Search Result
Results for "
A-Kinase-Anchoring Proteins Peptides Inhibitors
" in MedChemExpress (MCE) Product Catalog:
7729
Inhibitors & Agonists
193
Biochemical Assay Reagents
66
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P4076
-
|
|
HIV
|
Cancer
|
|
MPG peptides, Pβ is a primary amphiphilic peptide consisting of three domains .
|
-
-
- HY-P5636
-
|
BLP-7; Maximin 6
|
Bacterial
|
Infection
|
|
Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis .
|
-
-
- HY-P10529
-
|
|
Trk Receptor
|
Infection
|
|
Ganglioside GM1-binding peptides p3 is a synthetic peptide that can specifically bind to the pentasaccharide part of GM1 ganglioside. The dynamic transformation of Ganglioside GM1-binding peptides p3 may play an important role in the function of GM1 as a multiple receptor, such as in the classical pathway of cholera toxin infection. Ganglioside GM1-binding peptides p3 can be used to study the interaction between GM1 and its ligands .
|
-
-
- HY-P5720
-
|
|
Bacterial
|
Infection
|
|
Peptide 5e is an antimicrobial peptide. Peptide 5e inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 5, 25 μg/mL respectively .
|
-
-
- HY-P5730
-
|
|
Bacterial
|
Infection
|
|
Peptide 5g is an antimicrobial peptide. Peptide 5g inhibits E. coli, S. aureus, and C. albicans with MIC values of 30, 10, 12.5 μg/mL respectively .
|
-
-
- HY-P5564
-
|
|
Fungal
|
Infection
|
|
BTL peptide is an antifungal peptide. BTL peptide is active against B. maydis, A. brassicae, A. niger and C. personata .
|
-
-
- HY-P5615
-
|
|
Bacterial
|
Infection
|
|
XT-2 peptide is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-2 peptide has strong activity against E.coli, the vaule of MIC is 8 μM .
|
-
-
- HY-P5612
-
-
-
- HY-P5569
-
|
|
Fungal
|
Infection
|
|
SP-B peptide is an antimicrobial peptide. SP-B peptide has antifungal activity against strains of Cryptococcus neoformans, Candida albicans and Aspergillus fumigatus
|
-
-
- HY-P5634
-
|
BLP-3
|
Bacterial
|
Infection
|
|
Bombinin-like peptide 3 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis .
|
-
-
- HY-P5633
-
|
BLP-2
|
Bacterial
|
Infection
|
|
Bombinin-like peptide 2 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis .
|
-
-
- HY-P5600
-
|
|
Bacterial
|
Infection
|
|
The K4 peptide is an antimicrobial peptide with strong activity against Gram-positive and Gram-negative bacteria, including human pathogenic bacteria, such as Staphylococcus aureus and Marine Vibrio bacteria .
|
-
-
- HY-P5726
-
|
|
Antibiotic
|
Cancer
|
|
Aurein 1.2 is an active amphibian antibiotic peptide with antibiotic and anticancer activities .
|
-
-
- HY-P5707
-
-
-
- HY-P2365
-
|
|
Fungal
|
Infection
|
|
Histatin-8 is a part of the Histatin-3 central sequence and is known as hemagglutination-inhibiting peptide. Histatin-8 is a potent anti-fungal peptide. Histatin-8 shows antimicrobial activity against yeast strains. Histatin-8 can be used for oral thrush research .
|
-
-
- HY-P5631
-
|
|
Bacterial
|
Infection
|
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
-
-
- HY-P5728
-
-
-
- HY-P5803
-
|
|
Bacterial
|
Infection
|
|
Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM .
|
-
-
- HY-P5725
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Aurein 2.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria aurea and Litoria raniformis .
|
-
-
- HY-P5737
-
|
|
Bacterial
|
Infection
|
|
ASP-1 is a strong antistaphylococcal peptide with minimum inhibitory concentrations (MICs) of the purified peptide against S. aureus and methicillin-resistant S. aureus (MRSA) ranged from 2 μg/mL to 64 μg/mL .
