Histone Methyltransferase Cancer
    MM-589 is a potent inhibitor of WD repeat domain 5 (WDR5) and mixed lineage leukemia (MLL) protein-protein interaction. MM-589 binds to WDR5 with an IC50 of 0.90 nM and inhibits the MLL H3K4 methyltransferase activity with an IC50 of 12.7 nM.
  • HY-N7089
    Benzoyleneurea

    Bacterial Infection
    Benzoyleneurea possesses anti-bacterial activity. Benzoyleneurea scaffold can be used in the synthesis of novel protein geranylgeranyltransferase-I (PGGTase-I) inhibitors.
  • HY-P1063A
    LF11 TFA

    Bacterial Antibiotic Infection
    LF11 TFA is a peptide with antibacterial activity.
  • HY-P1329
    CTOP

    Opioid Receptor Neurological Disease
    CTOP is a peptide that acts as a μ-opioid receptor antagonist.
  • HY-13433
    Thapsigargin

    Calcium Channel SARS-CoV Apoptosis Cancer Infection
    Thapsigargin, an endoplasmic reticulum (ER) stress inducer, is an inhibitor of microsomal Ca 2+-ATPase. Thapsigargin efficiently inhibits coronavirus (HCoV-229E, MERS-CoV, SARS-CoV-2) replication in different cell types.
  • HY-P0133
    (Arg)9

    Nona-L-arginine; Peptide R9

    Others Neurological Disease
    (Arg)9 (Nona-L-arginine;Peptide R9) is a cell-penetrating peptide; exhibits neuroprotective activity with an IC50 of 0.78 μM in the glutamic acid model.
  • HY-P2319
    OVA-E1 peptide

    p38 MAPK JNK Inflammation/Immunology
    OVA-E1 peptide, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes.
  • HY-P1363
    β-Amyloid (1-42), human TFA

    Amyloid β-Peptide (1-42) (human) TFA

    Amyloid-β Neurological Disease
    β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
  • HY-136172
    ESI-08

    Ras Cancer Metabolic Disease Cardiovascular Disease
    ESI-08 is a potent and selective EPAC antagonist, which can completely inhibit both EPAC1 and EPAC2 (IC50 of 8.4 μM) activity. ESI-08 selectively blocks cAMP-induced EPAC activation, but does not inhibit cAMP-mediated PKA activation.
  • HY-101512
    A-395

    Histone Methyltransferase Cancer
    A-395 is an antagonist of polycomb repressive complex 2 (PRC2) protein-protein interactions that potently inhibits the trimeric PRC2 complex (EZH2-EED-SUZ12) with an IC50 of 18 nM.
  • HY-128577
    NIC3

    Others Cancer
    NIC3 is a selective nucleus accumbens-associated protein-1 (NAC1) inhibitor, binds to the conserved Leu-90 of NAC1, prevents its homodimerization, and leads to proteasomal NAC1 degradation. Anti-cancer activity.
  • HY-15450
    INCB 3284 dimesylate

    CCR Endocrinology
    INCB 3284 dimesylate is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC50 of 3.7 nM. INCB 3284 dimesylate can be used in the research of acute liver failure.
  • HY-19764
    GSK2983559 active metabolite

    RIP kinase Cancer
    GSK2983559 active metabolite is an active metabolite of GSK2983559. GSK2983559 active metabolite is a receptor interacting protein-2 (RIP2) kinase inhibitor extracted from patent WO/2014043446 A1, compound example 1.
  • HY-W041994
    GMBS

    Others Cancer
    GMBS is a heterobifunctional cross-linker. GMBS can be used in chemical cross-linking of proteins coupled with mass spectrometry (CXMS) to study protein folding and to map the interfaces between interacting proteins.
  • HY-14443
    XMD8-92

    ERK Epigenetic Reader Domain Cancer
    XMD8-92 is a potent ERK5 (BMK1)/BRD4 inhibitor with Kds of 80 and 190 nM, respectively. XMD8-92 inhibits DCAMKL2, PLK4 and TNK1 with Kds of 190, 600 and 890 nM, respectively. Anti-cancer activity.
  • HY-P1404
    R8-T198wt

    Pim Cancer
    R8-T198wt is a cell-permeable carboxyl-terminal p27 Kip1 peptide exhibits anti-tumor activity by inhibiting Pim-1 kinase.
  • HY-P1236A
    Atrial Natriuretic Peptide (ANP) (1-28), rat TFA

    Atrial natriuretic factor (1-28) (rat) TFA

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Atrial Natriuretic Peptide (ANP) (1-28), rat (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
  • HY-120179A
    LP-922761 hydrate

    Others Neurological Disease
    LP-922761 hydrate is a potent, selective and orally active adapter protein-2 associated kinase 1 (AAK1) inhibitor with IC50s of 4.8 nM and 7.6 nM in enzyme and cell assays, respectively. LP-922761 hydrate also inhibits BMP-2-inducible protein kinase (BIKE) with an IC50 of 24 nM. LP-922761 hydrate shows less activity at cyclin G-associated kinase (GAK), opioid, adrenergic α2 or GABAa receptors.
  • HY-120179
    LP-922761

    Others Neurological Disease
    LP-922761 is a potent, selective and orally active adapter protein-2 associated kinase 1 (AAK1) inhibitor with IC50s of 4.8 nM and 7.6 nM in enzyme and cell assays, respectively. LP-922761 also inhibits BMP-2-inducible protein kinase (BIKE) with an IC50 of 24 nM. LP-922761 exhibits no significant activity at cyclin G-associated kinase (GAK), opioid, adrenergic α2 or GABAa receptors.
  • HY-P1418
    DPC-AJ1951

    Thyroid Hormone Receptor Endocrinology
    DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
  • HY-P2319A
    OVA-E1 peptide TFA

    p38 MAPK JNK Inflammation/Immunology
    OVA-E1 peptide TFA, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes.
  • HY-112862
    Arg-AMS

    Aminoacyl-tRNA Synthetase Others
    Arg-AMS is a potent nanomolar inhibitor of arginyl tRNA synthetase, which displays tightly bound inhibitory characteristics for the A-domains in non-ribosomal peptide synthetases (NRPS) enzymes.
  • HY-120261
    GB-88

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    GB-88 is an oral, selective non-peptide antagonist of PAR2, inhibits PAR2 activated Ca 2+ release with an IC50 of 2 µM.
  • HY-100222
    CZ415

    mTOR Cancer
    CZ415 is a potent and highly selective mTOR inhibitor with a pIC50 of 8.07. CZ415 inhibits mTORC1 and mTORC2 protein complex.
  • HY-12622
    HSP70-IN-1

    HSP Cancer
    HSP70-IN-1 is a heat shock protein (HSP) inhibitor; inhibits the growth of Kasumi-1 cells with an IC50 of 2.3 μM.
  • HY-133246
    Monodes(N-carboxymethyl)valine Daclatasvir

    Daclatasvir Impurity A

    HCV Infection
    Monodes(N-carboxymethyl)valine Daclatasvir (Daclatasvir Impurity A) is the main degradation product of Daclatasvir. Daclatasvir is a potent HCV NS5A protein inhibitor.
  • HY-12479A
    Epetraborole hydrochloride

    GSK2251052 hydrochloride

    Bacterial Infection
    Epetraborole hydrochloride is a novel leucyl-tRNA synthetase (LeuRS) inhibitor, which inhibits protein synthesis by binding "to the terminal adenosine ribose (A76) of leucyl-tRNA synthetase".
  • HY-126146
    PKC-iota inhibitor 1

    PKC Cancer
    PKC-iota inhibitor 1 (compound 19) is a protein kinase C-iota (PKC-ι ℩) inhibitor with an IC50 value of 0.34 μM.
  • HY-111916
    BET-IN-4

    Epigenetic Reader Domain Cancer
    BET-IN-4 is a potent BET bromodomain protein (BRD4) inhibitor, with an IC50 of ≤ 1 μM.
  • HY-14775
    Nesbuvir

    HCV-796

    HCV Infection
    Nesbuvir is a nonnucleoside inhibitor of the hepatitis C virus (HCV) nonstructural protein 5B (NS5B) polymerase.
  • HY-114439
    MtbHU-IN-1

    Bacterial Infection
    MtbHU-IN-1 is an inhibitor of Mycobacterium tuberculosis nucleoid-associated protein HU (MtbHU), with a Kd of 98 nM for binding to WT MtbHU.
  • HY-B0974
    Methicillin sodium salt

    Meticillin sodium

    Bacterial Antibiotic Infection
    Methicillin sodium salt (Meticillin sodium) is a β-lactam antibiotic which acts by inhibiting penicillin-binding proteins that are involved in the synthesis of peptidoglycan.
  • HY-17412
    Minocycline hydrochloride

    Bacterial Antibiotic Infection
    Minocycline hydrochloride is a broad-spectrum tetracycline antibiotic, acting by binding to the bacterial 30S ribosomal subunit and inhibiting protein synthesis.
  • HY-100869A
    MM-589 TFA

    Histone Methyltransferase Cancer
    MM-589 TFA is a potent inhibitor of WD repeat domain 5 (WDR5) and mixed lineage leukemia (MLL) protein-protein interaction. MM-589 binds to WDR5 with an IC50 of 0.90 nM and inhibits the MLL H3K4 methyltransferase activity with an IC50 of 12.7 nM.
  • HY-112807
    SGLT inhibitor-1

    SGLT Metabolic Disease
    SGLT inhibitor-1 is a potent dual inhibitor of sodium glucose co-transporter proteins (SGLTs), inhibits hSGLT1 and hSGLT2 with IC50s of 43 nM and 9 nM, respectively.
  • HY-P0080
    Novokinin

    Angiotensin Receptor Metabolic Disease
    Novokinin is a peptide agonist of the angiotensin AT2 receptor.
  • HY-P1329A
    CTOP TFA

    Opioid Receptor Neurological Disease
    CTOP TFA is a peptide that acts as a μ-opioid receptor antagonist.
  • HY-P1522
    β-Amyloid (29-40)

    Amyloid beta-protein(29-40)

    Amyloid-β Neurological Disease
    β-Amyloid (29-40) is a fragment of Amyloid-β peptide.
  • HY-18370
    HIF-2α-IN-3

    HIF/HIF Prolyl-Hydroxylase Cancer
    HIF-2α-IN-3, an allosteric inhibitor of hypoxia inducible factor-2α (HIF-2α), exhibits an IC50 of 0.4 µM and a KD of 1.1 µM. Anticancer agent.
  • HY-P0289
    CEF3

    Influenza Virus Infection
    CEF3 (SIIPSGPLK) corresponds to aa 13-21 of the influenza A virus M1 protein. The matrix (M1) protein of influenza A virus is a multifunctional protein that plays essential structural and functional roles in the virus life cycle.
  • HY-P1418A
    DPC-AJ1951 TFA

    Thyroid Hormone Receptor Endocrinology
    DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR) , and characterized its activity in ex vivo and in vivo assays of bone resorption.
  • HY-P0139
    Gap 27

    Gap Junction Protein Cardiovascular Disease
    Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment.
  • HY-P1263
    tcY-NH2

    (trans-Cinnamoyl)-YPGKF-NH2

    Protease-Activated Receptor (PAR) Metabolic Disease
    tcY-NH2 is a selective rat PAR4 antagonist peptide. tcY-NH2 inhibits thrombin- and AY-NH2-induced rat platelet aggregation.
  • HY-P1850
    β-Amyloid (1-20)

    Amyloid-β Neurological Disease
    β-Amyloid (1-20) consists of amino acids 1 to 20 of beta amyloid protein.
  • HY-107643
    Reversan

    CBLC4H10

    P-glycoprotein Cancer
    Reversan (CBLC4H10) is a potent and nontoxic multidrug resistance-associated protein 1 (MRP1) and P-glycoprotein (Pgp) inhibitor.
  • HY-100737
    ML349

    Phospholipase Cancer
    ML349 is a potent and specific acyl protein thioesterase 2 (APT-2) inhibitor with a Ki of 120 nM. ML349 is also an inhibitor of LYPLA2 with an IC50 of 144 nM.
  • HY-50714
    Quiflapon sodium

    MK-591 sodium

    FLAP Apoptosis Inflammation/Immunology
    Quiflapon sodium (MK-591 sodium) is a selective and specific 5-Lipoxygenase-activating protein (FLAP) inhibitor. Quiflapon sodium is an orally active Leukotriene biosynthesis inhibitor. Induces apoptosis.
  • HY-13327
    Evacetrapib

    LY2484595

    CETP Cardiovascular Disease
    Evacetrapib is a potent and selective of CETP inhibitor, which inhibits human recombinant CETP protein (IC50 5.5 nM) and CETP activity in human plasma (IC50 36 nM) in vitro.
  • HY-111621
    DC661

    Autophagy Apoptosis Cancer
    DC661 is a potent palmitoyl-protein thioesterase 1 (PPT1) inhibitor, inhibits autophagy, and acts as an anti-lysosomal agent. Anti-cancer activity.
  • HY-117819
    TMP920

    ROR Inflammation/Immunology
    TMP920 is a highly potent and selective RORγt antagonist. TMP920 inhibits RORγt binding to the SRC1 peptide with an IC50 of 0.03 μM.
  • HY-128356
    SPL-410

    Others Inflammation/Immunology
    SPL-410 is an orally active, highly potent and selective hydroxyethylamine based SPPL2a (Signal Peptide Peptidase Like 2a) inhibitor, with an IC50 of 9 nM.
  • HY-P0122
    iRGD peptide

    c(CRGDKGPDC)

    Integrin Cancer
    iRGD peptide is a 9-amino acid cyclic peptide, triggers tissue penetration of drugs by first binding to av integrins, then proteolytically cleaved in the tumor to produce CRGDK/R to interact with neuropilin-1, and has tumor-targeting and tumor-penetrating properties.
  • HY-B0027
    Valnemulin Hydrochloride

    Bacterial Antibiotic Others
    Valnemulin hydrochloride is a pleuromutilin antibiotic which inhibits protein synthesis in bacteria by binding the peptidyl transferase enzyme in the 50s ribosomal subunit.
  • HY-13867
    Bisindolylmaleimide I

    GF109203X; Go 6850

    PKC Metabolic Disease Cancer
    Bisindolylmaleimide I (GF109203X) is a highly selective, cell-permeable, and reversible protein kinase C (PKC) inhibitor with a Ki of 14 nM.
  • HY-101770
    BTB-1

    Microtubule/Tubulin Cancer
    BTB-1 is a potent, selective and reversible mitotic motor protein Kif18A inhibitor with an IC50 of 1.69 μM.
  • HY-13949
    SRPIN340

    SRPK inhibitor

    SRPK Virus Protease Cancer
    SRPIN340 is an ATP-competitive serine-arginine-rich protein kinase (SRPK) inhibitor, with a Ki of 0.89 μM for SRPK1.
  • HY-13992
    AP20187

    B/B Homodimerizer

    FKBP Metabolic Disease
    AP20187 (B/B Homodimerizer) is a cell-permeable ligand used to dimerize FK506-binding protein (FKBP) fusion proteins and initiate biological signaling cascades and gene expression or disrupt protein-protein interactions.
  • HY-N0242
    Fraxinellone

    PD-1/PD-L1 HIF/HIF Prolyl-Hydroxylase STAT Cancer Inflammation/Immunology
    Fraxinellone is isolated from the root bark of the Rutaceae plant, Dictamnus dasycarpus. Fraxinellone is a PD-L1 inhibitor and inhibits HIF-1α protein synthesis without affecting HIF-1α protein degradation. Fraxinellone has the potential to be a valuable candidate for cancer treatment by targeting PD-L1.
  • HY-134517
    Fmoc-HoCys(ACM)-OH

    Others Others
    Fmoc-HoCys(ACM)-OH, a homolog of cysteine, is synthesized from L-methionine. Fmoc-HoCys(ACM)-OH also can be used for the synthesis of solid phase peptide.
  • HY-112210
    Shield-1

    FKBP Others
    Shield-1 is a specific, cell-permeant and high-affinity ligand of FK506-binding protein-12 (FKBP), and reverses the instability by binding to mutated FKBP (mtFKBP), allowing conditional expression of mtFKBP-fused proteins. Shield-1 can stabilize the entire fusion protein.
  • HY-P2247
    JTP10-△-R9 TFA

    JNK Cancer
    JTP10-△-R9 TFA is a selective JNK2 peptide inhibitor, with an IC50 of 89 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3.
  • HY-P0080A
    Novokinin TFA

    Angiotensin Receptor Metabolic Disease
    Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor.
  • HY-P0261
    Indolicidin

    Bacterial Infection
    Indolicidin is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
  • HY-P1880
    β-Amyloid (12-20)

    Amyloid-β Neurological Disease
    β-Amyloid (12-20) is a peptide fragment of β-Amyloid.
  • HY-P0241
    Neuromedin B

    Endogenous Metabolite Neurological Disease
    Neuromedin B (NMB) is a member of Bombesin (BN)-like peptide family in mammals.
  • HY-P1891
    β-Amyloid (22-40)

    Amyloid-β Neurological Disease
    β-Amyloid (22-40) is a peptide fragment of β-Amyloid.
  • HY-P1595
    CREBtide

    PKA Metabolic Disease
    CREBtide, a synthetic 13 amino acid peptide, has been reported as a PKA substrate.
  • HY-P1879
    β-Amyloid (18-28)

    Amyloid-β Neurological Disease
    β-Amyloid (18-28) is a peptide fragment of β-Amyloid.
  • HY-P1255
    Kinetensin

    Kinetensin (human)

    Neurotensin Receptor Neurological Disease Endocrinology
    Kinetensin is a neurotensin-like peptide isolated from pepsin-treated human plasma.
  • HY-P1893
    β-Amyloid (11-22)

    Amyloid-β Neurological Disease
    β-Amyloid (11-22) is a peptide fragment of β-Amyloid.
  • HY-10087
    Navitoclax

    ABT-263

    Bcl-2 Family Cancer
    Navitoclax (ABT-263) is a potent and orally active Bcl-2 family protein inhibitor that binds to multiple anti-apoptotic Bcl-2 family proteins, such as Bcl-xL, Bcl-2 and Bcl-w, with a Ki of less than 1 nM.
  • HY-P2281
    Atrial natriuretic factor (1-28) (human, porcine)

    Atrial natriuretic peptide (1-28)

    Endogenous Metabolite
    Atrial natriuretic factor (1-28) (human, porcine) (Atrial natriuretic peptide (1-28)) is an endogenous peptide produced by the heart, involved in blood pressure regulation. Atrial natriuretic factor (1-28) (human, porcine) produces natriuresis, diuresis and vasorelaxation in vivo.
  • HY-124718
    p32 Inhibitor M36

    M36

    PKC Cancer
    p32 inhibitor M36 (M36) is a p32 mitochondrial protein inhibitor, which binds directly to p32 and inhibits p32 association with LyP-1.
  • HY-133125
    ERAP1-IN-1

    Others Inflammation/Immunology
    ERAP1-IN-1 is an endoplasmic reticulum aminopeptidase 1 (ERAP1) inhibitor. ERAP1-IN-1 competitively inhibits ERAP1 activity towards a nonamer peptide representative of physiological substrates.
  • HY-P1000
    Sfllrnpndkyepf

    Thrombin Cardiovascular Disease
    Sfllrnpndkyepf is a synthetic thrombin receptor agonist peptide.
  • HY-U00327
    Prenyl-IN-1

    Farnesyl Transferase Neurological Disease
    Prenyl-IN-1 is a protein prenylation inhibitor, especially a geranylgeranyltransferase (GGT) or a farnesyltransferase (FT) inhibitor, exhibiting potent activity against oxidative stress, and particularly in the treatment of Parkinson's Disease.
  • HY-16663
    ITX3

    Others Others
    ITX3 is a specific and nontoxic inhibitor of the TrioN (N-terminal GEF domain of the multidomain Trio protein) with IC50 of 76 uM; inhibits TrioN-stimulated RhoG exchange in vitro.
  • HY-114118
    Semaglutide

    Glucagon Receptor Metabolic Disease
    Semaglutide, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide has the potential for type 2 diabetes treatment.
  • HY-119424
    SP4206

    Interleukin Related Inflammation/Immunology
    SP4206 is an IL-2/IL-2Rα interaction inhibitor. SP4206 binds with high affinity (Kd=70 nM) to IL-2 and blocks binding to its natural receptor IL-2Rα (Kd=10 nM).
  • HY-100529
    PD150606

    Proteasome Cancer
    PD 150606 is a selective, cell-permeable non-peptide calpain inhibitor with Ki values of 0.21 μM and 0.37 μM for μ- and m-calpains respectively, which is neuroprotective.
  • HY-P1453A
    CMD178 TFA

    STAT Inflammation/Immunology
    CMD178 (TFA) is a lead peptide that consistently reduces the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling. CMD178 (TFA) also is an inhibitor of STAT5 and inhibits Tregcells development.
  • HY-P1346
    APETx2

    Sodium Channel Inflammation/Immunology Neurological Disease
    APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.
  • HY-N0774
    Isofraxidin

    COX MMP Toll-like Receptor (TLR) Inflammation/Immunology
    Isofraxidin, a coumarin component from Acanthopanax senticosus, inhibits MMP-7 expression and cell invasion of human hepatoma cells. Isofraxidin inhibits the phosphorylation of ERK1/2 in hepatoma cells. Isofraxidin attenuates the expression of iNOS and COX-2, Isofraxidinalso inhibits TLR4/myeloid differentiation protein-2 (MD-2) complex formation.
  • HY-100235
    GSK591

    EPZ015866; GSK3203591

    Histone Methyltransferase Cancer
    GSK591 (EPZ015866) is a potent and selective inhibitor of protein methyltransferase 5 (PRMT5) with an IC50 of 4 nM.
  • HY-100390
    (S)-ML753286

    BCRP Cancer
    (S)-ML753286 is a breast cancer resistance protein (BCRP) inhibitor with an IC50 of 0.6 μM on BCRP efflux transporter.
  • HY-N0083
    Betulin

    Trochol

    Fatty Acid Synthase (FASN) Apoptosis Endogenous Metabolite Cancer
    Betulin (Trochol), is a sterol regulatory element-binding protein (SREBP) inhibitor with an IC50 of 14.5 μM in K562 cell line.
  • HY-14667
    Lomitapide

    AEGR-733; BMS-201038

    Others Cardiovascular Disease
    Lomitapide (AEGR-733; BMS-201038) is a potent inhibitor of microsomal triglyceride-transfer protein (MTP) with an IC50 of 8 nM in vitro.
  • HY-U00460
    3,6-DMAD hydrochloride

    IRE1 Cancer
    3,6-DMAD hydrochloride is a inhibitor of the IRE1α-XBP1 pathway of the unfolded protein response.
  • HY-N2506
    Ginsenoside Ra1

    Others Cardiovascular Disease
    Ginsenoside Ra1 is a component from ginseng, inhibits protein tyrosine kinase (PTK) activation induced by hypoxia/reoxygenation.
  • HY-133083
    BAY-474

    c-Met/HGFR Cancer
    BAY-474 is a tyrosine-protein kinase c-Met inhibitor. BAY-474 acts as an epigenetics probe.
  • HY-16927
    CK-869

    Arp2/3 Complex Cancer
    CK-869 is an Actin-Related Protein 2/3 (ARP2/3) complex inhibitor, with an IC50 of 7 μM.
  • HY-U00070
    Dirlotapide

    CP742033; Slentrol

    Others Metabolic Disease
    Dirlotapide (CP742033) is a gut-selective inhibitor of microsomal triglyceride transfer protein (MTP) that reliably produces weight loss in obese dogs.
  • HY-115496
    7-BIA

    Phosphatase Neurological Disease
    7-BIA is a receptor-type protein tyrosine phosphatase D (PTPRD) inhibitor with an IC50 of ~1-3 μM.
  • HY-P1382
    Rac1 Inhibitor W56

    Ras Cancer
    Rac1 Inhibitor W56 is a peptide comprising residues 45-60 of the guanine nucleotide exchange factor (GEF) recognition/activation site of Rac1. Rac1 Inhibitor W56 selectively inhibits Rac1 interaction with Rac1-specific GEFs TrioN, GEF-H1 and Tiam1.
  • HY-P1263A
    tcY-NH2 TFA

    (trans-Cinnamoyl)-YPGKF-NH2 TFA

    Protease-Activated Receptor (PAR) Metabolic Disease
    tcY-NH2 TFA is a selective rat PAR4 antagonist peptide. tcY-NH2 TFA inhibits thrombin- and AY-NH2-induced rat platelet aggregation.
  • HY-P2548
    pp60 (v-SRC) Autophosphorylation Site, Phosphorylated

    EGFR Others
    pp60 (v-SRC) Autophosphorylation Site, Phosphorylated is the phosphorylated peptide of an EGFR substrate. pp60 (v-SRC) Autophosphorylation Site, Phosphorylated can be used for the screening of EGFR Kinase inhibitors via phosphorylated-substrate quantification.
  • HY-19805
    STO-609

    CaMK AMPK Autophagy Metabolic Disease
    STO-609 is a selective and cell-permeable inhibitor of the Ca 2+/calmodulin-dependent protein kinase kinase (CaM-KK), with Ki values of 80 and 15 ng/mL for recombinant CaM-KKα and CaM-KKβ, respectively. STO-609 inhibits AMP-activated protein kinase kinase (AMPKK) activity in HeLa cell lysates with an IC50 ~0.02 g/ml.
  • HY-131132
    SHP2-IN-6

    Phosphatase Cancer
    SHP2-IN-6 is a potent SHP2 inhibitor, extracted from patent WO2017211303A1, compound 7, has an IC50 of 25.8 nM.
  • HY-19574
    FPR Agonist 43

    Others Inflammation/Immunology
    FPR Agonist 43 (compound 43) is a dual formyl peptide receptor 1 (FPR1) and formyl peptide receptor 2 (FPR2)/ALX agonist.
  • HY-120859A
    Zidebactam sodium salt

    WCK-5107 sodium salt

    Bacterial Infection
    Zidebactam sodium salt (WCK-5107 sodium salt) is a potent β-lactamase inhibitor. Zidebactam also is a penicillin-binding protein2 (PBP2) inhibitor with an IC50 of 0.26 μg/mL.
  • HY-120859
    Zidebactam

    WCK-5107

    Bacterial Infection
    Zidebactam (WCK-5107) is a potent β-lactamase inhibitor. Zidebactam also is a penicillin-binding protein2 (PBP2) inhibitor with an IC50 of 0.26 μg/mL.
  • HY-P0137
    CEF1, Influenza Matrix Protein M1 (58-66)

    Influenza Virus Infection
    CEF1, Influenza Matrix Protein M1 (58-66) is an epitope derived from the matrix protein of the influenza A virus.
  • HY-127002A
    Squarunkin A hydrochloride

    Src Cancer
    Squarunkin A hydrochloride is a potent and selective UNC119-cargo interaction inhibitor (IC50 of 10 nM for inhibiting the UNC119A-myristoylated Src N-terminal peptide interaction). Squarunkin A hydrochloride interferes with the activation of Src kinase in cells.
  • HY-P1224
    HAEGTFTSDVS

    Glucagon Receptor Metabolic Disease
    HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.
  • HY-P1601
    Neuropeptide Y(29-64)

    Neuropeptide Y Receptor Neurological Disease Endocrinology
    Neuropeptide Y(29-64) is a 36 amino acid peptide, a fragment of Neuropeptide Y.
  • HY-P1228
    HAEGTFT

    Glucagon Receptor Metabolic Disease
    HAEGTFT is the first N-terminal 1-7 residues of GLP-1 peptide.
  • HY-P1223
    Exendin-3/4 (59-86)

    Glucagon Receptor Metabolic Disease
    Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
  • HY-P0092
    Cecropin B

    Cytochrome P450 Bacterial Antibiotic Cancer Infection
    Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
  • HY-114166
    2-D08

    E1/E2/E3 Enzyme TAM Receptor Cancer
    2-D08 is a cell permeable, mechanistically unique inhibitor of protein SUMOylation. 2-D08 also inhibits Axl with an IC50 of 0.49 nM.
  • HY-50908
    Ridaforolimus

    MK-8669; Deforolimus; AP23573

    mTOR Autophagy Cancer
    Ridaforolimus (MK-8669) is a potent and selective mTOR inhibitor; inhibits ribosomal protein S6 phosphorylation with an IC50 of 0.2 nM in HT-1080 cells.
  • HY-131132A
    SHP2-IN-6 hydrochloride

    Phosphatase Cancer
    SHP2-IN-6 hydrochloride is a potent SHP2 inhibitor with an IC50 of 25.8 nM. SHP2-IN-6 hydrochloride is extracted from patent WO2017211303A1, compound 7.
  • HY-120217
    VH032

    Ligand for E3 Ligase Cancer
    VH032 is a VHL ligand used in the recruitment of the von Hippel-Lindau (VHL) protein. VH032 is a VHL/HIF-1α interaction inhibitor with a Kdprotein by a linker to form PROTACs.
  • HY-15317
    RI-1

    RAD51 Cancer
    RI-1 is a RAD51 inhibitor, with IC50s ranging from 5 to 30 μM. RI-1 binds covalently to the surface of RAD51 protein at cysteine 319. RI-1 inactivates RAD51 by directly binding to a protein surface that serves as an interface between protein subunits in RAD51 filaments. RI-1 can disrupt homologous recombination in human cells.
  • HY-19593
    Nikkomycin Z

    Fungal Antibiotic Infection
    Nikkomycin Z, a nucleoside-peptide, is a selective competitive chitin synthesis inhibitor. Nikkomycin Z has antifungal effects and acts as a competitive analogue of the chitin synthase substrate UDP-N-acetylglucosamine.
  • HY-12801
    DiZPK

    Others Others
    DiZPK is a photocrosslinker for identifying direct protein-protein interactions in living prokaryotic and eukaryotic cells.
  • HY-I1112
    Fmoc-N-Me-Val-OH

    Others Others
    Fmoc-N-Me-Val-OH is a modified peptide.
  • HY-P2278
    PEN (human)

    Others
    PEN (human) is an endogenous peptide GPR83 agonist.
  • HY-124761
    Poloppin

    Polo-like Kinase (PLK) Autophagy Cancer
    Poloppin is a potent, cell penetrant inhibitor of the mitotic Polo-like kinase (PLK) (IC50=26.9 μM) and prevents the protein-protein interaction via the Polo-box domain (PBD) (Kd= 29.5 μM). Poloppin selectively kills cells expressing mutant KRAS, enhancing death in mitosis. Poloppin is used for the study of KRAS-mutant cancers as single agents, or in combination with c-MET inhibitors.
  • HY-114118A
    Semaglutide TFA

    Glucagon Receptor Metabolic Disease
    Semaglutide TFA, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide TFA has the potential for type 2 diabetes treatment.
  • HY-103546
    BETP

    Glucagon Receptor Metabolic Disease
    BETP is an agonist of glucagon-like peptide-1 (GLP-1) receptor, with EC50s of 0.66 and 0.755 μM for human and rat GLP-1 receptor, respectively.
  • HY-P2478
    Human PD-L1 inhibitor V

    PD-1/PD-L1 Inflammation/Immunology
    Human PD-L1 inhibitor V, a polypeptide, is a competitive human PD-1 protein inhibitor with a Kd value of 3.32 μM. Human PD-L1 inhibitor V inhibit the interaction of hPD-1/hPD-L1.
  • HY-P2477
    Human PD-L1 inhibitor IV

    PD-1/PD-L1 Inflammation/Immunology
    Human PD-L1 inhibitor IV, a polypeptide, is a competitive human PD-1 protein inhibitor with a Kd value of 1.38 μM. Human PD-L1 inhibitor IV inhibits the interaction of hPD-1/hPD-L1.
  • HY-15873
    FTI 276

    Farnesyl Transferase Cancer
    FTI-276 is a protein farnesyl transferase (PFT) inhibitor with IC50s of 0.9 and 0.5 nM for Plasmodium falciparum and human.
  • HY-15979A
    H-89 dihydrochloride

    PKA Autophagy Others
    H-89 dihydrochloride is a potent and selective inhibitor of protein kinase A (PKA) with an IC50 of 48 nM and has weak inhibition on PKG, PKC, Casein Kinase.
  • HY-N0862
    Harringtonine

    Influenza Virus Cancer Infection
    Harringtonine is a natural Cephalotaxus alkaloid that inhibits protein synthesis. Harringtonine has anti-chikungunya virus (CHIKV) activities with an EC50 of 0.24 μM.
  • HY-108330
    AG126

    Tyrphostin AG126

    ERK Inflammation/Immunology
    AG126 is a tyrosine kinase inhibitor which can prevent the activation of mitogen-activated protein kinase p42MAPK (ERK2).
  • HY-122913
    Borussertib

    Akt Cancer
    Borussertib is a covalent-allosteric and first-in-class inhibitor of protein kinase Akt, with an IC50 of 0.8 nM and a Ki of 2.2 nM for Akt wt.
  • HY-12241
    AZ82

    Kinesin Cancer
    AZ82 is a selective kinesin-like protein KIFC1 (HSET/KIFC1) inhibitor, with a Ki of 43 nM and an IC50 of 300 nM for KIFC1.
  • HY-112150
    ZL0454

    Epigenetic Reader Domain Inflammation/Immunology
    ZL0454 is a potent and selective Bromodomain-containing protein 4 (BRD4) inhibitor with an IC50 of 49 and 32 nM for BD1 and BD2.
  • HY-16586
    PFI-1

    Epigenetic Reader Domain Autophagy Apoptosis Cancer
    PFI-1 is a selective BET (bromodomain-containing protein) inhibitor for BRD4 with IC50 of 0.22 μM in a cell-free assay.
  • HY-119254
    BAY-850

    Others Metabolic Disease
    BAY-850 is a potent and isoform selective ATPase family AAA domain-containing protein 2 (ATAD2) inhibitor, with an IC50 of 166 nM.
  • HY-14668
    Lomitapide mesylate

    AEGR-733 mesylate; BMS-201038 mesylate

    Others Cardiovascular Disease
    Lomitapide mesylate(AEGR-733; BMS-201038) is an inhibitor of microsomal triglyceride-transfer protein (MTP) wtih in vitro IC50 of 8 nM.
  • HY-N6789
    KT5720

    PKA Bacterial Antibiotic Infection Endocrinology Metabolic Disease
    KT5720 is a cell-permeable, potent, specific, reversible, ATP-competitive inhibitor of protein kinase A (PKA), with a Ki of 60 nM.
  • HY-13820
    GSK2656157

    PERK Autophagy Apoptosis Cancer
    GSK2656157 is a selective and ATP-competitive inhibitor of protein kinase R (PKR)-like endoplasmic reticulum kinase (PERK) with an IC50 of 0.9 nM.
  • HY-B1425
    Ethoxyquin

    HSP Reactive Oxygen Species Cancer
    Ethoxyquin is an antioxidant which has been used in animal feed for many years and also an inhibitor of heat shock protein 90 (Hsp90).
  • HY-15096
    MKT-077

    FJ-776

    HSP Cancer
    MKT-077 is a rhodacyanine dye and also a heat shock protein 70 (Hsp70) inhibitor which exhibits significant antitumor activity.
  • HY-111557
    YM-254890

    P2Y Receptor Cardiovascular Disease
    YM-254890 is a selective Gαq/11 protein inhibitor isolated from Chromobacterium sp. YM-254890 shows no inhibition of other G protein subtypes. YM-254890 inhibits platelet aggregation induced by ADP by blocking the P2Y1 signal transduction pathway, with an IC50 value below 0.6 μM.
  • HY-136219
    Protein kinase affinity probe 1

    Others Others
    Protein kinase affinity probe 1 is a novel protein kinase affinity probe for the functional identification of protein kinases (PKs). Protein kinase affinity probe 1 is a modified Purvalanol B (HY-18299) probe with 50% beads loading (Compound S3).
  • HY-134809
    Cyclotriazadisulfonamide

    CADA

    HIV Infection Inflammation/Immunology
    Cyclotriazadisulfonamide (CADA) is a specific CD4-targeted HIV entry inhibitors. Cyclotriazadisulfonamide (CADA) inhibits the co-translational translocation of human CD4 (huCD4) into the ER lumen in a signal peptide (SP)-dependent way.
  • HY-12220
    MM-102

    HMTase Inhibitor IX

    Histone Methyltransferase Cancer
    MM-102 (HMTase Inhibitor IX) is a potent WDR5/MLL interaction inhibitor, achieves IC50= 2.4 nM with an estimated Ki< 1 nM in WDR5 binding assay, which is >200 times more potent than the ARA peptide.
  • HY-100374
    Val-Cit-PAB-MMAE

    Drug-Linker Conjugates for ADC Cancer
    Val-Cit-PAB-MMAE is a drug-linker conjugate for ADC. Val-Cit-PAB-MMAE contains the ADCs linker (peptide Val-Cit-PAB) and a potent tubulin inhibitor MMAE (HY-15162). MMAE a potent mitotic inhibitor by inhibiting tubulin polymerization.
  • HY-109142
    Ziresovir

    AK0529; RO-0529

    RSV Infection
    Ziresovir (AK0529;RO-0529) is a potent, selective, and orally bioavailable respiratory syncytial virus (RSV) fusion (F) protein (RSV F) protein inhibitor. Ziresovir shows anti-RSV activity (EC50=3 nM) and highlights pharmacokinetics in animal species.
  • HY-19779
    JTT 551

    Phosphatase Metabolic Disease
    JTT 551 is selective a protein tyrosine phosphatase 1B (PTP1B) inhibitor, with Kis of 0.22 μM and 9.3 μM for PTP1B and TCPTP (T-cell protein tyrosine phosphatase), respectively; JTT 551 can be used in the research of type 2 diabetes mellitus.
  • HY-129172
    PD-1/PD-L1-IN 5 TFA

    PD-1/PD-L1 Cancer Infection Inflammation/Immunology
    PD-1/PD-L1-IN 5 TFA is a PD-1/PD-L1 protein/protein interaction inhibitor extracted from patent WO2017222976A1, compound Example 1, has an IC50 of ≤100 nM.
  • HY-P1250
    RFRP-3(human)

    Neuropeptide VF(124-131)(human)

    Neuropeptide Y Receptor Neurological Disease
    RFRP-3 (Neuropeptide VF(124-131))(human), a human GnIH peptide homolog, is a potent inhibitor of gonadotropin secretion by inhibiting Ca 2+ mobilization. RFRP-3(human) is a NPFF1 receptor agonist, it inhibits forskolin-induced production of cAMP with an IC50 of 0.7 nM.
  • HY-P1382A
    Rac1 Inhibitor W56 TFA

    Ras Cancer
    Rac1 Inhibitor W56 TFA is a peptide comprising residues 45-60 of the guanine nucleotide exchange factor (GEF) recognition/activation site of Rac1. Rac1 Inhibitor W56 TFA selectively inhibits Rac1 interaction with Rac1-specific GEFs TrioN, GEF-H1 and Tiam1.
  • HY-116078
    CKD-519

    CETP Cardiovascular Disease
    CKD-519 is a selective and potent cholesteryl ester transfer protein (CETP) inhibitor, which inhibits CETP-mediated transfer of cholesteryl ester in human serum with an IC50 of 2.3 nM.
  • HY-100625
    BVT948

    Phosphatase Cytochrome P450 Histone Methyltransferase Cancer
    BVT948 is a protein tyrosine phosphatase (PTP) inhibitor which can also inhibit several cytochrome P450 (P450) isoforms and lysine methyltransferase SETD8 (KMT5A).
  • HY-133953
    9-Oxoheptadecanedioic acid

    Others Others
    9-Oxoheptadecanedioic acid (compound 46) is a precursor of Civetone used for labeling proteins.
  • HY-P1331
    BAM-22P

    Bovine adrenal medulla-22P

    Opioid Receptor Neurological Disease
    BAM-22P, a highly potent opioid peptide, is a potent opioid agonist.
  • HY-P1560
    Allergen Gal d 4 (46-61), chicken

    Lysozyme C (46-61) (chicken)