|
-
-
- HY-P5711
-
-
-
- HY-P5584
-
-
-
- HY-P5632
-
|
|
Bacterial
|
Infection
|
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
-
-
- HY-P0003
-
|
Brain Natriuretic Peptide-32 human; BNP-32
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
Cancer
|
|
Nesiritide (Brain Natriuretic Peptide-32 human) is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide can be used for the research of heart failure .
|
-
-
- HY-P4133
-
|
|
ERK
MEK
|
Cancer
|
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable .
|
-
-
- HY-P5599
-
|
|
Bacterial
|
Infection
|
|
Temporin K is an antimicrobial peptide against Legionella pneumophila .
|
-
-
- HY-P5592
-
|
|
Bacterial
|
Infection
|
|
Temporin B is an antimicrobial peptide against Legionella pneumophila .
|
-
-
- HY-P5598
-
|
|
Bacterial
|
Infection
|
|
Temporin G is an antimicrobial peptide against Legionella pneumophila .
|
-
-
- HY-P5595
-
|
|
Bacterial
|
Infection
|
|
Temporin C is an antimicrobial peptide against Legionella pneumophila .
|
-
-
- HY-P5597
-
|
|
Bacterial
|
Infection
|
|
Temporin F is an antimicrobial peptide against Legionella pneumophila .
|
-
-
- HY-P4138
-
|
|
Fluorescent Dye
|
Cancer
|
|
Antennapedia Peptide FAM-labeled is a fluorophore labeled peptide. Antennapedia Peptide FAM-labeled also can be used for the research of cancer as a molecular probe .
|
-
-
- HY-P5722
-
|
|
Bacterial
|
Infection
|
|
Peptide 5f is an antimicrobial peptide derived from wasp venom. Peptide 5f has antimicrobial activity against bacteria and fungi. Peptide 5f has little hemolytic activity on human red blood cells .
|
-
-
- HY-P5642
-
|
RC-101
|
Bacterial
|
Infection
|
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
-
-
- HY-P5710
-
|
|
Bacterial
|
Infection
|
|
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo .
|
-
-
- HY-P5698
-
|
|
Bacterial
|
Infection
|
|
Cyclopetide 1 (Compound 1) is an antimicrobial peptide with moderate activity against B. subtilis, with a MIC of 25 μg/mL .
|
-
-
- HY-P5699
-
|
|
Bacterial
|
Infection
|
|
Cyclopetide 2 (Compound 2) is an antimicrobial peptide with moderate activity against B. subtilis, with a MIC of 50 μg/mL .
|
-
-
- HY-P5611
-
|
|
Bacterial
|
Infection
|
|
Maximin 7 is an antimicrobial peptide derived from toad Bombina maxima .
|
-
-
- HY-P5589
-
|
PlnA
|
Bacterial
|
Infection
|
|
Plantaricin A is an antimicrobial peptide derived from LactobacifZus plantarum against bacteria .
|
-
-
- HY-P5610
-
|
|
Bacterial
|
Infection
|
|
Maximin Hv is an antimicrobial peptide derived from toad Bombina maxima .
|
-
-
- HY-P5641
-
|
|
Bacterial
|
Infection
|
|
Pleurocidin is an antibacterial peptide derived from skin secretions of Winter Flounder .
|
-
-
- HY-P5614
-
|
|
Bacterial
|
Infection
|
|
Maximin 9 is an antimicrobial peptide derived from toad Bombina maxima .
|
-
-
- HY-P5969
-
-
-
- HY-P5715
-
|
|
Bacterial
|
Infection
|
|
Im6 is an antimicrobial peptide. Im6 is active against S. aureus and B.subtilis (Gram-positive bacterial) .
|
-
-
- HY-P5700
-
|
|
Bacterial
|
Infection
|
|
SAAP Fraction 3 is an antimicrobial peptide. SAAP Fraction 3 is active against P. haemolytica in Zn-saline buffer .
|
-
-
- HY-P5657
-
|
|
Bacterial
|
Infection
|
|
Maximin H5 is an antimicrobial peptide derived from toad Bombina maxima .