    Bacterial Infection
    Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
  • HY-P0311
    LAH4

    Bacterial Infection
    LAH4 is an antimicrobial peptide that strongly interacts with phospholipid membranes, exhibiting in vitro transfection efficiency.
  • HY-137179
    Glyco-diosgenin

    Others Others
    Glyco-diosgenin is a synthetic surfactant and detergent for extracting proteins from membranes for structure and function studies, and single-particle cryo-electron microscopy (cryoEM) studies of membrane proteins.
  • HY-P1214
    γ1-MSH

    Melanocortin Receptor Cardiovascular Disease
    γ1-MSH is a melanocortin MC3 receptor agonist, with a Ki of 34 nM for the rat MC3 receptor. γ1-MSH displays ~40-fold selectivity over MC4 (Ki=1318 nM).
  • HY-P1341
    OXA(17-33)

    Orexin Receptor (OX Receptor) Neurological Disease
    OXA(17-33) is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM).
  • HY-P1341A
    OXA(17-33) TFA

    Orexin Receptor (OX Receptor) Neurological Disease
    OXA(17-33) TFA is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) TFA shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM).
  • HY-P1214A
    γ1-MSH TFA

    Melanocortin Receptor Cardiovascular Disease
    γ1-MSH TFA is a melanocortin MC3 receptor agonist, with a Ki of 34 nM for the rat MC3 receptor. γ1-MSH TFA displays ~40-fold selectivity over MC4 (Ki=1318 nM).
  • HY-P0078
    TRAP-6

    PAR-1 agonist peptide; Thrombin Receptor Activator Peptide 6

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    TRAP-6 (PAR-1 agonist peptide), a peptide fragment, is a selective protease activating receptor 1 (PAR1) agonist. TRAP-6 activates human platelets via the thrombin receptor. TRAP-6 shows no activity at PAR4.
  • HY-112610
    CF53

    Epigenetic Reader Domain Histone Acetyltransferase Cancer
    CF53 is a highly potent, selective and orally active inhibitor of BET protein, with a Ki of <1 nM, Kd of 2.2 nM and an IC50 of 2 nM for BRD4 BD1. CF53 binds to both the BD1 and BD2 domains of BRD2, BRD3, BRD4, and BRDT BET proteins with high affinities, very selective over non-BET bromodomain-containing proteins. CF53 shows potent anti-tumor activity both in vitro and in vivo.
  • HY-N0005
    Curcumin

    Diferuloylmethane; Natural Yellow 3; Turmeric yellow

    Histone Acetyltransferase Epigenetic Reader Domain Keap1-Nrf2 Autophagy Mitophagy Influenza Virus Ferroptosis Cancer
    Curcumin (Diferuloylmethane), a natural phenolic compound, is a p300/CREB-binding protein-specific inhibitor of acetyltransferase, represses the acetylation of histone/nonhistone proteins and histone acetyltransferase-dependent chromatin transcription. Curcumin shows inhibitory effects on NF-κB and MAPKs, and has diverse pharmacologic effects including anti-inflammatory, antioxidant, antiproliferative and antiangiogenic activities. Curcumin induces stabilization of Nrf2 protein through Keap1 cysteine modification.
  • HY-P1597
    Malantide

    PKA PKC Cancer
    Malantide is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts. Malantide is also an efficient substrate for PKC with a Km of 16 μM.
  • HY-117626
    LP-935509

    Others Inflammation/Immunology Neurological Disease
    LP-935509 is a selective, ATP-competitive and brain-penetrant inhibitor of adapter protein-2 associated kinase 1 (AAK1) with an IC50 and a Ki of 3.3 nM and 0.9 nM, respectively. LP-935509 is also a potent inhibitor of BIKE (IC50=14 nM) and a modest inhibitor of GAK (IC50=320 nM). LP-935509 is highly brain-penetrant and reverses fully established pain behavior following the SNL procedure.
  • HY-N6796
    Manumycin A

    Farnesyl Transferase Ras Apoptosis Phospholipase Cancer Infection
    Manumycin A is an antibiotic. Manumycin A acts as a selective, competitive inhibitor of protein farnesyltransferase (FTase) with respect to farnesylpyrophosphate (Ki =1.2 μM), and as a noncompetitive inhibitor with respect to the Ras protein. Manumycin A induces apoptosis and exerts antitumor activity . Manumycin A suppresses exosome biogenesis and secretion via targeted inhibition of Ras/Raf/ERK1/2 signaling. Manumycin A is a nSMase inhibitor (EC50=0.25 μM).
  • HY-107096
    CH-0793076

    TP3076

    Topoisomerase Cancer
    CH-0793076 (TP3076), a hexacyclic camptothecin analog, is active drug and major metabolite of TP300. CH-0793076 inhibits DNA topoisomerase I with an IC50 of 2.3 μM. CH-0793076 is efficacious against cells expressing BCRP (breast cancer resistance protein).
  • HY-P1013
    Deltorphin 2

    [D-Ala2]-Deltorphin II

    Opioid Receptor Neurological Disease
    Deltorphin 2 is a selective peptide agonist for the δ opioid receptor.
  • HY-P1226
    HAEGTFTSD

    Glucagon Receptor Metabolic Disease
    HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner
  • HY-18986
    SAR405838

    MI-77301

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    SAR405838 is a highly potent and selective MDM2 inhibitor, binds to MDM2 with Ki= 0.88 nM and has high specificity over other proteins.
  • HY-18564
    HCV-IN-3

    HCV Infection
    HCV-IN-3 is a hepatitis C virus (HCV) NS3/4a protein inhibitor, with an IC50 of 20 μM, a Kd of 29 μM.
  • HY-112654
    GCN2iB

    Eukaryotic Initiation Factor (eIF) Autophagy Cancer
    GCN2iB is an ATP-competitive inhibitor of a serine/threonine-protein kinase general control nonderepressible 2 (GCN2), with an IC50 of 2.4 nM.
  • HY-117286
    (S)-JQ-35

    TEN-010

    Epigenetic Reader Domain Cancer
    (S)-JQ-35 (TEN-010) is an inhibitor of the Bromodomain and Extra-Terminal (BET) family bromodomain-containing proteins with potential antineoplastic activity.
  • HY-136434
    m-Chloramphenicol

    m-threo-Chloramphenicol

    Others Others
    m-Chloramphenicol (m-threo-Chloramphenicol) is an impurity of Chloramphenicol. Chloramphenicol, a broad-spectrum antibiotic, acts as a potent inhibitor of bacterial protein biosynthesis.
  • HY-18072
    GSK2606414

    PERK Autophagy Apoptosis Cancer
    GSK2606414 is a cell-permeable and orally available protein kinase R-like endoplasmic reticulum (ER) kinase (PERK) inhibitor with an IC50 of 0.4 nM.
  • HY-135301
    Flavanone hydrazone

    Others Inflammation/Immunology
    Flavanone hydrazine is a potent non-steroidal anti-inflammatory agent. Flavanone hydrazine effectively inhibits lens protein-induced ocular inflammation.
  • HY-112782
    VTX-27

    PKC Inflammation/Immunology
    VTX-27 is a selective protein kinase C θ (PKC θ) inhibitor, with Kis of 0.08 nM and 16 nM for PKC θ and PKC δ.
  • HY-101524
    TC13172

    Mixed Lineage Kinase Cancer
    TC13172 is a mixed lineage kinase domain-like protein (MLKL) inhibitor with an EC50 value of 2 nM for HT-29 cells.
  • HY-138202
    Lck-IN-1

    Src Inflammation/Immunology
    Lck-IN-1 is a potent lymphocyte protein tyrosine kinase (Lck) inhibitor extracted from patent WO2007013673A1, example 48.
  • HY-15205
    Ganetespib

    STA-9090

    HSP Apoptosis Cancer
    Ganetespib is a heat shock protein 90 (HSP90) inhibitor which exhibits potent cytotoxicity in a wide variety of hematological and solid tumor cell lines.
  • HY-12588
    Thiamet G

    Autophagy Cancer
    Thiamet G is a potent and selective inhibitor of O-GlcNAcase (OGA), which acts to remove O-GlcNAc from modified proteins, with Ki of 20 nM for human OGA.
  • HY-100462
    PTP1B-IN-2

    Phosphatase Metabolic Disease
    PTP1B-IN-2 is a potent protein tyrosine phosphatase 1B (PTP1B) inhibitor with an IC50 of 50 nM.
  • HY-10095A
    Olcegepant hydrochloride

    BIBN-4096 hydrochloride; BIBN4096BS hydrochloride

    CGRP Receptor Neurological Disease
    Olcegepant hydrochloride (BIBN-4096 hydrochloride) is a potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and with a Ki of 14.4 pM for human CGRP.
  • HY-10095
    Olcegepant

    BIBN-4096; BIBN 4096BS

    CGRP Receptor Neurological Disease
    Olcegepant (BIBN-4096) is a potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and Ki of 14.4 pM for human CGRP.
  • HY-N0630
    Shanzhiside methyl ester

    Glucagon Receptor Neurological Disease
    Shanzhiside methy lester is isolated from L. rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance.
  • HY-N2065
    Withaferin A

    NF-κB Ferroptosis Cancer Inflammation/Immunology
    Withaferin A is a steroidal lactone isolated from Withania somnifera, inhibits NF-kB activation and targets vimentin, with potent antiinflammatory and anticancer activities. Withaferin A is an inhibitor of endothelial protein C receptor (EPCR) shedding.
  • HY-19530
    PF-2771

    Kinesin Cancer
    PF-2771 is a potent and selective centromere protein E (CENP-E) inhibitor, inhibiting CENP-E motor activity with an IC50 of 16.1 nM; PF-2771 is used as an anticancer agent.
  • HY-103097
    ST271

    Phospholipase Others
    ST271 is a potent inhibitor of protein tyrosine kinase (PTK), inhibits phospholipase D activation stimulated by fMet-Leu-Phe and PAF, with IC50s of 6.7 and 9 μM, respectively.
  • HY-P1250A
    RFRP-3(human) TFA

    Neuropeptide VF(124-131)(human) TFA

    Neuropeptide Y Receptor Neurological Disease
    RFRP-3 (Neuropeptide VF(124-131))(human) TFA, a human GnIH peptide homolog, is a potent inhibitor of gonadotropin secretion by inhibiting Ca 2+ mobilization. RFRP-3(human) is a NPFF1 receptor agonist, it inhibits forskolin-induced production of cAMP with an IC50 of 0.7 nM.
  • HY-N2098
    Obtusifolin

    NF-κB Cancer
    Obtusifolin, isolated from the seeds of Cassia obtusifolia, regulates the gene expression and production of MUC5AC mucin in airway epithelial cells via inhibiting NF-kB pathway. Obtusifolin suppresses phthalate esters-induced breast cancer bone metastasis by targeting parathyroid hormone-related protein.
  • HY-130613
    MAC-545496

    Bacterial Infection
    MAC-545496 is a nanomolar inhibitor of glycopeptide-resistance-associated protein R (GraR). MAC-545496 displays strong binding affinity to the full-length GraR protein (Kd ≤ 0.1 nM). MAC-545496 is an antivirulence agent that reverses β-lactam resistance in Methicillin-resistant strains (MRSA).
  • HY-116999
    IR415

    HBV Infection
    IR415 is a potent anti-HBV agent and inhibits HBV replication by blocking the HBx activity. IR415 selectively interacts with HBx (Kd=2 nM) and blocks HBV-mediated RNAi suppression, reverses the inhibitory effect of HBx protein on the activity of the dicer endoribonuclease. HBx: hepatitis B virus X protein.
  • HY-135199
    Ubiquitination-IN-1

    E1/E2/E3 Enzyme Cancer
    Ubiquitination-IN-1 (compound 24) is a ubiquitination and Cksl-Skp2 protein-protein interaction (IC50=0.17 μM) inhibitor. Ubiquitination-IN-1 increases levels of p27. Ubiquitination-IN-1 has the potential for treatment disease by blocking the degradation of tumor suppressors.
  • HY-12830
    M-110

    Pim Cancer
    M-110 is a highly selective, ATP-competitive inhibitor of PIM kinases with a preference for PIM-3 (IC50=47 nM). M-110 inhibits PIM-1 and PIM-2 with similar IC50s of 2.5 μM. M-110 inhibits the proliferation of prostate cancer cell lines with IC50s of 0.6 to 0.9 μM.
  • HY-P1235A
    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Atrial Natriuretic Peptide (ANP) (1-28), human, porcine Acetate is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. ANP (1-28) inhibits endothelin-1 secretion in a dose-dependent way.
  • HY-P0245
    Speract

    Mitochondrial Metabolism Metabolic Disease
    Speract, a sea urchin egg peptide that regulates sperm motility, also stimulates sperm mitochondrial metabolism.
  • HY-P2559
    CDK7/9 tide

    CDK Cancer
    CDK7/9 tide is peptide substrate for CDK7 or CDK9.
  • HY-15295
    Vonoprazan Fumarate

    TAK-438

    Proton Pump Metabolic Disease
    Vonoprazan Fumarate (TAK-438), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan Fumarate inhibits H +,K +-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan Fumarate is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease.
  • HY-115688A
    (S)-TXNIP-IN-1

    Others Others
    (S)-TXNIP-IN-1 is the less active S-enantiomer of TXNIP-IN-1 (HY-115688). TXNIP-IN-1 is a TXNIP-TRX complex inhibitor which can be used in the research of TXNIP-TRX complex associated metabolic disorder (diabetes), cardiovascular disease, or inflammatory disease
  • HY-12220A
    MM-102 TFA

    HMTase Inhibitor IX TFA

    Histone Methyltransferase Cancer
    MM-102 TFA (HMTase Inhibitor IX TFA) is a potent WDR5/MLL interaction inhibitor, achieves IC50 = 2.4 nM with an estimated Ki < 1 nM in WDR5 binding assay, which is >200 times more potent than the ARA peptide.
  • HY-P1597A
    Malantide TFA

    PKA PKC Cancer
    Malantide TFA is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide TFA is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts. Malantide TFA is also an efficient substrate for PKC with a Km of 16 μM.
  • HY-100007
    Vonoprazan

    TAK-438 free base

    Proton Pump Endocrinology
    Vonoprazan (TAK-438 free base), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan inhibits H +,K +-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease.
  • HY-N4317
    Ethoxysanguinarine

    Apoptosis Cancer
    Ethoxysanguinarine is a benzophenanthridine alkaloid natural product that is mainly found in Macleaya cordata. Ethoxysanguinarine inhibits viability and induces apoptosis of colorectal cancer cells by inhibiting protein phosphatase 2A (CIP2A).
  • HY-N6684
    Deoxynivalenol

    Others Metabolic Disease
    Deoxynivalenol, a mycotoxin of the trichothecenes family, crosses the intestinal mucosa by a paracellular pathway through the tight junctions. The Deoxynivalenol transport is not affected by P-glycoprotein (PgP) or multidrug resistance-associated proteins (MRPs) inhibitors.
  • HY-112180
    JNJ-678

    JNJ-53718678

    RSV Infection
    JNJ-678 (JNJ-53718678) is a novel fusion protein inhibitor. JNJ-678 has the potential for respiratory syncytial virus (RSV) treatment.
  • HY-103483
    MD2-IN-1

    Toll-like Receptor (TLR) Inflammation/Immunology
    MD2-IN-1 is an inhibitor of Myeloid differentiation protein 2 (MD2) with a KD of 189  μM for the recombinant human MD2 (rhMD2).
  • HY-18900
    Nec-4

    RIP kinase Inflammation/Immunology
    Nec-4, a tricyclic derivative, is a potent receptor interacting protein 1 (RIP1) inhibitor, with an IC50 of 2.6 μM, Ki of 0.46 μM.
  • HY-15187A
    (R)-Filanesib

    (R)-ARRY-520

    Kinesin Cancer
    (R)-Filanesib ((R)-ARRY-520) is the R-enantiomer of Filanesib (HY-15187). Filanesib is a synthetic kinesin spindle protein (KSP) inhibitor with an IC50 of 6 nM.
  • HY-N1477
    Dencichine

    Dencichin; ODAP

    HIF/HIF Prolyl-Hydroxylase Neurological Disease
    Dencichin is a non-protein amino acid originally extracted from Panax notoginseng, and can inhibit HIF-prolyl hydroxylase-2 (PHD-2) activity.
  • HY-13442
    Eribulin

    B1939; E7389; ER-086526

    Microtubule/Tubulin Apoptosis Cancer
    Eribulin (E7389) is a microtubule targeting agent that is used for the research of metastatic breast cancer. Eribulin inhibits the proliferation of cancer cells by binding microtubule proteins and microtubules.
  • HY-133740
    MS117

    Histone Methyltransferase Cancer
    MS117 is a first-in-class and cell-active irreversible protein arginine methyltransferase 6 (PRMT6) covalent inhibitor, with an IC50 of 18 nM.
  • HY-114349
    HS-1371

    RIP kinase Cancer Infection Cardiovascular Disease
    HS-1371 is a potent and ATP-competitive receptor-interacting protein kinase 3 (RIP3) inhibitor with an IC50 of 20.8 nM.
  • HY-102079
    SAFit1

    FKBP Metabolic Disease Neurological Disease
    SAFit1 is a FK506 binding protein 51 (FKBP51)-specific inhibitor with a Ki of 4±0.3 nM.
  • HY-101563
    GSK3326595

    EPZ015938

    Histone Methyltransferase Cancer
    GSK3326595 (EPZ015938) is a potent, selective, reversible inhibitor of protein arginine methyltransferase 5 (PRMT5) with an IC50 of 6.2 nM.
  • HY-13343
    ZM 336372

    Raf Apoptosis Cancer
    ZM 336372 is a potent inhibitor of the protein kinase c-Raf. The IC50 value is 0.07 μM in the standard assay, which contains 0.1 mM ATP.
  • HY-10394S
    Linezolid D3

    PNU-100766 D3

    Bacterial Infection
    Linezolid D3 is a deuterium labeled Linezolid (PNU-100766). Linezolid is a synthetic antibiotic that acts by inhibiting the initiation of bacterial protein synthesis.
  • HY-112438
    MF-094

    Deubiquitinase Cancer
    MF-094 is a potent and selective USP30 inhibitor with an IC50 of 120 nM. MF-094 increases protein ubiquitination and accelerates mitophagy.
  • HY-18257
    Rolitetracycline

    Bacterial Antibiotic Infection
    Rolitetracycline, a derivative of tetracycline, is a broad-spectrum antibiotic. Rolitetracyclin has a role as a protein synthesis inhibitor, an antiprotozoal drug and a prodrug.
  • HY-13442A
    Eribulin mesylate

    B1939 mesylate; E7389 mesylate; ER-086526 mesylate

    Microtubule/Tubulin Apoptosis Cancer
    Eribulin mesylate (E7389 mesylate) is a microtubule targeting agent that is used for the research of metastatic breast cancer. Eribulin mesylate inhibits the proliferation of cancer cells by binding microtubule proteins and microtubules.
  • HY-123931
    ZLDI-8

    Notch Phosphatase Apoptosis Cancer
    ZLDI-8 is a Notch activating/cleaving enzyme ADAM-17 inhibitor and inhibits the cleavage of Notch protein. ZLDI-8 decreases the expression of pro-survival/anti-apoptosis and epithelial-mesenchymal transition (EMT) related proteins. ZLDI-8 is also a competitive and irreversible tyrosine phosphatase (Lyp) inhibitor with an IC50 of 31.6 μM and a Ki of 26.22 μM. ZLDI-8 inhibits the growth of MHCC97-H cells with an IC50 of 5.32 μM.
  • HY-100432
    LOC14

    Others Inflammation/Immunology Neurological Disease
    LOC14 is a potent Protein disulfide isomerase (PDI) inhibitor with EC50 and Kd values of 500 nM and 62 nM, respectively. LOC14 exhibits high stability in mouse liver microsomes and blood plasma, low intrinsic microsome clearance, and low plasma-protein binding. LOC14 inhibits PDIA3 activity, decreases intramolecular disulfide bonds and subsequent oligomerization (maturation) of HA in lung epithelial cells.
  • HY-130680
    Syk-IN-3

    Syk Cancer
    Syk-IN-3, a potent spleen tyrosine kinase (Syk) inhibitor, extracted from patent WO2011075515A1, compound example 152, has an IC50 of 1 nM.
  • HY-100566
    SuO-Val-Cit-PAB-MMAE

    Drug-Linker Conjugates for ADC Cancer
    SuO-Val-Cit-PAB-MMAE is a drug-linker conjugate for ADC by using the anti-mitotic agent, monomethyl auristatin E (MMAE, a tubulin inhibitor), linked via the peptide SuO-Val-Cit-PAB.
  • HY-19529
    Ro 46-2005

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Ro 46-2005 is a novel synthetic non-peptide endothelin receptor antagonist, inhibits the specific binding of 125I-ET-1 to human vascular smooth muscle cells (ETA receptor) with IC50 of 220 nM.
  • HY-12286
    PI-1840

    Proteasome Cancer
    PI-1840 is a potent and selective inhibitor for chymotrypsin-like (CT-L) (IC50 value = 27 ± 0.14 nM) over trypsin-like and peptidylglutamyl peptide hydrolyzing (IC50 values >100 μM) activities of the proteasome.
  • HY-P1145
    Glucagon-like peptide 1 (1-37), human

    HuGLP-1

    Glucagon Receptor Metabolic Disease
    Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
  • HY-P2317
    Cecropin P1, porcine

    Endogenous Metabolite
    Cecropin P1, porcine is an antibacterial peptide originally identified in moths (Hyalophora cecropia) and later in pig intestine.
  • HY-P1521
    β-Amyloid 15-21

    Beta-Amyloid (15-21)

    Amyloid-β Neurological Disease
    β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
  • HY-P1510
    β-amyloid 1-11

    Amyloid-β Neurological Disease
    β-amyloid (1-11) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
  • HY-P1484
    Bradykinin (1-7)

    Bradykinin Fragment 1-​7

    Bradykinin Receptor Cardiovascular Disease Endocrinology
    Bradykinin (1-7) is an amino-truncated Bradykinin peptide. Bradykinin (1-7) is a metabolite of Bradykinin, cleaved by endopeptidase.
  • HY-P1062
    Lauryl-LF 11

    Bacterial Antibiotic Infection
    Lauryl-LF 11, N-terminally acylated analogue of LF11, is a peptide with antibacterial activity.
  • HY-P1334
    DPDPE

    Opioid Receptor Neurological Disease
    DPDPE, an opioid peptide, is a selective δ-opioid receptor (DOR) agonist with anticonvulsant effects.
  • HY-P1751
    Ceratotoxin B

    Bacterial Infection
    Ceratotoxins B is antibacterial peptide produced by the sexually mature females of Ceratitis capitata. Lytic and antibacterial activity .
  • HY-P1517
    β-Amyloid (31-35)

    Amyloid-β Neurological Disease
    β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.
  • HY-124069
    M-525

    Epigenetic Reader Domain Cancer
    M-525 is a first-in-class, highly potent, irreversible and covalent menin-MLL protein-protein interaction inhibitor. M-525 binds to menin with an IC50 of 3 nM and achieves low nanomolar potencies in cell growth inhibition and in suppression of MLL regulated gene expression in MLL leukemia cells. Anti-leukemia activity.
  • HY-107096B
    CH-0793076 TFA

    TP3076 TFA

    Topoisomerase Cancer
    CH-0793076 (TP3076) TFA, a hexacyclic camptothecin analog, is active drug and major metabolite of TP300. CH-0793076 TFA inhibits DNA topoisomerase I with an IC50 of 2.3 μM. CH-0793076 TFA is efficacious against cells expressing BCRP (breast cancer resistance protein).
  • HY-138407
    PD-1/PD-L1-IN 7

    PD-1/PD-L1 HBV Cancer Infection
    PD-1/PD-L1-IN 7 is a human PD-1/PD-L1 protein/protein interaction inhibitor with an IC50 of 0.213 nM. PD-1/PD-L1-IN 7 has anticancer and antiviral functions.
  • HY-100595
    Sodium stibogluconate

    Stibogluconate trisodium nonahydrate

    Phosphatase Cancer
    Sodium stibogluconate (Stibogluconate trisodium nonahydrate) is a potent inhibitor of protein tyrosine phosphatase. Sodium stibogluconate inhibits 99% of SHP-1, SHP-2 and PTP1B activity at 10, 100, 100 μg/mL, respectively.
  • HY-13977A
    PKR-IN-C16

    Others Neurological Disease
    PKR-IN-C16 is a specific protein kinase (PKR) inhibitor. PKR-IN-C16 is able to inhibit the autophosphorylation of PKR and unlock the translation blockade induced by PKR in primary neuronal cultures.
  • HY-P1479
    Calmodulin-Dependent Protein Kinase II (290-309)

    CaMK Autophagy Neurological Disease
    Calmodulin-Dependent Protein Kinase II (290-309) is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II.
  • HY-P1479A
    Calmodulin-Dependent Protein Kinase II(290-309) acetate

    CaMK Autophagy Neurological Disease
    Calmodulin-Dependent Protein Kinase II (290-309) acetate is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II.
  • HY-P0128
    β-Amyloid (25-35)

    Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)

    Amyloid-β Neurological Disease
    β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells.
  • HY-116819
    VU0453379

    Glucagon Receptor Metabolic Disease
    VU0453379 is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM.
  • HY-P1293
    Conantokin G

    iGluR Neurological Disease
    Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties.
  • HY-122615
    SPOP-IN-6b

    Others Cancer
    SPOP-IN-6b is a speckle-type POZ protein (SPOP) inhibitor extracted from patent CN 107141287, SPOP-B-88.
  • HY-15873A
    FTI 276 TFA

    Farnesyl Transferase Cancer
    FTI-276 is a protein farnesyl transferase (PFT) inhibitor with IC50s of 0.9 nM and 0.5 nM for Plasmodium falciparum and human, respectively.
  • HY-50883
    BMS 299897

    γ-secretase Neurological Disease
    BMS 299897 is a sulfonamide γ-secretase inhibitor with an IC50 of 7 nM for Aβ production inhibition in HEK293 cells stably overexpressing amyloid precursor protein (APP).
  • HY-16642A
    LY2828360

    Cannabinoid Receptor Neurological Disease
    LY2828360 is a slowly acting but efficacious G protein-biased cannabinoid (CB2) agonist, inhibiting cAMP accumulation and activating ERK1/2 signaling.
  • HY-110177
    SP-100030

    NF-κB Inflammation/Immunology
    SP-100030 is a potent NF-κB and activator protein-1 (AP-1) double inhibitor (IC50s=50 and 50 nM, respectively). SP-100030 inhibits IL-2, IL-8, and TNF-alpha production in Jurkat and other T cell lines. SP-100030 decreases murine collagen-induced arthritis (CIA).
  • HY-115497
    BRD5529

    E1/E2/E3 Enzyme Inflammation/Immunology
    BRD5529 is a selective CARD9-E3 ubiquitin ligase TRIM62 protein-protein interaction inhibitor with an IC50 of 8.6 μM. BRD5529 directly and selectively binds CARD9, disrupts TRIM62 recruitment, inhibits TRIM62-mediated ubiquitinylation and activation of CARD9, and demonstrates cellular activity and selectivity in CARD9-dependent pathways.
  • HY-12801A
    DiZPK Hydrochloride

    Others Others
    DiZPK Hydrochloride is a structural analog of pyrrolysine (Pyl), acting as a photocrosslinker for identifying direct protein-protein interactions in living prokaryotic and eukaryotic cells.
  • HY-133021
    Arazine

    N-Acetyl-S-farnesyl-L-cysteine

    Others Inflammation/Immunology
    Arazine (N-Acetyl-S-farnesyl-L-cysteine) is a cell-permeable modulator of G protein and G-protein coupled receptor signaling. Arazine can be a a substrate for isoprenylcysteine methyltransferase by competing with prenylated G protein or its receptors site.
  • HY-P0219
    Microcystin-LA

    Phosphatase Cancer
    Microcystin LA, a natural toxin, exerts its cytotoxic exects by inhibiting the serine-threonine protein phosphatases PP1 and PP2A with IC50s of 0.3 and 0.3 nM, respectively.
  • HY-P7061A
    ALX 40-4C Trifluoroacetate

    CXCR Infection Endocrinology
    ALX 40-4C Trifluoroacetate is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1; ALX 40-4C Trifluoroacetate also acts as an antagonist of the APJ receptor, with an IC50 of 2.9 μM.
  • HY-P7061
    ALX 40-4C

    CXCR Infection Endocrinology
    ALX 40-4C is a small peptide inhibitor of the chemokine receptor CXCR4, inhibits SDF-1 from binding CXCR4 with a Ki of 1 μM, and suppresses the replication of X4 strains of HIV-1; ALX 40-4C Trifluoroacetate also acts as an antagonist of the APJ receptor, with an IC50 of 2.9 μM.
  • HY-D0889
    Glycylglycine

    Endogenous Metabolite Metabolic Disease
    Glycylglycine is the simplest of all peptides and could function as a gamma-glutamyl acceptor.
  • HY-P1860
    TNF-α (31-45), human

    Others Inflammation/Immunology
    TNF-α (31-45), human is a peptide of tumor necrosis factor-α.
  • HY-W008555
    Fmoc-N-Me-Ile-OH

    Others Others
    Fmoc-N-Me-Ile-OH is a used in peptide synthesis.
  • HY-P0163
    Gramicidin

    Bacterial Antibiotic Infection
    Gramicidin is an antimicrobial peptide assembling as channels in membranes and increasing their permeability towards cations.
  • HY-P1524
    Beta-Amyloid(1-14),mouse,rat

    Amyloid-β Neurological Disease
    Beta-Amyloid(1-14),mouse,rat is a 1 to 14 fragment of Amyloid-β peptide.
  • HY-P1593
    Mini Gastrin I, human

    Cholecystokinin Receptor Cancer Endocrinology
    Mini Gastrin I, human is a shorter version of human gastrin, consists of amino acids 5-17 of the parent peptide.
  • HY-P1145A
    Glucagon-like peptide 1 (1-37), human TFA

    HuGLP-1 TFA

    Glucagon Receptor Metabolic Disease
    Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.
  • HY-P1014
    HCGRP-(8-37)

    Human α-CGRP (8-37)

    CGRP Receptor Metabolic Disease Cardiovascular Disease
    HCGRP-(8-37) is a human calcitonin gene-related peptide (hCGRP) fragment and also an antagonist of CGRP receptor.
  • HY-P1334A
    DPDPE TFA

    Opioid Receptor Neurological Disease
    DPDPE TFA, an opioid peptide, is a selective δ-opioid receptor (DOR) agonist with anticonvulsant effects.
  • HY-P1581
    Ceratotoxin A

    Bacterial Infection
    Ceratotoxin A, a 29-residue peptide isolated from the accessory gland secretion fluid, with strong anti-bacterial activity.
  • HY-P1062A
    Lauryl-LF 11 TFA

    Bacterial Antibiotic Infection
    Lauryl-LF 11 TFA, N-terminally acylated analogue of LF11, is a peptide with antibacterial activity.
  • HY-P1490
    Bradykinin (2-9)

    Des-Arg1-bradykinin

    Bradykinin Receptor Cardiovascular Disease Endocrinology
    Bradykinin (2-9) is an amino-truncated Bradykinin peptide. Bradykinin (2-9) is a metabolite of Bradykinin, cleaved by Aminopeptidase P.
  • HY-P0173A
    Chlorotoxin

    Chloride Channel Cancer
    Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
  • HY-P1572
    Handle region peptide, rat

    Renin Inflammation/Immunology
    Handle region peptide, rat is a prorenin receptor antagonist, suppresses the progression of diabetic nephropathy and has anti-inflammatory in the eye.
  • HY-P2496
    Endothelin 1 (swine, human), Alexa Fluor 488-labeled

    Endothelin Receptor Cardiovascular Disease
    Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB.
  • HY-128971
    LHVS

    Cathepsin Parasite Infection
    LHVS is a potent, non-selective cysteine protease inhibitor. LHVS effectively blocks T. gondii microneme protein secretion (IC50=10 μM), gliding motility, and cell invasion.
  • HY-100472
    ZYZ-488

    Caspase Cancer
    ZYZ-488 is a competitive apoptotic protease activating factor-1 (Apaf-1) inhibitor. ZYZ-488 inhibits the activation of binding protein procaspase-9 and procaspase-3.
  • HY-114492
    GSK547

    GSK'547

    RIP kinase Cancer
    GSK547 (GSK'547) is a highly selective and potent inhibitor of receptor-interacting serine/threonine protein kinase 1 (RIP1), inhibits macrophage-mediated adaptive immune tolerance in pancreatic cancer.
  • HY-N0141
    Parthenolide

    (-)-Parthenolide

    NF-κB Autophagy Mitophagy Apoptosis Cancer
    Parthenolide is a sesquiterpene lactone found in the medicinal herb Feverfew. Parthenolide exhibits anti-inflammatory activity by inhibiting NF-κB activation; also inhibits HDAC1 protein without affecting other class I/II HDACs.
  • HY-17593
    Solithromycin

    CEM-101; OP-1068

    Bacterial Antibiotic Infection
    Solithromycin (CEM-101) is an orally bioavailable, effective antimicrobial agent, with IC50s for inhibition of cell viability, protein synthesis, and growth rate are 7.5 ng/mL, 40 ng/mL, and 125 ng/mL for Streptococcus pneumonia, Staphylococcus aureus, and Haemophilus influenzae, respectively. Solithromycin binds to the large 50S subunit of the ribosome and inhibits protein biosynthesis.
  • HY-133146
    DJ001

    Phosphatase Apoptosis Inflammation/Immunology
    DJ001 is a highly specific, selective and non-competitive protein tyrosine phosphatase-σ (PTPσ) inhibitor with an IC50 of 1.43 μM. DJ001 displays no inhibitory activity against other phosphatases, with only modest inhibitory activity against Protein Phosphatase 5. DJ001 promotes promote hematopoietic stem cell regeneration.
  • HY-16659
    EHT 1864

    Ras Neurological Disease Cancer
    EHT 1864 is an inhibitor of Rac family small GTPases. EHT 1864 directly binds and impairs the ability of this small GTPase to engage critical downstream effectors required for growth transformation. The Kd values are 40, 50, 60, and 230 nM for Rac1, Rac1b, Rac2 and Rac3, respectively. EHT 1864 also potently inhibits other Rac-dependent transformation processes, Tiam1- and Ras-mediated growth transformation. EHT 1864 prevents Aβ 40 and Aβ 42 production in vivo.
  • HY-P0276A
    GIP, human TFA

    Gastric Inhibitory Peptide (GIP), human TFA

    Insulin Receptor Metabolic Disease
    GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
  • HY-B2236
    DL-Lysine

    (±)-2,6-Diaminocaproic acid

    Others Metabolic Disease
    DL-Lysine is a racemic mixture of the D-Lysine and L-Lysine. Lysine is an α-amino acid that is used in the biosynthesis of proteins.
  • HY-B2236A
    DL-Lysine monohydrate

    (±)-2,6-Diaminocaproic acid monohydrate

    Others Metabolic Disease
    DL-Lysine monohydrate is a racemic mixture of the D-Lysine and L-Lysine. Lysine is an α-amino acid that is used in the biosynthesis of proteins.
  • HY-B2172
    Vitamin K

    Others Cardiovascular Disease
    Vitamin K, the blood-clotting vitamin, is important for the function of numerous proteins within the body, such as the coagulation factors, osteocalcin and matrix-Gla protein.
  • HY-B1898
    Metadoxine

    PKA Metabolic Disease
    Metadoxine blocks adipocyte differentiation in association with inhibition of the protein kinase A-cAMP response element binding protein (PKA-CREB) pathway.
  • HY-130256
    β-NF-JQ1

    PROTAC Epigenetic Reader Domain Cancer
    β-NF-JQ1 is a PROTAC that recruits AhR E3 ligase to target proteins. β-NF-JQ1 is directed against bromodomain-containing (BRD) proteins using β-NF as an AhR ligand, induces the interaction of AhR and BRD proteins, and displays effective anticancer activity that correlated with protein knockdown activity.
  • HY-100857
    PrPSc-IN-1

    Others Neurological Disease
    PrPSc-IN-1 is a fluorescent probe, binds to the misfolded protein PrP Sc, inhibits its accumulation, with an IC50 of 1.6 μM. Anti-prion activity.
  • HY-110263
    EML 425

    Histone Acetyltransferase Epigenetic Reader Domain Metabolic Disease Neurological Disease Cardiovascular Disease
    EML425 is a potent and selective CREB binding protein (CBP)/p300 inhibitor with IC50s of 2.9 and 1.1 μM, respectively.
  • HY-122386
    Kirromycin

    Mocimycin; Delvomycin

    Bacterial Antibiotic Infection
    Kirromycin (Mocimycin) is an antibiotic produced by Streptomyces ramocissimus. Kirromycin is a bacterial protein synthesis inhibitor that immobilizes elongation factor Tu (EF-Tu) on the elongating ribosome.
  • HY-18563
    4-Phenoxybenzylamine

    HCV Infection
    4-Phenoxybenzylamine inhibits the function of the NS3 protein by stabilizing an inactive conformation with an IC50 of about 500 μM against FL NS3/4a.
  • HY-B1848
    Hexaflumuron

    Others Others
    Hexazinone is a nonselective herbicide from the triazine family. Hexazinone binds to the D-1 quinone protein of the electron transport chain in photosystem II to inhibit the photosynthesis.
  • HY-B1849
    Hexazinone

    Others Infection
    Hexazinone is a nonselective herbicide from the triazine family. Hexazinone binds to the D-1 quinone protein of the electron transport chain in photosystem II to inhibit the photosynthesis.
  • HY-18623
    VI 16832

    Others Cancer
    VI 16832 is a broad spectrum Type I kinase inhibitor which can be used as an enrichment tool for the comparative expression analysis of protein kinases in different cancer cell lines.
  • HY-128807
    E3 ligase Ligand 10

    Ligand for E3 Ligase Cancer
    E3 ligase Ligand 10 is a ligand for E3 ubiquitin ligase. E3 ligase Ligand 10 can be connected to the ligand for protein by a linker to form PROTACs. PROTACs are inducers of ubiquitination-mediated degradation of cancer-promoting proteins.
  • HY-129653
    E3 ligase Ligand 18

    Ligand for E3 Ligase Cancer
    E3 ligase Ligand 18 is a ligand for E3 ubiquitin ligase. E3 ligase Ligand 18 can be connected to the ligand for protein by a linker to form PROTACs. PROTACs are inducers of ubiquitination-mediated degradation of cancer-promoting proteins.
  • HY-128811
    E3 ligase Ligand 14

    Ligand for E3 Ligase Cancer
    E3 ligase Ligand 14 is a ligand for E3 ubiquitin ligase. E3 ligase Ligand 14 can be connected to the ligand for protein by a linker to form PROTACs. PROTACs are inducers of ubiquitination-mediated degradation of cancer-promoting proteins.
  • HY-43961
    E3 ligase Ligand 8

    Ligand for E3 Ligase Cancer
    E3 ligase Ligand 8 is a ligand for E3 ubiquitin ligase. E3 ligase Ligand 8 can be connected to the ligand for protein by a linker to form PROTACs. PROTACs are inducers of ubiquitination-mediated degradation of cancer-promoting proteins.
  • HY-100585
    Splitomicin

    Splitomycin

    HDAC Cancer
    Splitomicin (Splitomycin) is a selective Sir2p inhibitor. Splitomicin inhibits NAD +-dependent HDAC activity of Sir2 protein. Splitomicin induces dose-dependent inhibition of HDAC in the yeast extract with an IC50 of 60 μM.
  • HY-N2000
    Bellidifolin

    HIV Cancer Infection Inflammation/Immunology
    Bellidifolin is a xanthone isolated from the stems of Swertia punicea, with hepatoprotective, hypoglycemic, anti-oxidation, anti-inflammatory and antitumor activities. Bellidifolin also acts as a viral protein R (Vpr) inhibitor.
  • HY-128806
    E3 ligase Ligand 9