|
-
-
- HY-P5577
-
-
-
- HY-P5659
-
-
-
- HY-P5660
-
|
|
Bacterial
|
Infection
|
|
Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
-
- HY-P5677
-
|
|
Bacterial
|
Infection
|
|
Bombinin H5 is an antimicrobial peptide derived from the skin of moth Bombina variegata .
|
-
-
- HY-P5674
-
|
|
Bacterial
|
Infection
|
|
Bombinin H2 is an antimicrobial peptide derived from the skin of moth Bombina variegata .
|
-
- HY-P4933
-
|
|
Tau Protein
|
Others
|
|
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5662
-
|
|
Bacterial
|
Infection
|
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P4855
-
|
|
Fungal
Bacterial
|
Infection
|
|
CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections .
|
-
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
-
- HY-P5568
-
|
|
HIV
|
Infection
|
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
-
- HY-P5594
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S1 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5587
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5656
-
|
|
Bacterial
|
Infection
|
|
Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5591
-
|
|
Fungal
|
Infection
|
|
PAF26 is an antimicrobial peptide against phytopathogenic fungi Penicillium digitatum, Penicillium italicum and Botrytis cinerea .
|
-
- HY-P5607
-
-
- HY-P5590
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S3 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5593
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5658
-
|
|
Bacterial
|
Infection
|
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5621
-
|
|
Bacterial
|
Infection
|
|
Maximin 63 is an antimicrobial peptide derived from the brain of a toad. Maximin 63 has strong activity against S.aureus (MIC: 18.8 μg/mL) .
|
-
- HY-P5653
-
|
|
Bacterial
|
Infection
|
|
Bombolitin III is an antimicrobial peptide derived from bumblebee venom. Bombolitin III can lysate erythrocyte and liposome .
|
-
- HY-P5652
-
|
|
Bacterial
|
Infection
|
|
Bombolitin II is an antimicrobial peptide derived from bumblebee venom. Bombolitin II can lysate erythrocyte and liposome .
|
-
- HY-P5620
-
|
|
Bacterial
|
Infection
|
|
DFTamP1 is an antimicrobial peptide against Staphylococcus aureus USA300 activity (MIC is 3.1 μM) .
|
-
- HY-P5654
-
|
|
Bacterial
|
Infection
|
|
Bombolitin IV is an antimicrobial peptide derived from bumblebee venom. Bombolitin IV can lysate erythrocyte and liposome .
|
-
- HY-P5734
-
|
|
Bacterial
|
Infection
|
|
Bactenecin 5 is a bovine antibacterial peptide. Bactenecin 5 is active against Escherichia coli, Salmonella typhimurium, and Klebsiella pneumoniae. T, with MIC values of 12-25 μg/mL .
|
-
- HY-P5585
-
|
|
Bacterial
|
Infection
|
|
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor .
|
-
- HY-P5258
-
|
|
EGFR
|
Metabolic Disease
|
|
Oligopeptide-41 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P5225
-
|
|
PGC-1α
|
Others
|
|
Acetyl hexapeptide-38 is a bioactive peptide with upregulate adipogenesis effect and has been reported used as a cosmetic ingredient .
|
-
- HY-16027
-
|
|
GnRH Receptor
|
Endocrinology
|
|
Acyline, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels .
|
-
- HY-P3557
-
-
- HY-P5628
-
|
|
Bacterial
|
Infection
|
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
-
- HY-P5624
-
|
|
Bacterial
|
Infection
|
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
-
- HY-P5596
-
|
|
Bacterial
|
Infection
|
|
Combi-2 is an antimicrobial peptide against S.aureus, S.sanguis and E.coli .
|
-
- HY-P5566
-
|
|
Bacterial
|
Infection
|
|
GLK-19 is an antimicrobial peptide, and is active against E. coli (MIC: 10 μM) .
|
-
- HY-P10172
-
-
- HY-P5664
-
|
|
Bacterial
|
Infection
|
|
Maximin S4 is an antimicrobial peptide derived from toad Bombina maxima. Maximin S4 has antibacterial activity against mycoplasma .