    Ligand for E3 Ligase Cancer
    E3 ligase Ligand 9 is a ligand for E3 ubiquitin ligase. E3 ligase Ligand 9 can be connected to the ligand for protein by a linker to form PROTACs or SNIPERs. PROTACs are inducers of ubiquitination-mediated degradation of cancer-promoting proteins.
  • HY-N0830
    Palmitic acid

    Endogenous Metabolite HSP Metabolic Disease Neurological Disease Cardiovascular Disease Cancer
    Palmitic acid is a long-chain saturated fatty acid commonly found in both animals and plants. PA can induce the expression of glucose-regulated protein 78 (GRP78) and CCAAT/enhancer binding protein homologous protein (CHOP) in in mouse granulosa cells.
  • HY-P0250
    Kassinin

    Neurokinin Receptor Neurological Disease Endocrinology
    Kassinin is a peptide derived from the Kassina frog. It belongs to tachykinin family of neuropeptides. It is secreted as a defense response, and is involved in neuropeptide signalling.
  • HY-P2416
    Gastrin I, rat

    Rat Gastrin-17

    Cholecystokinin Receptor Endocrinology
    Gastrin I, rat (Rat Gastrin-17) is a peptide hormone, can stimulate gastric acid secretion potently.
  • HY-P1593A
    Mini Gastrin I, human TFA

    Cholecystokinin Receptor Cancer Endocrinology
    Mini Gastrin I, human (TFA) is a shorter version of human gastrin, consists of amino acids 5-17 of the parent peptide.
  • HY-P2282
    APTSTAT3-9R

    STAT Cancer
    APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity.
  • HY-W013750
    Fmoc-Arg-OH

    Fmoc-L-Arginine

    Others Others
    Fmoc-Arg-OH (Fmoc-L-Arginine), an Fmoc modified Arginine, is a used in peptide synthesis.
  • HY-P1346A
    APETx2 TFA

    Sodium Channel Inflammation/Immunology Neurological Disease
    APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain.
  • HY-P1259
    PR-39

    Proteasome Bacterial Inflammation/Immunology
    PR-39, a natural proline- and arginine-rich antibacterial peptide, is a noncompetitive, reversible and allosteric proteasome inhibitor. PR-39 reversibly binds to the α7 subunit of the proteasome and blocks degradation of NF-κB inhibitor IκBα by the ubiquitin-proteasome pathway. PR-39 stimulates angiogenesis, inhibits inflammatory responses and significant reduces myocardial infarct size in mice.
  • HY-101121
    NI-42

    Epigenetic Reader Domain Cancer
    NI-42 (compound 13-d), a structurally orthogonal chemical probe for the BRPFs, is a biased, potent inhibitor of the BRD of the BRPFs (IC50s of BRPF1/2/3=7.9/48/260 nM; Kds of BRPF1/2/3=40/210/940 nM) with excellent selectivity over nonclass IV BRD proteins.
  • HY-101518
    APG-115

    AA-115

    MDM-2/p53 E1/E2/E3 Enzyme Apoptosis Cancer
    APG-115 (AA-115) is an orally active MDM2 protein inhibitor binding to MDM2 protein with IC50 and Ki values of 3.8 nM and 1 nM, respectively. APG-115 blocks the interaction of MDM2 and p53 and induces cell-cycle arrest and apoptosis in a p53-dependent manner.
  • HY-108262
    UCN-02

    7-epi-Hydroxystaurosporine

    PKC PKA Cancer
    UCN-02 (7-epi-Hydroxystaurosporine) is a selective protein kinase C (PKC) inhibitor produced by Streptomyces strain N-12, with IC50s of 62 nM and 250 nM for PKC and protein kinase A (PKA), respectively. UCN-02 (7-epi-Hydroxystaurosporine) displays cytotoxic effect on the growth of HeLa S3 cells.
  • HY-129939
    PROTAC BRD4 ligand-1

    Epigenetic Reader Domain Ligand for Target Protein for PROTAC Cancer
    PROTAC BRD4 ligand-1 is a potent BET inhibitor and a ligand for target BRD4 protein for PROTACT GNE-987 (HY-129937A).
  • HY-18717
    Mutant IDH1-IN-2

    Isocitrate Dehydrogenase (IDH) Cancer
    Mutant IDH1-IN-2 is a inhibitor of mutant Isocitrate dehydrogenase (IDH) proteins, with IC50 of in LS-MS biochemical assay, IC50 of 16.6 nM in Fluorescence biochemical assay.
  • HY-135397
    (R)-​Linezolid

    (R)-PNU-100766

    Others Infection
    (R)-Linezolid is an impurity of Linezolid (PNU-100766). Linezolid, the first member of the class of oxazolidinone synthetic antibiotic, acts by inhibiting the initiation of bacterial protein synthesis.
  • HY-B2006
    Fenvalerate

    Phosphatase Bacterial Infection
    Fenvalerate is a potent protein phosphatase 2B (calcineurin) inhibitor with an IC50 of 2-4 nM for PP2B-Aα. Fenvalerate is a pyrethroid ester insecticide and acaricide.
  • HY-B0282
    Acetylcholine chloride

    ACh chloride

    nAChR Calcium Channel Endogenous Metabolite Neurological Disease Cancer
    Acetylcholine chloride (ACh chloride), a neurotransmitter, is a potent cholinergic agonist. Acetylcholine chloride is a modulator of the activity of dopaminergic (DAergic) neurons through the stimulation of nicotinic acetylcholine receptors (nAChRs). Acetylcholine chloride inhibits p53 mutant peptide aggregation in vitro.
  • HY-N2319
    Dihydroergocristine mesylate

    DHEC mesylate

    Amyloid-β Neurological Disease
    Dihydroergocristine mesylate (DHEC mesylate) is a inhibitor of γ-secretase (GSI), reduces the production of the Alzheimer's disease amyloid-β peptides, binds directly to γ-secretase and Nicastrin with equilibrium dissociation constants (Kd) of 25.7 nM and 9.8 μM, respectively.
  • HY-W009602
    Phenylalanylalanine

    H-Phe-Ala-OH

    Others Others
    Phenylalanylalanine (H-Phe-Ala-OH) is a dipeptide composed of phenylalanine and alanine. Phenylalanylalanine is an incomplete breakdown product of protein digestion or protein catabolism.
  • HY-128699
    D-Desthiobiotin

    Endogenous Metabolite Others
    D-Desthiobiotin is a biotin derivative used in affinity chromatography and protein chromatography, also can be used for protein and cell labeling, detection and isolation.
  • HY-13624A
    Epirubicin hydrochloride

    4'-Epidoxorubicin hydrochloride

    DNA/RNA Synthesis Topoisomerase Apoptosis Cancer
    Epirubicin hydrochloride (4'-Epidoxorubicin hydrochloride), a semisynthetic L-arabino derivative of doxorubicin, has an antineoplastic agent by inhibiting Topoisomerase. Epirubicin hydrochloride inhibits DNA and RNA synthesis. Epirubicin hydrochloride is a Forkhead box protein p3 (Foxp3) inhibitor and inhibits regulatory T cell activity.
  • HY-13624
    Epirubicin

    4'-Epidoxorubicin

    DNA/RNA Synthesis Topoisomerase Apoptosis Cancer
    Epirubicin (4'-Epidoxorubicin), a semisynthetic L-arabino derivative of doxorubicin, has an antineoplastic agent by inhibiting Topoisomerase. Epirubicin inhibits DNA and RNA synthesis. Epirubicin is a Forkhead box protein p3 (Foxp3) inhibitor and inhibits regulatory T cell activity.
  • HY-114410
    CCI-006

    Mitochondrial Metabolism Cancer
    CCI-006 is a selective inhibitor and chemosensitizer of MLL-rearranged leukemia cells, by inhibits mitochondrial respiration resulting in insurmountable mitochondrial depolarization and a pro-apoptotic unfolded protein response (UPR) in a subset of MLL-r leukemia cells.
  • HY-N7068
    Mupirocin calcium hydrate

    Bacterial Antibiotic Infection Inflammation/Immunology
    Mupirocin calcium hydrate is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin calcium hydrate apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis.
  • HY-13756A
    Tacrolimus monohydrate

    FK506 monohydrate; Fujimycin monohydrate; FR900506 monohydrate

    Phosphatase FKBP Autophagy Bacterial Antibiotic Cancer Infection Inflammation/Immunology
    Tacrolimus monohydrate (FK506 monohydrate), a macrocyclic lactone, binds to FK506 binding protein (FKBP) to form a complex and inhibits calcineurin phosphatase, which inhibits T-lymphocyte signal transduction and IL-2 transcription. Immunosuppressive properties.
  • HY-P1293A
    Conantokin G TFA

    iGluR Neurological Disease
    Conantokin G TFA, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G TFA inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G TFA has neuroprotective properties.
  • HY-P1164
    Urotensin II (114-124), human

    Urotensin Receptor Cardiovascular Disease
    Urotensin II (114-124), human, an 11-amino acid residue peptide, is a potent vasoconstrictor and agonist for the orphan receptor GPR14.
  • HY-P0206
    Bradykinin

    Bradykinin Receptor Endogenous Metabolite Cardiovascular Disease Endocrinology
    Bradykinin is an active peptide that is generated by the kallikrein-kinin system. It is a inflammatory mediator and also recognized as a neuromediator and regulator of several vascular and renal functions.
  • HY-P1592A
    G3-C12 TFA

    Galectin Cancer
    G3-C12 (TFA) is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
  • HY-P1534
    Adrenomedullin (1-50), rat

    CGRP Receptor Cardiovascular Disease
    Adrenomedullin (1-50), rat is a 50 amino acid peptide, which induces a selective arterial vasodilation via activation of CGRP1 receptor.
  • HY-P1469
    Bradykinin (1-6)

    Bradykinin Receptor Cardiovascular Disease Endocrinology
    Bradykinin (1-6) is an amino-truncated Bradykinin peptide. Bradykinin (1-6) is a stable metabolite of Bradykinin, cleaved by carboxypeptidase Y (CPY).
  • HY-P2318
    Bac2A TFA

    Fungal
    Bac2A TFA is an antimicrobial and immunomodulatory peptide. Bac2A TFA is a linear variant of bactenecin and is very effective against fungal pathogens.
  • HY-17504A
    Rosuvastatin

    ZD 4522

    HMG-CoA Reductase (HMGCR) Autophagy Potassium Channel Metabolic Disease Cardiovascular Disease
    Rosuvastatin (ZD 4522) is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM, delayed cardiac repolarization, and thereby prolonged action potential durations (APDs) and corrected QT interval (QTc) intervals. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-P1141A
    GLP-1(9-36)amide TFA

    Glucagon Receptor Metabolic Disease
    GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor.
  • HY-P2230
    Angstrom6

    A6 Peptide

    PAI-1 Cancer
    Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling.
  • HY-129361
    Fmoc-Ala-Ala-Asn-PABC-PNP

    ADC Linker Cancer
    Fmoc-Ala-Ala-Asn-PABC-PNP is a peptide cleavable ADC linker.
  • HY-P1695
    Cinnamycin

    Ro 09-0198

    Antibiotic Bacterial Infection
    Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) .
  • HY-101177
    Naltrindole hydrochloride

    Opioid Receptor Neurological Disease Cancer
    Naltrindole hydrochloride is a highly potent and selective non-peptide δ opioid receptor antagonist with a Ki of 0.02 nM.
  • HY-131095
    Z-Glu-Tyr-OH

    Others Others
    Z-Glu-Tyr-OH can be used for synthesis of peptides on a solid support.
  • HY-19639
    E-982

    Others Others
    E-982 is a steroid used for the on-line screening of the DNA unwinding element binding protein (DUE-B) immobilized protein column.
  • HY-103194
    KH7

    Others Others
    KH7 is a soluble adenylyl cyclase (sAC)-specific inhibitor, with IC50s of 3-10 μM toward both recombinant purified human sACt protein and heterologously expressed sACt in cellular assays. KH7 is also a cAMP inhibitor.
  • HY-112800
    cyt-PTPε Inhibitor-1

    Phosphatase Metabolic Disease
    cyt-PTPε Inhibitor-1 is a potent cytosolic protein tyrosine phosphatase epsilon (cyt-PTPε) inhibitor, binds to the catalytic domain of cyt-PTPε, blocks c-Src activation (dephosphorylation of c-Src), and exhibits anti-osteoclastic activity.
  • HY-P1259A
    PR-39 TFA

    Proteasome Bacterial Inflammation/Immunology
    PR-39 TFA, a natural proline- and arginine-rich antibacterial peptide, is a noncompetitive, reversible and allosteric proteasome inhibitor. PR-39 TFAreversibly binds to the α7 subunit of the proteasome and blocks degradation of NF-κB inhibitor IκBα by the ubiquitin-proteasome pathway. PR-39 TFA stimulates angiogenesis, inhibits inflammatory responses and significant reduces myocardial infarct size in mice.
  • HY-P1474
    β-Amyloid (22-35)

    Amyloid β-Protein (22-35)

    Amyloid-β Neurological Disease
    β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution).
  • HY-111860
    SNIPER(ABL)-013

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-013, conjugating GNF5 (ABL inhibitor) to Bestatin (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 20 μM.
  • HY-111548
    Spastazoline

    Others Others
    Spastazoline is a potent and selective spastin (a microtubule-severing AAA protein) inhibitor, with an IC50 of 99 nM for Human spastin. Spastazoline shows no effect on ATPase activity of a recombinant human VPS4.
  • HY-N6729
    HT-2 Toxin

    Others Metabolic Disease
    HT-2 Toxin is an active, deacetylated metabolite of the T-2 toxin. HT-2 toxin inhibits protein synthesis and cell proliferation in plants.
  • HY-N4185
    Licoflavone A

    Phosphatase Neurological Disease
    Licoflavone A is a flavonoid isolated from the roots of Glycyrrhiza uralensis, inhibits protein tyrosine phosphatase-1B (PTP1B), with an IC50 of 54.5 μM.
  • HY-B1596A
    Ceftizoxime sodium

    SKF-88373

    Bacterial Antibiotic Infection
    Ceftizoxime sodium (SKF-88373) is third generation cephalosporin effective against Gram-negative and Gram-positive bacteria. It binds penicillin-binding proteins (PBPs) and inhibits the bacterial cell wall synthesis.
  • HY-14865C
    Omadacycline hydrochloride

    PTK0796 hydrochloride; Amadacycline hydrochloride

    Bacterial Antibiotic Infection
    Omadacycline (PTK 0796) hydrochloride, a tetracycline antibacterial agent, acts through the inhibition of protein synthesis. Omadacycline hydrochloride exhibits activity against a broad spectrum of bacteria, including Gram-positive, Gram-negative, anaerobic, and atypical pathogens. Omadacycline hydrochloride can be used for the research of acute bacterial skin and skin-structure infections, community-acquired pneumonia, and urinary tract infections.
  • HY-138565
    K-975

    YAP Cancer
    K-975 is a potent, selective and orally active TEAD inhibitor, with a strong inhibitory effect against protein-protein interactions between YAP1/TAZ and TEAD. K-975 covalently binds to Cys359 located in the palmitate-binding pocket of TEAD via an acrylamide structure. K-975 exhibits antitumor activity on malignant pleural mesothelioma.
  • HY-A0036
    Bazedoxifene acetate

    TSE-424 acetate

    Estrogen Receptor/ERR Cancer
    Bazedoxifene acetate (TSE-424 acetate) is an oral, nonsteroidal selective estrogen receptor modulator (SERM), with IC50s of 23 nM and 99 nM for ERα and ERβ, respectively. Bazedoxifene acetate can be used for the research of osteoporosis. Bazedoxifene acetate also acts as an inhibitor of IL-6/GP130 protein-protein interactions and can be used for the research of pancreatic cancer.
  • HY-13756
    Tacrolimus

    FK506; Fujimycin; FR900506

    Phosphatase FKBP Bacterial Autophagy Antibiotic Cancer Infection Inflammation/Immunology
    Tacrolimus (FK506), a macrocyclic lactone, binds to FK506 binding protein (FKBP) to form a complex. Tacrolimus inhibits calcineurin phosphatase, which inhibits T-lymphocyte signal transduction and IL-2 transcription. Immunosuppressive properties.
  • HY-114492A
    (Rac)-GSK547

    RIP kinase Cancer
    (Rac)-GSK547 is the racemate of GSK547. GSK547 is a highly selective and potent inhibitor of receptor-interacting serine/threonine protein kinase 1 (RIP1), inhibits macrophage-mediated adaptive immune tolerance in pancreatic cancer.
  • HY-N6732
    K-252a

    SF2370; Antibiotic K 252a; Antibiotic SF 2370

    PKC PKA CaMK Trk Receptor Autophagy Antibiotic Infection Inflammation/Immunology
    K-252a, a staurosporine analog isolated from Nocardiopsis sp. soil fungi, inhibits protein kinase, with IC50 values of 470 nM, 140 nM, 270 nM, and 1.7 nM for PKC, PKA, Ca 2+/calmodulin-dependent kinase type II, and phosphorylase kinase, respectively. K-252a is a potent inhibitor (IC50 of 3 nM) of the tyrosine protein kinase (TRK) activity of the NGF receptor gp140trk, the product of the trk protooncogene.
  • HY-101903A
    BMS-309403 sodium

    FABP Metabolic Disease Cardiovascular Disease
    BMS-309403 sodium is a potent, orally active, and selective adipocyte fatty acid binding protein (also known as FABP4, aP2) inhibitor, with Kis of <2, 250, and 350 nM for FABP4, FABP3, and FABP5, respectively. BMS-309403 sodium interacts with the fatty-acid-binding pocket within the interior of the protein and competitively inhibits the binding of endogenous fatty acids. BMS-309403 sodium improves endothelial function in apolipoprotein E-deficient mice and in cultured human endothelial cells.
  • HY-101903
    BMS-309403

    FABP Metabolic Disease Cardiovascular Disease
    BMS-309403 is a potent, orally active and selective adipocyte fatty acid binding protein (also known as FABP4, aP2) inhibitor with Kis of <2, 250, and 350 nM for FABP4, FABP3, and FABP5, respectively. BMS-309403 interacts with the fatty-acid-binding pocket within the interior of the protein and competitively inhibits the binding of endogenous fatty acids. BMS-309403 improves endothelial function in apolipoprotein E-deficient mice and in cultured human endothelial cells.
  • HY-W011109
    CKI-7

    Casein Kinase CDK SGK Ribosomal S6 Kinase (RSK) Cancer
    CKI-7 is a potent and ATP-competitive casein kinase 1 (CK1) inhibitor with an IC50 of 6 μM and a Ki of 8.5 μM. CKI-7 is a selective Cdc7 kinase inhibitor. CKI-7 also inhibits SGK, ribosomal S6 kinase-1 (S6K1) and mitogen- and stress-activated protein kinase-1 (MSK1). CKI-7 has a much weaker effect on casein kinase II and other protein kinases.
  • HY-N6791
    KT5823

    PKA PKC Bacterial Apoptosis Antibiotic Infection Inflammation/Immunology
    KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na +/I - symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation.
  • HY-P1105
    GaTx2

    Others Neurological Disease
    GaTx2 is a seletive and a high affinity inhibitor of ClC-2 channels with a voltage-dependent apparent KD of ∼20 pM. GaTx2 is a peptide toxin inhibitor from Leiurus quinquestriatus hebraeus venom. GaTx2 is useful in determining the role and the membrane localization of ClC-2 in specific cell types.
  • HY-W010041
    Scyllo-Inositol

    Amyloid-β Endogenous Metabolite Neurological Disease
    Scyllo-Inositol, an amyloid inhibitor, potentialy inhibits α-synuclein aggregation. Scyllo-Inositol stabilizes a non-fibrillar non-toxic form of amyloid-β peptide (Aβ42) in vitro, reverses cognitive deficits, and reduces synaptic toxicity and lowers amyloid plaques in an Alzheimer's disease mouse model.
  • HY-P1164A
    Urotensin II (114-124), human TFA