|
-
- HY-P0102
-
|
|
mAChR
|
Neurological Disease
|
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation .
|
-
- HY-P5622
-
|
|
Dengue Virus
|
Infection
|
|
Hs-1 is an antimicrobial peptide displays 80% protection against the dengue-2 virus .
|
-
- HY-P2442
-
|
|
Bacterial
|
Others
|
|
Bombolitin V is a potent antimicrobial peptide with an ED 50 value of 2 micrograms/ml in causing mast cell degranulation .
|
-
- HY-P5233
-
|
|
Procollagen C Proteinase
|
Others
|
|
Acetyltetrapeptide 11 is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P5582
-
|
|
Bacterial
|
Infection
|
|
Combi-1 is an antimicrobial peptide with broad-spectrum activity against different bacteria and yeast cells .
|
-
- HY-P5689
-
|
|
Bacterial
|
Infection
|
|
Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells .
|
-
- HY-P5692
-
|
|
Bacterial
|
Infection
|
|
Maximin 77 is an antimicrobial peptide. Maximin 77 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 77 has hemolytic activities against human red cells .
|
-
- HY-P5691
-
|
|
Bacterial
|
Infection
Cancer
|
|
P1 is a broad-spectrum antimicrobial peptide. P1 shows antibacterial activity against Gram-positive and Gram-negative bacteria,such as B. anthracis spores and Carbapenem-resistant A. baumannii and K. pneumoniae .
|
-
- HY-P5639
-
|
|
Fungal
|
Infection
|
|
Gageotetrin A is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin A has antifungal activity, but none toxic to numerous human cancer cells .
|
-
- HY-P5731
-
|
|
Bacterial
|
Infection
|
|
Bac7(1-35) is a proline-rich antimicrobial peptide, selective for Gram-negative bacteria, which acts intracellularly after membrane translocation .
|
-
- HY-P5251
-
-
- HY-P5735
-
|
Bac-7
|
Bacterial
|
Infection
|
|
Bactenecin 7 is an antibacterial peptide active against the growth of Enterobacter cloacae (MICs, 25 to 200μg/ml) .
|
-
- HY-P5687
-
|
|
Bacterial
|
Infection
|
|
Im5, an antimicrobial peptide, has antibacterial (MIC: 10, 2.5-5, 0.5-1 μM for E. coli, S. aureus, B. subtilis respectively) and hemolytic activity (EC50: 28 μM) .
|
-
- HY-P5748
-
|
|
ADC Cytotoxin
|
Others
|
|
Bac5(1-25) is an N-terminal fragment of the bovine proline-rich antimicrobial peptide Bac5 .
|
-
- HY-P5565
-
|
|
Bacterial
|
Infection
Cancer
|
|
RP-1 is an antimicrobial peptide, and is active against S. aureus, S. typhimurium, E. coli, and C. albicans .
|
-
- HY-P5626
-
|
|
Bacterial
|
Infection
|
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
-
- HY-P5818
-
-
- HY-P5575
-
-
- HY-P5576
-
-
- HY-P5548
-
|
|
Bacterial
|
Infection
Cancer
|
|
CaLL is an antimicrobial peptide. CaLL has antibacterial activity against B. anthracis, B. anthracis (vegetative), and B. cepacia (MIC: 7.8, 31.3, 31.3 μg/mL) .
|
-
- HY-P5646
-
|
|
Bacterial
|
Infection
|
|
Gageotetrin C is an antimicrobial peptide derived from the marine bacterium Bacillus subtilis. Gageotetrin C is more active against fungi (MIC value is 0.02-0.04 μM) .
|
-
- HY-P5696
-
|
|
Bacterial
Parasite
Fungal
|
Infection
|
|
Xenopsin precursor fragment is an antimicrobial peptide, and has antibacterial/antifungal (10-500 μg/mL) and anti-protozoal (MIC: 2-20 μg/mL) activity .
|
-
- HY-P5682
-
|
|
Bacterial
|
Infection
|
|
Maximin 41 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus (MIC: 75 μg/mL). Maximin 41 has hemolytic activities against human red cells .
|
-
- HY-P5627
-
|
|
Bacterial
|
Infection
|
|
XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-4 has strong activity against E.coli, the vaule of MIC is 18 μM .
|
-
- HY-P5690
-
|
|
Bacterial
|
Infection
|
|
Distinctin is an antimicrobial peptide. Distinctin can be isolated from frog skin. Distinctin has antibacterial activity against E. faecalis, P. aeruginosa, S. aureus and E. coli (MIC: 14.5, 28.0, 28.0, 14.5 μM) .
|
-
- HY-P10310
-
|
|
HIV
|
Infection
|
|
F9170 is an amphipathic peptide with an activity of inactivate HIV-1 virions. F9170 targets the conserved cytoplasmic tail of HIV-1 env and disrupts the integrity of the viral membrane. F9170 is able to cross the blood-brain barrier (BBB) .
|
-
- HY-P5572
-
-
- HY-P5630
-
|
|
Bacterial
|
Infection
|
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
-
- HY-106204
-
|
|
EGFR
|
Cancer
|
|
Nelipepimut-S is a peptide vaccine which targets HER2. Nelipepimut-S has immune activity against HER2 positive breast cancer .
|
-
- HY-P5570
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Aurein 2.3 is an antibiotic antimicrobial peptide. Aurein 2.3 partially inhibits E.coli ATPase activity and inhibits cell growth .
|
-
- HY-P5701
-
|
|
Bacterial
Fungal
|
Infection
|
|
EP2 is an antimicrobial peptide. EP2 has antibacterial and antifungal activities. EP2 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 11.4 μg/mL .
|
-
- HY-P5637
-
|
|
Bacterial
|
Infection
|
|
Tur1A is an antimicrobial peptide derived from bottlenose dolphins Tursiops truncates. Tur1A inhibits bacterial protein synthesis by binding to ribosomes and blocking the transition from the initiation stage to the extension stage .
|
-
- HY-P10688
-
-
- HY-P0281A
-
|
|
HIV
|
Infection
|
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P5571
-
-
- HY-P5685
-
|
|
Bacterial
|
Infection
|
|
Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P3968
-
|
|
CD47
|
Others
|
|
Thrombospondin-1 (1016-1021) (human, bovine, mouse), a Thrombospondin-1-derived peptide, is a truncated peptide devoid of CD47-binding activity .
|
-
- HY-P0281
-
|
|
HIV
|
Infection
|
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P4204
-
|
|
Bacterial
|
Infection
|
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
- HY-P5663
-
|
|
Bacterial
|
Infection
|
|
Bombinin H-BO1 is an antimicrobial peptide derived from toad Bombina orientalis skin secretions. Bombinin H-BO1 is active against Candida albicans, and the MIC value is 256 mg/L .
|
-
- HY-P1426
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5695
-
|
|
Bacterial
|
Infection
|
|
GP-2B is an antimicrobial peptide. GP-2B shows antibacterial activity against Gram-positive strain (MIC: 8-128 μg/mL for S. aureus and Enterococcus faecalis) .
|
-
- HY-P3945
-
|
|
Neuropeptide FF Receptor
|
Neurological Disease
|
|
Prolactin-Releasing Peptide (12-31), bovine is a peptide fragment of prolactin-releasing peptide (PrRP). PrRP is RF-amide peptides expressed in brain areas involved in
pain modulation. Prolactin-Releasing Peptide (12-31), bovine can be used for the research of nervous system disease .
|
-
- HY-P5603
-
|
BNBD-12
|
Bacterial
|
Infection
|
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
-
- HY-P2483
-
|
|
Bacterial
|
Infection
|
|
Octaarginine is a cell-penetrating peptide (CPP). CPPs show membrane translocation activities. CPPs are used for intracellular delivery of various membrane-impermeable bioactive agents because of their intrinsic ability to gain access to cell interiors. CPPs have also been used to deliver antibacterial agents to target intracellular bacteria .