    Urotensin Receptor Cardiovascular Disease
    Urotensin II (114-124), human TFA, an 11-amino acid residue peptide, is a potent vasoconstrictor and agonist for the orphan receptor GPR14.
  • HY-P1244
    Secretin (33-59), rat

    Secretin (rat)

    Glucagon Receptor Neurological Disease
    Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
  • HY-P0191
    Charybdotoxin

    Potassium Channel Inflammation/Immunology
    Charybdotoxin, a 37-amino acid peptide isolated from venom of the scorpion Leiurus quinquestriatus var. hebraeus, is a K + channel blocker.
  • HY-P1772
    β-Amyloid (1-17)

    Amyloid-β Neurological Disease
    β-Amyloid (1-17) is a peptide of β-Amyloid, stabilizes the fibres and plays a role in Aβ fibre formation.
  • HY-P1562
    PUMA BH3

    Bcl-2 Family Cancer
    PUMA BH3 is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
  • HY-P1225
    {Val1}-Exendin-3/4

    Glucagon Receptor Metabolic Disease
    {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.
  • HY-P0263
    Dermaseptin

    Bacterial Fungal Antibiotic Infection
    Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration.
  • HY-P1474A
    β-Amyloid (22-35) (TFA)

    Amyloid β-Protein (22-35) (TFA)

    Amyloid-β Neurological Disease
    β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 TFA forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution).
  • HY-108466
    Ro 08-2750

    Apoptosis Cancer Neurological Disease
    Ro 08-2750 is a non-peptide and reversible nerve growth factor (NGF) inhibitor which binds to NGF, and with an IC50 of ~ 1 µM. Ro 08-2750 inhibits NGF binding to p75 NTR selectively over TRKA. Ro 08-2750 is a selective MSI RNA-binding activity inhibitor, with an IC50 of 2.7 μM.
  • HY-13264
    Degrasyn

    WP1130

    Deubiquitinase Bcr-Abl Autophagy Apoptosis Cancer
    Degrasyn (WP1130) is a cell-permeable deubiquitinase (DUB) inhibitor, directly inhibiting DUB activity of USP9x, USP5, USP14, and UCH37. Degrasyn has been shown to downregulate the antiapoptotic proteins Bcr-Abl and JAK2.
  • HY-111752
    EML4-ALK kinase inhibitor 1

    ALK Cancer
    EML4-ALK kinase inhibitor 1 is a potent orally active inhibitor of echinoderm microtubule-associated protein-like 4-anaplastic lymphoma kinase (EML4-ALK), with an IC50 of 1 nM.
  • HY-N1255
    Scoulerine

    (-)-Scoulerine; Discretamine

    Microtubule/Tubulin Beta-secretase Apoptosis Cancer
    Scoulerine ((-)-Scoulerine), an isoquinoline alkaloid, is a potent antimitotic compound. Scoulerine is also an inhibitor of BACE1 (ß-site amyloid precursor protein cleaving enzyme 1). Scoulerine inhibits proliferation, arrests cell cycle, and induces apoptosis in cancer cells.
  • HY-U00235
    SR121566A

    Integrin Inflammation/Immunology
    SR121566A is a novel non-peptide Glycoprotein IIb/IIIa (GP IIb-IIIa) antagonist, which can inhibit ADP-, arachidonic acid- and collagen-induced human platelet aggregation with IC50s of 46±7.5, 56±6 and 42±3 nM, respectively.
  • HY-126488
    H-Ser-His-OH

    Endogenous Metabolite Metabolic Disease
    H-Ser-His-OH is a short peptide with hydrolysis cleavage activity, an endogenous metabolite.
  • HY-15555
    EPZ005687

    Histone Methyltransferase Cancer
    EPZ005687 is a potent and selective inhibitor of EZH2 with Ki of 24 nM, and has 50-fold selectivity against EZH1 and 500-fold selectivity against 15 other protein methyltransferases.
  • HY-112157
    PF-06751979

    Beta-secretase Neurological Disease
    PF-06751979 is a potent, brain penetrant, β-site amyloid precursor protein cleaving enzyme 1 (BACE1) inhibitor with an IC50 of 7.3 nM in BACE1 binding assay.
  • HY-N6650
    Isotanshinone IIA

    Phosphatase Metabolic Disease
    Isotanshinone IIA, an abietane-type diterpene metabolite, could non-competitively inhibit Protein Tyrosine Phosphatase 1B (PTP1B) activity with an IC50 0f 11.4 μM.
  • HY-N6651
    Isocryptotanshinone

    STAT Phosphatase Cancer
    Isocryptotanshinone is a potent signal transducer and activator of transcription 3 (STAT3) and protein tyrosine phosphatase 1B PTP1B inhibitor, with an IC50 of 56.1 μM for PTP1B.
  • HY-128907
    MC-Val-Cit-PAB-clindamycin

    Drug-Linker Conjugates for ADC Cancer
    MC-Val-Cit-PAB-clindamycin is a drug-linker conjugate for ADC with potent antitumor activity by using clindamycin (a protein synthesis inhibitor), linked via the ADC linker MC-Val-Cit-PAB.
  • HY-128585
    GNE684

    RIP kinase Cancer Inflammation/Immunology
    GNE684 is a potent inhibitor of potent receptor interacting protein 1 (RIP1), with mean Ki app values of 21 nM, 189 nM and 691 nM for human mouse and rat RIP1, respectively.
  • HY-128902
    MC-Val-Cit-PAB-vinblastine

    Drug-Linker Conjugates for ADC Cancer
    MC-Val-Cit-PAB-vinblastine is a drug-linker conjugate for ADC with potent antitumor activity by using vinblastine (an microtubule protein inhibitor), linked via the ADC linker MC-Val-Cit-PAB.
  • HY-112149
    ZL0420

    Epigenetic Reader Domain Inflammation/Immunology
    ZL0420 is a potent and selective bromodomain-containing protein 4 (BRD4) inhibitor with IC50 values of 27 nM against BRD4 BD1 and 32 nM against BRD4 BD2.
  • HY-111859
    SNIPER(ABL)-058

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-058, conjugating Imatinib (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 10 μM.
  • HY-16911
    AFN-1252

    API-1252; Debio 1452

    Bacterial Antibiotic Infection
    AFN-1252(Debio 1452) is a potent inhibitor of enoyl-acyl carrier protein reductase (FabI), inhibited all clinical isolates of Staphylococcus aureus and Staphylococcus epidermidis at concentrations of ≤0.12 μg/ml.
  • HY-111854
    SNIPER(ABL)-015

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-015, conjugating GNF5 (ABL inhibitor) to MV-1 (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 5 μM .
  • HY-120508
    Pivanex

    AN-9; Pivalyloxymethyl butyrate

    HDAC Bcr-Abl Apoptosis Cancer Inflammation/Immunology
    Pivanex (AN-9), a derivative of Butyric acid, is an orally active HDAC inhibitor. Pivanex down-regulates bcr-abl protein and enhances apoptosis. Pivanex has antimetastic and antiangiogenic properties.
  • HY-15286
    Sodium 4-pentynoate

    Others Others
    Sodium 4-pentynoate is a alkynylacetate analogue, can be metabolically incorporated onto cellular proteins through biosynthetic mechanisms for profiling of acetylated proteins in diverse cell types.
  • HY-P1036
    Compstatin

    Complement System Others
    Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively.
  • HY-17504
    Rosuvastatin Calcium

    Rosuvastatin hemicalcium; ZD 4522 Calcium

    HMG-CoA Reductase (HMGCR) Autophagy Potassium Channel Metabolic Disease Cardiovascular Disease
    Rosuvastatin Calcium (Rosuvastatin hemicalcium) is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin Calcium potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM, delayed cardiac repolarization, and thereby prolonged action potential durations (APDs) and corrected QT interval (QTc) intervals. Rosuvastatin Calcium reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin Calcium is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-17504C
    (3R,5R)-Rosuvastatin

    HMG-CoA Reductase (HMGCR) Potassium Channel Autophagy Metabolic Disease Cardiovascular Disease
    (3R,5R)-Rosuvastatin is the (3R,5R)-enantiomer of Rosuvastatin. Rosuvastatin is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-17504D
    (3S,5R)-Rosuvastatin

    HMG-CoA Reductase (HMGCR) Potassium Channel Autophagy Metabolic Disease Cardiovascular Disease
    (3S,5R)-Rosuvastatin is the (3S,5R)-enantiomer of Rosuvastatin. Rosuvastatin is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-A0031
    Bazedoxifene

    TSE-424

    Estrogen Receptor/ERR Cancer
    Bazedoxifene (TSE-424) is an oral, BBB-penetrant nonsteroidal selective estrogen receptor modulator (SERM), with IC50s of 23 nM and 99 nM for ERα and ERβ, respectively. Bazedoxifene can be used for the research of osteoporosis. Bazedoxifene also acts as an inhibitor of IL-6/GP130 protein-protein interactions and can be used for the research of pancreatic cancer.
  • HY-A0031A
    Bazedoxifene hydrochloride

    TSE-424 hydrochloride

    Estrogen Receptor/ERR Cancer
    Bazedoxifene hydrochloride (TSE-424 hydrochloride) is an oral active, BBB-penetrant nonsteroidal selective estrogen receptor modulator (SERM), with IC50s of 23 nM and 99 nM for ERα and ERβ, respectively. Bazedoxifene hydrochloride can be used for the research of osteoporosis. Bazedoxifene hydrochloride acts as an inhibitor of IL-6/GP130 protein-protein interactions. Bazedoxifene hydrochloride can be used for the research of pancreatic cancer.
  • HY-123979
    ζ-Stat

    NSC37044

    PKC Apoptosis Cancer
    ζ-Stat (NSC37044) is a specific and atypical PKC-ζ inhibitor, with an IC50 of 5 μM. ζ-Stat can reduce melanoma cell lines proliferation and induce apoptosis, and has antitumor activity in vitro.
  • HY-122727
    STL127705

    DNA-PK Cancer
    STL127705 (Compound L) is a Ku 70/80 heterodimer protein inhibitor, inhibits Ku70/80-DNA interaction, with an IC50 of 3.5 μM. STL127705 also inhibits Ku-dependent activation of DNA-PKCS kinase (IC50, 2.5 μM).
  • HY-P0173B
    Chlorotoxin TFA

    Chloride Channel Cancer
    Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker. Anti-cancer activity.
  • HY-P2523
    Temporin L

    Bacterial Fungal Infection
    Temporin L is a potent antimicrobial peptide and is active against Gram-negative bacteria and yeast strains. Temporin L also has antiendotoxin properties.
  • HY-P0324
    Parasin I

    Bacterial Infection
    Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
  • HY-P0191A
    Charybdotoxin TFA

    Potassium Channel Inflammation/Immunology
    Charybdotoxin TFA, a 37-amino acid peptide isolated from venom of the scorpion Leiurus quinquestriatus var. hebraeus, is a K + channel blocker.
  • HY-106262B
    Delcasertib hydrochloride

    KAI-9803 hydrochloride; BMS-875944 hydrochloride

    PKC Inflammation/Immunology Cardiovascular Disease
    Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI).
  • HY-106262
    Delcasertib

    KAI-9803; BMS-875944

    PKC Inflammation/Immunology Cardiovascular Disease
    Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI).
  • HY-P2231A
    Cotadutide acetate

    MEDI0382 acetate

    Glucagon Receptor Metabolic Disease
    Cotadutide acetate (MEDI0382 acetate) is a potent peptide dual agonist of glucagon-like peptide-1 (GLP-1) and glucagon receptor with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate (MEDI0382 acetate) exhibits ability to facilitate both weight loss and glycaemic control, has the potential for obesity and type 2 diabetes (T2D) treatment.
  • HY-69220
    7-Octynoic acid

    PROTAC Linker Cancer
    7-Octynoic acid (compound 42) is a PROTAC linker and can be used in the synthesis of a series of PROTACs. PROTACs contain two different ligands connected by a linker; one is a ligand for an E3 ubiquitin ligase and the other is for the target protein. PROTACs exploit the intracellular ubiquitin-proteasome system to selectively degrade target proteins.
  • HY-104021
    GSK840

    GSK'840

    RIP kinase Inflammation/Immunology
    GSK840 (GSK'840) is a receptor-interacting protein kinase 3 (RIP3 or RIPK3) inhibitor, which binds RIP3 kinase domain with an IC50 of 0.9 nM, and inhibits kinase activity with an IC50 of 0.3 nM.
  • HY-12429
    Beclabuvir

    BMS-791325

    HCV Infection
    Beclabuvir is an allosteric inhibitor that binds to thumb site 1 of the hepatitis C virus (HCV) NS5B RNA-dependent RNA polymerase, and inhibits recombinant NS5B proteins from HCV genotypes 1, 3, 4, and 5 with IC50 of < 28 nM. 
  • HY-P0276
    GIP, human

    Gastric Inhibitory Peptide (GIP), human

    Insulin Receptor Metabolic Disease
    GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
  • HY-126457
    Thalidomide-propargyl

    Ligand for E3 Ligase Cancer
    Thalidomide-propargyl is the Thalidomide-based Cereblon ligand used in the recruitment of CRBN protein. Thalidomide-propargyl can be connected to the ligand for protein by a linker to form the IMiD containing PROTACs.
  • HY-114164
    Thrombin

    Thrombin Neurological Disease
    Thrombin is a trypsin-like allosteric serine protease. Thrombin enables site-specific cleavage of fusion proteins with an accessible Thrombin recognition sequence and can be used to digest GST-tagged proteins.
  • HY-123979A
    ζ-Stat trisodium

    NSC37044 trisodium

    PKC Apoptosis Cancer
    ζ-Stat trisodium (NSC37044 trisodium) is a specific and atypical PKC-ζ inhibitor, with an IC50 of 5 μM. ζ-Stat trisodium can reduce melanoma cell lines proliferation and induce apoptosis, and has antitumor activity in vitro.
  • HY-138562
    HIV-1 Nef-IN-1

    HIV Infection
    HIV-1 Nef-IN-1 is an HIV-1 Nef protein inhibitor that efficiently competes for Nef-SH3Hck interactions with a Kd of 6.7 μM.
  • HY-135127
    Dot1L-IN-4

    Histone Methyltransferase Cancer
    Dot1L-IN-4 is a potent disruptor of telomeric silencing 1-like protein (DOT1L) inhibitor with an IC50 SPA DOT1L of 0.11 nM.
  • HY-138283
    MR837

    Histone Methyltransferase Cancer
    MR837 is an inhibitor of NSD2-PWWP1. MR837 can bind with human nuclear receptor binding SET domain protein 2 (PWWP domain).
  • HY-14175
    Begacestat

    GSI-953

    γ-secretase Neurological Disease
    Begacestat (GSI-953) is a selective thiophene sulfonamide inhibitor of amyloid precursor protein gamma-secretase (IC5040=15 nM) for the treatment of Alzheimer's disease.
  • HY-B0751
    Fumagillin

    Amebacilin; NSC9168

    Parasite HIV Antibiotic Infection
    Fumagillin(NSC9168) is a complex biomolecule and used as an antimicrobial agent. Fumagillin can inhibits HIV‐1 infection through the inhibition of HIV-1 viral protein R (Vpr) activity.
  • HY-N0374
    Licochalcone C

    Glucosidase Metabolic Disease
    Licochalcone C could inhibit α-glucosidase, with IC50s of <100 nM and 92.43 μM for α-glucosidase and protein tyrosine phosphatase 1B (PTP1B), respectively.
  • HY-100716
    IPI549

    PI3K Cancer
    IPI549 is a potent and selective PI3Kγ inhibitor with an IC50 of 16 nM. IPI549 shows >100-fold selectivity over other lipid and protein kinases.
  • HY-124512
    Quercetin pentaacetate

    Pentaacetylquercetin

    RSV Infection Inflammation/Immunology
    Quercetin pentaacetate could interact with F-protein with lower binding energy and better stability to block viral adhesion. Quercetin pentaacetate interacts with RSV and inhibit the viral adhesion on cell surface.
  • HY-129035
    Vanin-1-IN-1

    Others Metabolic Disease Inflammation/Immunology
    Vanin-1-IN-1 is an inhibitor of vanin-1 enzyme which is a cell surface associated, giycosyiphosphatidyS inositol (GPi) anchored protein and plays an important role in metabolism and inflammation.
  • HY-W008235
    Fmoc-N-Me-Ala-OH

    Others Others
    Fmoc-N-Me-Ala-OH, an N-Fmoc-N-methyl amino acid, is available for the peptide-coupling reaction.
  • HY-17566
    Capreomycin sulfate

    Bacterial Antibiotic Infection
    Capreomycin sulfate is a peptide antibiotic, commonly grouped with the aminoglycosides, which is given in combination with other antibiotics for MDR-tuberculosis.
  • HY-129360
    Ala-Ala-Asn-PAB

    ADC Linker Cancer
    Ala-Ala-Asn-PAB is a peptide cleavable ADC linker for antibody-drug conjugates (ADCs).
  • HY-W008558
    Fmoc-N-Me-Leu-OH

    Others Others
    Fmoc-N-Me-Leu-OH, an N-Fmoc-N-methyl amino acid, is available for the peptide-coupling reaction.
  • HY-W010983
    SC-236

    COX PPAR Apoptosis Cancer Inflammation/Immunology Cardiovascular Disease
    SC-236 is an orally active COX-2 specific inhibitor (IC50 = 10 nM) and a PPARγ agonist. SC-236 suppresses activator protein-1 (AP-1) through c-Jun NH2-terminal kinase. SC-236 exerts anti-inflammatory effects by suppressing phosphorylation of ERK in a murine model.
  • HY-18990
    GSK180736A

    ROCK Cardiovascular Disease
    GSK180736A is potent Rho-associated coiled-coil kinase 1 (ROCK1) inhibitor with an IC50 of 100 nM. GSK180736A is also a selective and ATP-competitive G protein-coupled receptor kinase 2 (GRK2) inhibitor with an IC50 of 0.77 μM.
  • HY-125402
    GSK-843

    GSK'843

    RIP kinase Inflammation/Immunology
    GSK-843 (GSK'843) is a receptor-interacting protein kinase 3 (RIP3 or RIPK3) inhibitor, which binds RIP3 kinase domain with an IC50 of 8.6 nM, and inhibits kinase activity with an IC50 of 6.5 nM.
  • HY-P0248
    Kemptide

    PKA Metabolic Disease
    Kemptide is a synthetic heptapeptide that acts as a specific substrate for cAMP-dependent protein kinase (PKA).
  • HY-P0263A
    Dermaseptin TFA

    Bacterial Fungal Infection
    Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration.
  • HY-P1388
    β-Amyloid (1-42), rat

    Amyloid β-peptide (1-42) (rat)

    Amyloid-β Neurological Disease
    β-Amyloid (1-42), rat is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
  • HY-P1462
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat

    CGRP Receptor Neurological Disease
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor (CRLR).
  • HY-122653
    CCT367766

    PROTAC Cancer
    CCT367766 is a potent and the third generation heterobifunctional and PROTAC-based pirin targeting protein degradation probe (PDP), depletes pirin protein expression at low concentration. CCT367766 exhibits a moderate affinity for the CRBN-DDB1 complex with an IC50 value of 490 nM. CCT367766 reveals a good affinity for the recombinant pirin and CRBN with Kd values of 55 nM and 120 nM, respectively. CCT367766 provides a potential chemical tool to study a largely unexplored protein.
  • HY-120548
    KBU2046

    Others Cancer
    KBU2046 is an oral, highly selective inhibitor of cell motility and cell invasion in vitro. KBU2046 binds chaperone heterocomplexes, selectively alters binding of client proteins that regulate motility, and lacks all of the hallmarks of classical HSP90 inhibitors. KBU2046 inhibits cancer metastasis and prolongs life.
  • HY-101920
    Autophinib

    Autophagy Cancer Neurological Disease
    Autophinib is a potent, selective autophagy inhibitor with IC50s of 90 nM and 40 nM for starvation- and Rapamycin-induced autophagy, respectively. Autophinib is also an ATP competitive Vacuolar Protein Sorting 34 (VPS34) inhibitor with an IC50 of 19 nM. Autophinib inhibits autophagy induced by starvation or Rapamycin by targeting VPS34.
  • HY-108317
    ABL127