|
-
- HY-P3489
-
-
- HY-P5252
-
|
|
Tyrosinase
|
Metabolic Disease
|
|
Diaminopropionoyl tripeptide-33isa bioactive peptide with protects skin cells from UVA-induced DNA damages and has been reported used as a cosmetic ingredient .
|
-
- HY-P5602
-
|
|
Bacterial
|
Infection
|
|
Mastoparan B is an antimicrobial peptide derived from hornet Vespa. Mastoparan B can cause the shape of red blood cells to change from normal disk-like to serrated .
|
-
- HY-P10518
-
|
|
Bacterial
|
Infection
|
|
Anoplin is an antimicrobial peptide found in the venom of the solitary wasp (Anoplius samariensis). Anoplin exhibits antimicrobial activity against a wide range of bacteria, including both gram-positive and gram-negative bacteria. Anoplin can be used in the development of antibiotics .
|
-
- HY-P5688
-
|
|
Bacterial
|
Infection
|
|
Maximin 68 is an antimicrobial peptide. Maximin 68 has antibacterial activity against C. albicans, S. aureus, E. coli, B. subtilis (MIC: 18.8, 9.4, 37.5, 9.4 μg/mL). Maximin 68 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P5275
-
|
CG-Lipoxyn
|
NF-κB
|
Metabolic Disease
|
|
Tripeptide-41(CG-Lipoxyn)isa bioactive peptide withreduce fat accumulationeffect and has been reported used as a cosmetic ingredient .
|
-
- HY-P5567
-
|
|
HIV
HSV
|
Infection
|
|
GLR-19 is an anti-HIV peptide. GLR-19 also has antiviral activity against HSV-2 .
|
-
- HY-400312
-
-
- HY-P0274
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
PGLa, a 21-residue peptide, is an antimicrobial peptide. PGLa is a member of the magainin family of antibiotic peptides found in frog skin and its secretions .
|
-
- HY-P5648
-
|
|
Bacterial
|
Infection
|
|
PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5647
-
|
|
Bacterial
|
Infection
|
|
PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5649
-
|
|
Bacterial
|
Infection
|
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5651
-
|
|
Bacterial
|
Infection
|
|
PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5884A
-
|
|
PKC
|
Others
|
|
PKCθ pseudosubstrate peptide inhibitor, myristoylated TFA is a synthetic peptide that can be used to study the mechanism of action of PKCθ .
|
-
- HY-P5613
-
|
|
Bacterial
|
Infection
|
|
XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-1 has strong activity against S.aureus, E.coli and C.albicans, the vaule of MIC are 5, 6, 50 μM , respectively .
|
-
- HY-P5673
-
|
|
Bacterial
|
Infection
|
|
Bombinin H1 is an antimicrobial peptide derived from the skin of moth Bombina variegata. The lethal concentrations of Bombinin H1 against Escherichia coli D21 and Staphylococcus aureus Cowan 1 are 3.8 and 2.1 μM, respectively .
|
-
- HY-P5676
-
|
|
Bacterial
|
Infection
|
|
Bombinin H3 is an antimicrobial peptide derived from the skin of moth Bombina variegata. The lethal concentrations of Bombinin H3 against Escherichia coli D21 and Staphylococcus aureus Cowan 1 are 3.7 and 2.4 μM, respectively .
|
-
- HY-P5678
-
|
|
Bacterial
|
Infection
|
|
Bombinin H4 is an antimicrobial peptide derived from the skin of moth Bombina variegata. The lethal concentrations of Bombinin H4 against Escherichia coli D21 and Staphylococcus aureus Cowan 1 are 4.8 and 3.3 μM, respectively .
|
-
- HY-P0274A
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of antibiotic peptides found in frog skin and its secretions .
|
-
- HY-P5629
-
|
|
Bacterial
|
Infection
|
|
MCF is an antimicrobial peptide derived from bee venom. MCF has activity against E.coli W 160-37, S.aureus 8530 and B.subtilis, the MIC values are 35-45 μg/ml, 25-35 μg/ml and 15-25 μg/ml .