    Others Cancer
    ABL127 is a selective and covalent inhibitor of protein methylesterase 1 (PME-1) with IC50s of 6.4 nM and 4.2 nM in HEK293T and MDA-MB-231 cells, respectively.
  • HY-101354
    R-IMPP

    PF-00932239

    Ser/Thr Protease Cancer Cardiovascular Disease
    R-IMPP (PF-00932239) is an anti-secretagogue of PCSK9 (IC50=4.8 μM), which targets the 80S ribosome to inhibit PCSK9 protein translation.
  • HY-111861
    SNIPER(ABL)-024

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-024, conjugating GNF5 (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 5μM.
  • HY-10299
    GSK-923295

    Kinesin Apoptosis Cancer
    GSK-923295 is a special, allosteric inhibitor of centromere-associated protein-E (CENP-E) kinesin motor ATPase activity, with Ki of 3.2±0.2 nM and 1.6± 0.1 nM for human and canine, respectively.
  • HY-N2419
    Erythrodiol

    Endogenous Metabolite Metabolic Disease
    Erythrodiol is an olive oil component. Erythrodiol promotes Cholesterol efflux (ChE) by selectively inhibiting the degradation of ABCA1 protein. Erythrodiol is a good candidate to be further explored for therapeutic or preventive application in the context of atherosclerosis.
  • HY-107777
    LLY-283

    Histone Methyltransferase Cancer
    LLY-283 is a potent, selective and oral protein arginine methyltransferase 5 (PRMT5) inhibitor, with an IC50 of 22 nM and a Kd of 6 nM for PRMT5:MEP50 complex, and shows antitumor activity.
  • HY-13997
    Ombitasvir

    ABT-267

    HCV Infection
    Ombitasvir is a potent inhibitor of the hepatitis C virus protein NS5A, with EC50s of 0.82 to 19.3 pM against HCV genotypes 1 to 5, and 366 pM against genotype 6a.
  • HY-15789
    Elbasvir

    MK-8742

    HCV Infection
    Elbasvir (MK-8742) is a hepatitis C virus nonstructural protein 5A (HCV NS5A) inhibitor with EC50s of 4, 3 and 3 nM against genotype 1a, 1b, and 2a, respectively.
  • HY-135682
    Nitrosobiotin

    Others Others
    Nitrosobiotin is prepared from biotin.
  • HY-109187A
    Posenacaftor sodium

    PTI-801 sodium

    CFTR Inflammation/Immunology
    Posenacaftor (PTI-801) sodium is a cystic fibrosis transmembrane regulator (CFTR) protein modulator that corrects the folding and trafficking of CFTR protein. Posenacaftor sodium is used for the research of cystic fibrosis (CF).
  • HY-111945
    Cys modifier 1

    Others Others
    Cys modifier 1 (compound 7) is a cysteine-selective protein modifier for protein bioconjugation. A fluorescent carbonylacrylic derivative bearing nitrobenzofurazan (λex=465nm and λem539 nm)[1].
  • HY-P2039
    Retrobradykinin

    Bradykinin Receptor Endogenous Metabolite Endocrinology Cardiovascular Disease
    Retrobradykinin has the reverse sequence of Bradykinin (HY-P0206). Retrobradykinin exhibits no kinin activity and can be used as a negative control for Bradykinin.
  • HY-B0780
    Fimasartan

    BR-A-657

    Angiotensin Receptor Apoptosis Cardiovascular Disease Endocrinology
    Fimasartan(BR-A-657) is a non-peptide angiotensin II receptor antagonist used for the treatment of hypertension and heart failure.
  • HY-W007970
    H-Phe-Phe-OH

    Endogenous Metabolite Neurological Disease
    H-Phe-Phe-OH is a peptide made of two phenylalanine molecules; Phenylalanine is an essential amino acid and the precursor for the amino acid tyrosine.
  • HY-114267
    Cbz-B3A

    mTOR Others
    Cbz-B3A is a potent and selective inhibitor of mTORC1 signaling that appear to bind to ubiquilins 1, 2, and 4, and Cbz-B3A inhibits the phosphorylation of eIF4E-binding protein 1 (4EBP1).
  • HY-13671
    LW6

    HIF-1α inhibitor; LW8

    HIF/HIF Prolyl-Hydroxylase Apoptosis Cancer
    LW6 (HIF-1α inhibitor) is a novel HIF-1 inhibitor with an IC50 of 4.4 μM. LW6 decreases HIF-1α protein expression without affecting HIF-1β expression.
  • HY-W011121
    2-Oleoylglycerol

    GPR119 Metabolic Disease
    2-Oleoylglycerol is a dietary naturally occurring lipid. 2-Oleoylglycerol is a GPR119 agonist, with an EC50 of 2.5 μM for human GPR119 in transiently transfected COS-7 cells. 2-Oleoylglycerol stimulates glucagon-like peptide-1 (GLP-1) secretion in vivo.
  • HY-129657
    GLP-1 receptor agonist 4

    Glucagon Receptor Metabolic Disease
    GLP-1 receptor agonist 4 is a glucagon-like peptide-1 receptor (GLP-1R) agonist extracted from patent WO2009111700A2, compound 87, has an EC50 of 64.5 nM. GLP-1 receptor agonist 4 can be used in the research for treatment of diabetes.
  • HY-N5011
    5,7-Dimethoxyflavone

    Cytochrome P450 Cancer Inflammation/Immunology
    5,7-Dimethoxyflavone is one of the major components of Kaempferia parviflora, has anti-obesity, anti-inflammatory, and antineoplastic effects. 5,7-Dimethoxyflavone inhibits cytochrome P450 (CYP) 3As. 5,7-Dimethoxyflavone is also a potent Breast Cancer Resistance Protein (BCRP) inhibitor.
  • HY-103710
    IBR2

    RAD51 Apoptosis Cancer
    IBR2 is a potent and specific RAD51 inhibitor and inhibits RAD51-mediated DNA double-strand break repair. IBR2 disrupts RAD51 multimerization, accelerates proteasome-mediated RAD51 protein degradation, inhibits cancer cell growth and induces apoptosis.
  • HY-B1099
    Hycanthone

    DNA/RNA Synthesis Topoisomerase Parasite Infection
    Hycanthone is a thioxanthenone DNA intercalator and inhibits RNA synthesis as well as the DNA topoisomerases I and II. Hycanthone inhibits nucleic acid biosynthesis and inhibits apurinic endonuclease-1 (APE1) by direct protein binding with a KD of 10 nM. Hycanthone is a bioactive metabolite of Lucanthone (HY-B2098) and has anti-schistosomal agent.
  • HY-P1567
    β-Amyloid (10-35), amide

    Amyloid-β Neurological Disease
    β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
  • HY-P1170
    N-terminally acetylated Leu-enkephalin

    Ac-L-Tyr-Gly-Gly-L-Phe-D-Leu-COOH

    Opioid Receptor Neurological Disease
    N-terminally acetylated Leu-enkephalin is the N-terminally acetylated form of Leu-enkephalin. Leu-enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.
  • HY-P1308
    SLIGRL-NH2

    Protease-Activated Receptor-2 Activating Peptide

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    SLIGRL-NH2 (Protease-Activated Receptor-2 Activating Peptide) is an agonist of Protease-Activated Receptor-2 (PAR-2).
  • HY-P1462A
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA

    CGRP Receptor Neurological Disease
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat (TFA) is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor (CRLR).
  • HY-P0283
    Protease-Activated Receptor-2, amide

    Protease-Activated Receptor (PAR) Cancer
    Protease-Activated Receptor-2, amide (SLIGKV-NH2) is a highly potent protease-activated receptor-2 (PAR2) activating peptide.
  • HY-P1388A
    β-Amyloid (1-42), rat TFA

    Amyloid β-peptide (1-42) (rat) TFA

    Amyloid-β Neurological Disease
    β-Amyloid (1-42), rat TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
  • HY-P1854
    β-Amyloid (1-9)

    Amyloid-β Neurological Disease
    β-Amyloid (1-9), an N-terminal fragment of beta amyloid, consists of amino acid residues 1 to 9. β-Amyloid (1-9) contains a B cell epitope, but it does not include T cell epitopes. Omission of residues 1 to 9 from the full-length Alzheimer'sβ-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism .
  • HY-133028
    CKI-7 free base

    Casein Kinase CDK SGK Ribosomal S6 Kinase (RSK) Cancer
    CKI-7 free base is a potent and ATP-competitive casein kinase 1 (CK1) inhibitor with an IC50 of 6 μM and a Ki of 8.5 μM. CKI-7 free base is a selective Cdc7 kinase inhibitor. CKI-7 free base also inhibits SGK, ribosomal S6 kinase-1 (S6K1) and mitogen- and stress-activated protein kinase-1 (MSK1). CKI-7 free base has a much weaker effect on casein kinase II and other protein kinases.
  • HY-P1036A
    Compstatin TFA

    Complement System Others
    Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively.
  • HY-122866
    ZT-12-037-01

    Ras Cancer
    ZT-12-037-01 is a STK19-targeted inhibitor, has a high-affinity interaction with STK19 protein and inhibits oncogenic NRAS-driven melanocyte malignant transformation. ZT-12-037-01 is an ATP-competitive inhibitor, inhibiting phosphorylation of NRAS (major isoform of Ras family) with an IC50 of 24 nM.
  • HY-P1189
    Echistatin

    Integrin Metabolic Disease Inflammation/Immunology
    Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1.
  • HY-Y0781
    Pyruvic acid

    Acetylformic acid

    Endogenous Metabolite Others
    Pyruvic acid is an intermediate metabolite in the metabolism of carbohydrates, proteins, and fats.
  • HY-113079
    Argininic acid

    Endogenous Metabolite Metabolic Disease
    Argininic acid is an α-amino acid that is used in the biosynthesis of proteins.
  • HY-N1481
    Methyl linoleate

    Others Metabolic Disease
    Methyl linoleate, a major active constituent of Sageretia thea fruit (HFSF), is a major anti-melanogenic compound. Methyl linoleate downregulates microphthalmia-associated transcription factor (MITF) and tyrosinase-related proteins.
  • HY-13407
    Gossypol

    BL 193

    Bcl-2 Family Cancer
    Gossypol, a natural product isolated from cottonseeds and roots, binds to Bcl-xL protein and Bcl-2 protein with Kis of 0.5-0.6 μM and 0.2-0.3 mM, respectively.
  • HY-14136
    Rimonabant

    SR141716

    Cannabinoid Receptor Bacterial Infection Metabolic Disease Cancer
    Rimonabant (SR141716) is a highly potent, brain penetrated and selective central cannabinoid receptor (CB1) antagonist with a Ki of 1.8 nM. Rimonabant (SR141716) also inhibits Mycobacterial membrane protein Large 3 (MMPL3).
  • HY-12530
    Velpatasvir

    GS-5816

    HCV Cancer
    Velpatasvir (VEL, GS-5816) is a novel pan-genotypic hepatitis C virus (HCV) nonstructural protein 5A (NS5A) inhibitor with activity against genotype 1 (GT1) to GT6 HCV replicons.
  • HY-138142
    Euphol acetate

    Others Metabolic Disease
    Euphol acetate is a triterpene that can be isolated from Euphorbia broteri. Euphol acetate is an inhibitor of hepatic transport proteins organic anion-transporting polypeptide 1/3 (OATP1B1/3).
  • HY-111879
    Biotin-BS

    SNIPER Cancer
    Biotin-BS contains two different ligands, methyl-bestatin (MeBS) for cIAP1 and biotin, which are connected by linkers. MeBS as a ligand for cellular inhibitor of apoptosis protein 1 (cIAP1) ubiquitin ligase.
  • HY-14137
    Rimonabant Hydrochloride

    SR 141716A Hydrochloride

    Cannabinoid Receptor Bacterial Cancer Infection Metabolic Disease
    Rimonabant hHydrochloride (SR 141716A Hydrochloride) is a highly potent and selective central cannabinoid receptor (CB1) antagonist with an Ki of 1.8 nM. Rimonabant hHydrochloride (SR 141716A Hydrochloride) also inhibits Mycobacterial membrane protein Large 3 (MMPL3).
  • HY-134598A
    653-47 hydrochloride

    Epigenetic Reader Domain Cancer
    653-47 hydrochloride, a potentiator, significantly potentiates the cAMP-response element binding protein (CREB) inhibitory activity of 666-15. 653-47 hydrochloride is also a very weak CREB inhibitor with IC50 of 26.3 μM.
  • HY-19537
    NI-57

    Epigenetic Reader Domain Cancer Inflammation/Immunology
    NI-57 is an inhibitor of bromodomain and plant homeodomain finger-containing (BRPF) famlily of proteins, with IC50s of 3.1, 46 and 140 nM for BRPF1, BRPF2 (BRD1) and BRPF3, respectively.
  • HY-134598
    653-47

    Epigenetic Reader Domain Cancer
    653-47, a potentiator, significantly potentiates the cAMP-response element binding protein (CREB) inhibitory activity of 666-15. 653-47 is also a very weak CREB inhibitor with IC50 of 26.3 μM.
  • HY-100779
    Rimacalib

    SMP 114

    CaMK Autophagy Metabolic Disease
    Rimacalib (SMP 114) is a Ca 2+/calmodulin-dependent protein kinase II (CaMKII) inhibitor, with IC50s of ~1 μM for CaMKIIα to ~30 μM for CaMKIIγ.
  • HY-13960
    GSK1324726A

    I-BET726

    Epigenetic Reader Domain Apoptosis Cancer
    GSK1324726A is a novel, potent, and selective inhibitor of BET proteins with high affinity to BRD2 (IC50=41 nM), BRD3 (IC50=31 nM), and BRD4 (IC50=22 nM).
  • HY-19825
    Rebeccamycin

    Topoisomerase ADC Cytotoxin Cancer
    Rebeccamycin, an antitumor antibiotic, inhibits DNA topoisomerase I. Rebeccamycin appears to exert its primary antineoplastic effect by poisoning topoisomerase I and has negligible effect on protein kinase C and topoisomerase II.
  • HY-B1156
    Cephradine

    Cefradine; SQ-11436

    Bacterial TOPK Antibiotic Infection
    Cephradine (Cefradine) is the first-generation broad-spectrum cephalosporin antibiotic, which also acts as an inhibitor of TOPK (T-LAK cell-originated protein kinase) and suppresses skin inflammation induced by excessive solar ultraviolet.
  • HY-102080
    SAFit2

    FKBP Cancer
    SAFit2 is a highly potent, highly selective FK506-binding protein 51 (FKBP51) inhibitor with a Ki of 6 nM and also enhances AKT2-AS160 binding.
  • HY-108709
    CC-671

    CDK Cancer
    CC-671 is a dual TTK protein kinase/CDC2-like kinase (CLK2) inhibitor with IC50s of 0.005 and 0.006 μM for TTK and CLK2, respectively.
  • HY-123823
    Nitroaspirin

    NCX 4016

    COX Apoptosis Cancer
    Nitroaspirin (NCX 4016) is a nitric oxide (NO) donor and a nitro-derivative of Aspirin, which combines with Nitroaspirin to inhibit cyclooxygenase. Nitroaspirin (NCX 4016) has antithrombotic and anti-platelet properties and acts as a direct and irreversible inhibitor of COX-1. Nitroaspirin (NCX 4016) causes significant induction of cell cycle arrest and apoptosis in Cisplatin-resistant human ovarian cancer cells via down-regulation of EGFR/PI3K/STAT3 signaling and modulation of Bcl-2 family proteins.
  • HY-B0958
    Mupirocin

    BRL-4910A; Pseudomonic acid

    Bacterial Antibiotic Infection
    Mupirocin (BRL-4910A) is an orally active antibiotic isolated from Pseudomonas fluorescens. Mupirocin (BRL-4910A) apparently exerts its antimicrobial activity by reversibly inhibiting isoleucyl-transfer RNA, thereby inhibiting bacterial protein and RNA synthesis.
  • HY-17406
    Tolcapone

    Ro 40-7592

    COMT Amyloid-β Neurological Disease
    Tolcapone (Ro 40-7592) is a selective, potent and orally active COMT inhibitor. Tolcapone is also a potent inhibitor of α-syn and Aβ42 oligomerization and fibrillogenesis and protect against extracellular toxicity induced by the aggregation of both proteins in PC12 cells.
  • HY-14435
    Pyridone 6

    JAK Cancer
    Pyridone 6 is a pan-JAK inhibitor, which potently inhibits the JAK kinase family, with IC50s of 1 nM for JAK2 and TYK2, 5 nM for JAK3, and 15 nM for JAK1, while displaying significantly weaker affinities (130 nM to >10 mM) for other protein tyrosine kinases.
  • HY-19615B
    MS023 dihydrochloride

    Histone Methyltransferase Cancer
    MS023 dihydrochloride is a potent, selective, and cell-active inhibitor of human type I protein arginine methyltransferases (PRMTs) inhibitor, with IC50s of 30, 119, 83, 4 and 5 nM for PRMT1, PRMT3, PRMT4, PRMT6, and PRMT8, respectively.
  • HY-19615
    MS023

    Histone Methyltransferase Cancer
    MS023 is a potent, selective, and cell-active inhibitor of human type I protein arginine methyltransferases (PRMTs) inhibitor, with IC50s of 30, 119, 83, 4 and 5 nM for PRMT1, PRMT3, PRMT4, PRMT6, and PRMT8, respectively.
  • HY-122571
    Retro-2

    Filovirus Parasite Autophagy Cancer Infection
    Retro-2 is a selective inhibitor of retrograde protein trafficking at the endosome-trans-Golgi network interface. Retro-2 is an ebolavirus (EBOV) infection inhibitor with an EC50 of 12.2 µM in HeLa cells. Retro-2 induces cell autophagy.
  • HY-125834
    GMB-475

    PROTAC Bcr-Abl Apoptosis Cancer
    GMB-475 is a degrader of BCR-ABL1 tyrosine kinase based on PROTAC, overcoming BCR-ABL1-dependent drug resistance. GMB-475 targets BCR-ABL1 protein and recruits the E3 ligase Von Hippel Lindau (VHL), resulting in ubiquitination and subsequent degradation of the oncogenic fusion protein.
  • HY-109172
    Ezeprogind

    AZP-2006

    Amyloid-β Neurological Disease
    Ezeprogind (AZP-2006) is an orally active neurotrophic inducer. Ezeprogind targets all causes of neurodegeneration and is not only aiming at markers such as Abeta protein or tau protein. Ezeprogind is a potent neuroprotectant and can be used for the research of neurological disorders, including progressive supranuclear palsy (PSP), tauopathies, alzheimer’s and parkinson’s diseases, et al.
  • HY-P1592
    G3-C12

    Galectin Cancer
    G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
  • HY-106268A
    Larazotide acetate

    Gap Junction Protein Inflammation/Immunology
    Larazotide acetate is a synthetic peptide. Larazotide acetate acts as a tight junction regulator and reverses leaky junctions to their normally closed state.
  • HY-P1097
    Gastrin I, human

    Cholecystokinin Receptor Endocrinology
    Gastrin I, human is the endogenous peptide produced in the stomach, and increases gastric acid secretion via cholecystokinin 2 (CCK2) receptor.
  • HY-10235
    Telaprevir

    VX-950

    HCV Protease HCV Infection
    Telaprevir (VX-950) is a highly selective, reversible, and potent peptidomimetic inhibitor of the HCV NS3-4A protease, the steady-state inhibitory constant (Ki) of Telaprevir is 7 nM against a genotype 1 (H strain) NS3 protease domain plus a NS4A cofactor peptide.
  • HY-P0324A
    Parasin I TFA

    Bacterial Infection
    Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
  • HY-P2323
    Lactoferricin B (4-14), bovine TFA

    Bacterial Antibiotic Cancer Inflammation/Immunology
    Lactoferricin B (4-14), bovine (TFA), a peptide corresponding to residues 4-14 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms.
  • HY-P1043A
    NGR peptide Trifluoroacetate

    Aminopeptidase Cancer
    NGR peptide Trifluoroacetate containing the asparagine-glycine-arginine (NGR) motif is recognized by CD13/aminopeptidase N (APN) receptor isoforms that are selectively overexpressed in tumor neovasculature.
  • HY-P1742
    Gluten Exorphin B5

    Opioid Receptor Metabolic Disease
    Gluten Exorphin B5 is an exogenous opioid peptides derived from wheat gluten, acts on opioid receptor, increases postprandial plasma insulin level in rats.
  • HY-P0288
    [Leu5]-Enkephalin

    Leu-enkephalin; Leucine enkephalin; Leucyl-enkephalin

    Opioid Receptor Endogenous Metabolite Neurological Disease
    [Leu5]-Enkephalin is a pentapeptide with morphine like properties. [Leu5]-Enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.
  • HY-108896
    Icatibant acetate

    HOE 140 acetate

    Bradykinin Receptor Inflammation/Immunology
    Icatibant acetate (HOE-140 acetate) is a potent and specific peptide antagonist of bradykinin B2 receptor with an IC50 and Ki of 1.07 nM and 0.798 nM respectively.
  • HY-126437A
    Poly-L-lysine hydrochloride

    Bacterial Infection Inflammation/Immunology
    Poly-L-lysine hydrochloride is a nonspecific attachment factor for cells useful in promoting cell adhesion to solid substrates by enhancing electrostatic interaction between negatively charged ions of the cell membrane and the culture surface. Poly-L-lysine is a strong-attraction regulator that promotes liquid-liquid phase separation (LLPS) at low concentrations but suppresses LLPS at high concentrations. Antibacterial cationic peptide..
  • HY-P1141
    GLP-1(9-36)amide

    Glucagon Receptor Metabolic Disease
    GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor.
  • HY-N6062
    Perivine

    Perivin

    Others Neurological Disease
    Perivine (Perivin) targets protein retinoblastoma-associated proteins (RbAp48) and resolves the instability of the RbAp48-FOG-1 complex. Perivine can be used for the study of Alzheimer's disease.
  • HY-23095
    Thalidomide-5-OH

    Ligand for E3 Ligase Cancer
    Thalidomide-5-OH is the Thalidomide-based cereblon ligand used in the recruitment of CRBN protein. Thalidomide-5-OH can be connected to the ligand for protein by a linker to form PROTACs.
  • HY-101213
    OSW-1

    Others Cancer
    OSW-1, isolated from Ornithogalum caudatum, is a specific antagonist of osterol-binding protein (OSBP) and OSBP-related protein 4 (ORP4) with GI50s in the nanomolar range in human cancer lines.
  • HY-19676
    Pralnacasan

    VX-740; HMR 3480

    Caspase Inflammation/Immunology
    Pralnacasan (VX-740) is a potent, selective, non-peptide and orally active interleukin-1β converting enzyme (ICE, caspase 1) inhibitor with a Ki of 1.4 nM. Pralnacasan inhibits proinflammatory cytokines IL-18, IL-1β , and IFN-γ. Pralnacasan has the potential for osteoarthritis and rheumatoid arthritis treatment.
  • HY-B0510
    Trimethoprim

    Antifolate Bacterial Antibiotic Infection
    Trimethoprim is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim has the potential for urinary tract infections, Shigellosis and Pneumocystis pneumonia treatment.
  • HY-120323
    DRI-C21045

    TNF Receptor Inflammation/Immunology
    DRI-C21045 (compound 10) is a potent and selective inhibitor of the CD40-CD40L costimulatory protein-protein interaction (PPI) with an IC50 of 0.17 µM. DRI-C21045 shows concentration-dependent inhibition of the activation of NF-κB and B cell proliferation all induced by CD40L with IC50s of 17.1 µM and 4.5 µM, respectively.
  • HY-101180
    C2 Ceramide

    Ceramide 2

    Phosphatase Mitochondrial Metabolism Apoptosis Endocrinology Metabolic Disease
    C2 Ceramide (Ceramide 2) is the main lipid of the stratum corneum and a protein phosphatase 1 (PP1) activator. C2 Ceramide activates PP2A and ceramide-activated protein phosphatase (CAPP). C2 Ceramide induces cells differentiation and apoptosis, inhibits mitochondrial respiratory chain complex III. C2 Ceramide is also a skin conditioning agent that protects the epidermal barrier from water loss.
  • HY-124828
    CMLD-2

    Apoptosis Cancer
    CMLD-2, an inhibitor of HuR-ARE interaction, competitively binds HuR protein disrupting its interaction with adenine-uridine rich elements (ARE)-containing mRNAs (Ki=350 nM). CMLD-2 induces apoptosis exhibits antitumor activity in different cancer cells as colon, pancreatic, thyroid and lung cancer cell lines. Hu antigen R (HuR) is an RNA binding protein, can regulate target mRNAs stability and translation.
  • HY-P0265
    β-Amyloid (1-40)

    Amyloid-β Neurological Disease
    β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
  • HY-129241
    AGX51

    Others Cancer
    AGX51 is a first-in-class pan-Id (inhibitors of DNA-binding/differentiation proteins) antagonist and degrader. AGX51 inhibits the Id1-E47 interaction, leading to ubiquitin-mediated degradation of Ids, cell growth arrest, and reduces viability. AGX51 inhibits pathologic ocular neovascularization.
  • HY-135859
    NH2-MPAA-NODA

    Others Cancer
    NH2-MPAA-NODA is a nitroveratryl-based photocleavable linker, it has a NODA motif and a methyl phenyl acetic acid (MPAA) backbone. NH2-MPAA-NODA can be used as a radiolabel by labeling with 18F-fluoride.
  • HY-136179
    ZAP-180013

    Tyrosinase Inflammation/Immunology
    ZAP-180013 is a zeta-chain-associated protein kinase 70 (ZAP-70) inhibitor with an IC50 of 1.8 μM. ZAP-180013 inhibits the interaction of ZAP-70 SH2 domain with immunoreceptor tyrosine-based activation motif (ITAMs).
  • HY-12219A
    MSI-1436 lactate

    Trodusquemine lactate; Aminosterol-1436 lactate

    Phosphatase Endocrinology
    MSI-1436 lactate is a selective, non-competitive inhibitor of the enzyme protein-tyrosine phosphatase 1B (PTB1B), with an IC50 of 1 μM, 200-fold preference over TCPTP (IC50 of 224 μM).
  • HY-N1963
    Curzerene

    Gutathione S-transferase Apoptosis Cancer
    Curzerene is a sesquiterpene is isolated from the rhizome of Curculigo orchioides Gaertn with anti-cancer activity. Curzerene inhibits glutathione S-transferase A1 (GSTA1) mRNA and protein expression. Curzerene induces cell apoptosis.
  • HY-114712
    SJ572403

    SJ403

    Others Cancer
    SJ572403 (SJ403) is an inhibitor of disordered protein p27(Kip1). p27(Kip1) is a regulator of the CDKs that control eukaryotic cell division.
  • HY-111863
    SNIPER(ABL)-047

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-047, conjugating HG-7-85-01 (ABL inhibitor) to MV-1 (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 2 μM.
  • HY-N6258
    Kahweol

    AMPK Apoptosis Metabolic Disease
    Kahweol is one of the consituents of the coffee from Coffea Arabica with anti-inflammatory anti-angiogenic, and anti-cancerous activities. Kahweol inhibits adipogenesis and increase glucose uptake by AMP-activated protein kinase (AMPK) activation. Kahweol induces apoptosis.
  • HY-128978
    PTP1B-IN-8

    Phosphatase Metabolic Disease
    PTP1B-IN-8 is a potent and selective potent protein tyrosine phosphatase-1B (PTP1B) inhibitor extracted from patent CN103626692A, example 1.
  • HY-N4108
    Hypophyllanthin

    P-glycoprotein Cancer Inflammation/Immunology
    Hypophyllanthin is a major lignan in Phyllanthus spp, with strong anti-inflammatory activity. Hypophyllanthin directly inhibits P-glycoprotein (P-gp) activity and did not interfere with multidrug resistance protein 2 (MRP2) activity.
  • HY-101564
    JNJ-64619178

    Histone Methyltransferase Cancer
    JNJ-64619178 is a selective, orally active and pseudo-irreversible protein arginine methyltransferase 5 (PRMT5) inhibitor with an IC50 of 0.14 nM. JNJ-64619178 has potent activity In lung cancer.
  • HY-15662
    Tulathromycin A

    Tulathromycin; CP 472295

    Antibiotic Bacterial Infection
    Tulathromycin A (Tulathromycin), a macrolide antibiotic, inhibits protein synthesis (IC50=0.26 µM) by targeting bacterial ribosome. Tulathromycin A is used for the research of respiratory disease in cattle and swine. Immunomodulatory effects.
  • HY-12219
    MSI-1436

    Trodusquemine; Aminosterol-1436

    Phosphatase Endocrinology
    MSI-1436 is a selective, non-competitive inhibitor of the enzyme protein-tyrosine phosphatase 1B (PTB1B), with an IC50 of appr 1 μM, 200-fold preference over TCPTP (IC50, 224 μM).
  • HY-112730
    PEO-IAA

    2-(1H-Indol-3-yl)-4-oxo-4-phenyl-butyric acid

    Others Others
    PEO-IAA is an indole-3-acetic acid (IAA) antagonist. PEO-IAA is an auxin antagonist that binds to transport inhibitor response 1/auxin signaling F-box proteins (TIR1/AFBs).
  • HY-15880
    CCT007093

    Phosphatase Apoptosis Autophagy Cancer
    CCT007093 is an effective protein phosphatase 1D (PPM1D Wip1) inhibitor. Wip1 inhibition can activate the mTORC1 pathway and enhance hepatocyte proliferation after hepatectomy.
  • HY-101032
    RIPA-56

    RIP kinase Inflammation/Immunology
    RIPA-56 is a highly potent, selective, and metabolically stable inhibitor of receptor-interacting protein 1 (RIP1) with an IC50 of 13 nM. RIPA-56 can be used for the treatment of systemic inflammatory response syndrome.
  • HY-B2145
    Ilaprazole sodium

    IY-81149 sodium

    Proton Pump TOPK Cancer Inflammation/Immunology
    Ilaprazole (IY-81149) sodium is an orally active proton pump inhibitor. Ilaprazole sodium irreversibly inhibits H +/K +-ATPase in a dose-dependent manner with an IC50 of 6 μM in rabbit parietal cell preparation. Ilaprazole sodium is used for the research of gastric ulcers. Ilaprazole sodium is also a potent TOPK (T-lymphokine-activated killer cell-originated protein kinase) inhibitor.
  • HY-12831
    Ampkinone

    AMPK Metabolic Disease
    Ampkinone is an indirect AMP-activated protein kinase (AMPK) activator.
  • HY-111431A
    p-Methylphenyl potassium sulfate

    Others Metabolic Disease
    p-Methylphenyl potassium sulfate is a prototype protein-bound uremic toxin.
  • HY-P1189A
    Echistatin TFA

    Integrin Metabolic Disease Inflammation/Immunology
    Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1.
  • HY-131081
    γ-Amanitin

    DNA/RNA Synthesis ADC Cytotoxin Cancer
    γ-Amanitin an ADC cytotoxin and isolated from the mushroom. γ-Amanitin inhibits RNA polymerase II and disrupts synthesis of mRNA. γ-Amanitin shows similar effects to α-Amanitin and β-Amanitin.
  • HY-114236
    Ezeprogind disulfate

    AZP-2006 disulfate

    Amyloid-β Neurological Disease
    Ezeprogind (AZP-2006) disulfate is an orally active neurotrophic inducer. Ezeprogind disulfate targets all causes of neurodegeneration and is not only aiming at markers such as Abeta protein or tau protein. Ezeprogind disulfate is a potent neuroprotectant and can be used for the research of neurological disorders, including progressive supranuclear palsy (PSP), tauopathies, alzheimer’s and parkinson’s diseases, et al.
  • HY-114645
    PDK1-IN-RS2

    PDK-1 Cancer
    PDK1-IN-RS2 is a mimic of peptide docking motif (PIFtide) and is a substrate-selective PDK1 inhibitor with a Kd of 9 μM. PDK1-IN-RS2 suppresses the activation of the downstream kinases S6K1 by PDK1.
  • HY-B0510C
    Trimethoprim lactate

    Antifolate Bacterial Infection
    Trimethoprim lactic is a bacteriostatic antibiotic and an orally active dihydrofolate reductase inhibitor. Trimethoprim lactic is active against a wide range of Gram-positive and Gram-negative aerobic bacteria. Trimethoprim lactic has the potential for urinary tract infections, Shigellosis and Pneumocystis pneumonia treatment.
  • HY-P1244A
    Secretin (33-59), rat TFA

    Secretin (rat) (TFA)

    Glucagon Receptor Neurological Disease
    Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
  • HY-P1763
    Urechistachykinin II

    Uru-TK II

    Bacterial Infection
    Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
  • HY-P1768
    Urechistachykinin I

    Uru-TK I

    Bacterial Infection
    Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
  • HY-P0197
    Neurokinin A

    Substance K; Neurokinin α; Neuromedin L

    Neurokinin Receptor Neurological Disease Endocrinology
    Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues.
  • HY-P1308A
    SLIGRL-NH2 TFA

    Protease-Activated Receptor-2 Activating Peptide TFA

    Protease-Activated Receptor (PAR) Inflammation/Immunology
    SLIGRL-NH2 TFA (Protease-Activated Receptor-2 Activating Peptide TFA) is an agonist of Protease-Activated Receptor-2 (PAR-2).
  • HY-P0199
    Pancreatic Polypeptide, human

    Human pancreatic polypeptide

    Neuropeptide Y Receptor Metabolic Disease Endocrinology
    Pancreatic Polypeptide, human is a C-terminally amidated 36 amino acid peptide, which acts as a neuropeptide Y (NPY) Y4/Y5 receptor agonist.
  • HY-101986
    BIIE-0246

    AR-H 053591

    Neuropeptide Y Receptor Metabolic Disease Endocrinology
    BIIE-0246 is a potent and highly selective non-peptide neuropeptide Y (NPY) Y2 receptor antagonist, with an IC50 of 15 nM.
  • HY-112295
    AzKTB

    Others Infection
    AzKTB is a capture reagent which bears a short trypsin-cleavable peptide sequence between the azide module and the TAMRA/PEG-biotin labels.
  • HY-100200
    SMER28

    Autophagy Cancer
    SMER28 is a positive regulator of autophagy acting via an mTOR-independent mechanism. SMER28 prevents the accumulation of amyloid beta peptide.
  • HY-117661
    SPHINX31

    SRPK Cancer
    SPHINX31 is a potent and selective inhibitor of serine/arginine-rich protein kinase 1 (SRPK1), with an IC50 of 5.9 nM. SPHINX31 inhibits phosphorylation of serine/arginine-rich splicing factor 1 (SRSF1). SPHINX31 is a potential topical therapeutic for neovascular eye disease.
  • HY-N0781
    Linderalactone

    Apoptosis Cancer
    Linderalactone is an important sesquiterpene lactone isolated from Radix linderae. Linderalactone inhibits cancer growth by modulating the expression of apoptosis-related proteins and inhibition of JAK/STAT signalling pathway. Linderalactone also inhibits the proliferation of the lung cancer A-549 cells with an IC50 of 15 µM.
  • HY-15003
    ATH686

    FLT3 Apoptosis Cancer
    ATH686 is a potent, selective and ATP-competitive FLT3 inhibitor. ATH686 target mutant FLT3 protein kinase activity and inhibit the proliferation of cells harboring FLT3 mutants via induction of apoptosis and cell cycle inhibition. ATH686 has antileukemic effects.
  • HY-14865B
    Omadacycline tosylate

    PTK 0796 tosylate; Amadacycline tosylate

    Bacterial Antibiotic Infection
    Omadacycline (PTK 0796) tosylate, a first-in-class orally active aminomethylcycline antibacterial, is a member of the tetracycline class of antibiotics. Omadacycline tosylate acts through the inhibition of bacterial protein synthesis by binding to the 30S ribosomal subunit. Omadacycline tosylate possesses broad-spectrum antibacterial activity against aerobic and anaerobic Gram-positive and Gram-negative bacteria, as well as atypical bacteria. Omadacycline tosylate can be used for the research of acute bacterial skin and skin-structure infections, community-acquired pneumonia, and urinary tract infections.
  • HY-N3942
    Glabranine

    HIV Influenza Virus Infection
    Glabranine, an flavonoid, is isolated from Tephrosia s.p, exerts a inhibitory effect in vitro on the dengue virus. Glabranine forms interaction with the soluble ectodomain of DENV type 2 (DENV2) E protein.
  • HY-103597
    Thalidomide-O-COOH

    Cereblon ligand 3; E3 ligase Ligand 3

    Ligand for E3 Ligase Others
    Thalidomide-O-COOH (Cereblon ligand 3) is the Thalidomide-based Cereblon ligand used in the recruitment of CRBN protein. Thalidomide-O-COOH (Cereblon ligand 3) can be connected to the ligand for protein by a linker to form PROTACs.
  • HY-17510
    Gossypol (acetic acid)

    (±)-Gossypol-acetic acid; BL-193 (acetic acid)

    Bcl-2 Family Cancer
    Gossypol acetic acid ((±)-Gossypol-acetic acid), a natural product isolated from cottonseeds and roots, binds to Bcl-xL protein and Bcl-2 protein with Kis of 0.5-0.6 μM and 0.2-0.3 mM, respectively.
  • HY-15874A
    Fiboflapon sodium

    GSK2190915 sodium salt; AM-803 sodium

    FLAP Leukotriene Receptor Inflammation/Immunology
    Fiboflapon sodium (GSK2190915; AM-803) is a potent and orally bioavailable 5-lipoxygenase-activating protein (FLAP) inhibitor with a potency of 2.9 nM in FLAP binding, an IC50 of 76 nM for inhibition of LTB4 in human blood.
  • HY-B0843A
    Metalaxyl-M

    (R)-Metalaxyl

    Fungal Infection
    Metalaxyl-M ((R)-Metalaxyl) is the active (R)-enantiomer of Metalaxyl. Metalaxyl-M is a broad-spectrum fungicide that inhibits protein and ribosomal RNA synthesis in fungi. Metalaxyl is used for research of plant diseases caused by pathogens of the Oomycota division.
  • HY-N1549
    Prunin

    Naringenin 7-0-glucoside

    Enterovirus Phosphatase Infection Metabolic Disease
    Prunin is a potent inhibitor of human enterovirus A71 (HEVA71). Prunin shows strong inhibitory activity against protein tyrosine phosphatase 1B (PTP1B), with an IC50 of 5.5 µM.
  • HY-101867
    AU1235

    Bacterial Cancer Infection
    AU1235, an adamantyl urea, is a potent MmpL3 inhibitor. The Mycobacterium tuberculosis protein MmpL3 performs an essential role in cell wall synthesis, since it effects the transport of trehalose monomycolates across the inner membrane.
  • HY-110346
    AZD5582 dihydrochloride

    IAP Apoptosis Cancer
    AZD5582 dihydrochloride is an antagonist of the inhibitor of apoptosis proteins (IAPs), which binds to the BIR3 domains cIAP1, cIAP2, and XIAP with IC50s of 15, 21, and 15 nM, respectively. AZD5582 induces apoptosis.
  • HY-111903
    Levomecol

    Bacterial Infection
    Levomecol (Chloramphenicol), made up of Chloramphenicol, Methyluracil, is a broad-spectrum antibiotic that is derived from the bacterium Streptomyces venezuelae. Levomecol (Chloramphenicol)) stops bacterial growth by binding to the bacterial ribosome (blocking peptidyl transferase) and inhibiting protein synthesis.
  • HY-12600
    AZD5582

    IAP Apoptosis Cancer
    AZD5582 is an antagonist of the inhibitor of apoptosis proteins (IAPs), which binds to the BIR3 domains cIAP1, cIAP2, and XIAP with IC50s of 15, 21, and 15 nM, respectively. AZD5582 induces apoptosis.
  • HY-119370
    CHMFL-ABL-121

    Bcr-Abl Apoptosis Cancer
    CHMFL-ABL-121 is a highly potent type II ABL kinase inhibitor with IC50s of 2 nM and 0.2 nM against purified inactive ABL wt and T315I kinase protein, respectively.
  • HY-12833