|
-
- HY-P3758
-
|
|
Natriuretic Peptide Receptor (NPR)
|
Others
|
|
BNP (1-21), Pro (Human) is a peptide containg 21 amino acids. B-Type Natriuretic Peptide (BNP), a cardiac natriuretic hormone. BNP together with the highly homologous atrial natriuretic peptide, it forms a dual natriuretic peptide system of the heart. BNP is responsible for changes in the heart organogenesis and is associated with transition to extrauterine life .
|
-
- HY-P5683
-
|
|
Bacterial
|
Infection
|
|
Maximin 45 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus, E. coli, B. subtilis (MIC: 4.7, 9.4, 75 μg/mL). Maximin 45 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P3164
-
|
AcTP1
|
Biochemical Assay Reagents
|
Others
|
|
Caprooyl-tetrapeptide-9 (AcTP1) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P5686
-
|
|
Bacterial
|
Infection
|
|
Maximin 78 is an antimicrobial peptide. Maximin 78 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 37.5, 4.7, 37.5 μg/mL). Maximin 78 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P4101
-
|
|
HIV
|
Infection
|
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
|
-
- HY-P10183
-
-
- HY-P5253
-
-
- HY-P1929
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Bivalirudin, a peptide anticoagulant, is a direct thrombin inhibitor for anticoagulation in the setting of invasive cardiology, particularly percutaneous coronary intervention .
|
-
- HY-P5684
-
|
|
Bacterial
|
Infection
|
|
Maximin H39 is an antimicrobial peptide. MaximinH39 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 9.4, 9.4, 18.8 μg/mL). Maximin H39 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P5854
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
-
- HY-P5964
-
-
- HY-P5784
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P5783
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P5712
-
|
Gramicidin soviet
|
Antibiotic
Bacterial
|
Infection
|
|
Gramicidin S (Gramicidin soviet) is a cationic cyclic peptide antibiotic. Gramicidin S is active against Gram-negative and Gram-positive bacteria by perturbing integrity of the bacterial membranes. Gramicidin S also inhibits cytochrome bd quinol oxidase .
|
-
- HY-P5675
-
|
|
Bacterial
|
Infection
|
|
Bombinin H7 is an antimicrobial peptide derived from skin secretions of Bombina. Bombinin H7 is active against Bacillus megaterium Bm11 with a lethal concentration of 25.2 μM .
|
-
- HY-P5964A
-
-
- HY-P5801
-
|
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5061
-
-
- HY-P1344
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
-
- HY-P3815
-
|
|
Casein Kinase
|
Others
|
|
Casein Kinase 2 Substrate Peptide is a common CK2 substrate peptide. Casein Kinase 2 Substrate Peptide is synthesized with its C-terminus conjugated to 5-[(2-aminoethyl)amino]naphthalene-1-sulfonic acid (EDANS). Casein Kinase 2 Substrate Peptide can be used for protein kinase CK2 activity determination .
|
-
- HY-P5574
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Aurein 3.1 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 80, 50, 50, 50, 50 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis) .
|
-
- HY-P5573
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Aurein 2.6 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 25, 25, 30, 25, 30 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis) .
|
-
- HY-P1271
-
|
Catestatin (cattle)
|
nAChR
|
Cardiovascular Disease
|
|
Catestatin is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin is an endogenous peptide that regulates cardiac function and blood pressure . Catestatin is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release .
|
-
- HY-P3743
-
|
|
Src
Others
|
Others
|
|
p60c-src Substrate is an efficient and specific substrate for p60c-src protein tyrosine kinase (PTK). p60c-src Substrate can be used to synthesize chimeric branched peptides .
|
-
- HY-P1344A
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide TFA is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
-
- HY-P2361
-
|
|
Ras
|
Others
|
|
S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .
|
-
- HY-P5800
-
|
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5644
-
|
|
Bacterial
|
Infection
|
|
Retrocyclin-3 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
-
- HY-P5643
-
|
|
Bacterial
|
Infection
|
|
Retrocyclin-2 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
-
- HY-P1383A
-
|
|
Ras
|
Others
|
|
Rac1 Inhibitor F56, control peptide TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor F56, control peptide TFA contains a Trp 56 to Phe 56 mutation. Rac1 Inhibitor F56, control peptide TFA has no effect on Rac1 interaction with its guanine nucleotide exchange factors (GEFs) .
|
-
- HY-P2522
-
|
|
Bacterial
|
Infection
|
|
Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM .
|
-
- HY-P3281
-
|
|
Biochemical Assay Reagents
|
Others
|
|
FGL peptide, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5183
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
-
- HY-P4352
-
|
|
HIV
|
Others
|
|
HIV-2 Peptide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4848
-
|
|
Antibiotic
|
Infection
|
|
Dermcidin-1L (human) is an antibiotic peptide secreted by sweat glands. Dermcidin-1L (human) has antimicrobial activity. Dermcidin-1L (human) can be used for the research of inflammatory skin disorders .
|
-
- HY-P5793
-
-
- HY-P1632
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P5071
-
|
|
Bacterial
|
Infection
|
|
EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4 .
|
-
- HY-P5618
-
|
|
Bacterial
|
Infection
|
|
Maximin H2 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H2 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 20, 2, 4, 2 μg/ml, respectively .
|
-
- HY-P5655
-
|
|
Bacterial
|
Infection
|
|
Maximin H4 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H4 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 12, 6, 12, 6 μg/ml, respectively .
|
-
- HY-P5619
-
|
|
Bacterial
|
Infection
|
|
Maximin H3 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H3 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 20, 10, 20, 5 μg/ml, respectively .
|
-
- HY-P3624
-
|
|
Guanylate Cyclase
|
Cardiovascular Disease
|
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research .
|
-
- HY-P1481
-
-
- HY-P3877A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM .
|
-
- HY-P0099
-
|
|
nAChR
|
Others
|
|
Pentapeptide-3 is a pentapeptide fragment of neurotoxin waglerin-1, it can be extracted from the venom of Temple Viper. Pentapeptide-3 is a competitive antagonist of nicotinic acetylcholine receptors (nAChRs), it can blocks nerves at the post-synaptic membrane. Pentapeptide-3 has anti-aging effects and it can be used together with other cosmetic peptides .
|
-
- HY-P5608
-
|
|
Bacterial
|
Infection
|
|
Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 4 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5609
-
|
|
Bacterial
|
Infection
|
|
Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 5 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5604
-
|
|
Bacterial
|
Infection
|
|
Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5605
-
|
|
Bacterial
|
Infection
|
|
Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 2 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P4031
-
-
- HY-P4033
-
-
- HY-P3876
-
-
- HY-P5616
-
|
|
Bacterial
|
Infection
|
|
Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively .
|
-
- HY-P0269
-
|
Magainin I
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .
|
-
- HY-P2217
-
|
DSC-127; NorLeu3-A(1-7)
|
Angiotensin Receptor
|
Inflammation/Immunology
|
|
Aclerastide (DSC-127) is an angiotensin receptor agonist. Aclerastide also is a peptide analog of angiotensin II. Aclerastide can be used for the research of tissue regeneration in diabetic ulcers .
|
-
- HY-P3623
-
|
|
Fluorescent Dye
|
Others
|
|
Biotin-Glucagon-Like Peptide 1 (7-36) amide, human is a biologically active peptide. Biotin-Glucagon-Like Peptide 1 (7-36) amide, human can be used for the research of various biochemical studies.
|
-
- HY-P10699
-
-
- HY-P10071
-
|
Calmodulin Kinase IINtide; CaM-KIIN; CaM-KIINβ
|
CaMK
|
Others
|
|
CaMKII inhibitory peptide KIIN is a potent inhibitor of CaMKII .
|
-
- HY-P4200
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Lugdunin is an antibiotic peptide. Lugdunin inhibits bacteria by dissipating their membrane potential. Lugdunin is active against Gram-positive bacteria, such as S. aureus, and reduces S. aureus skin and nasal colonization. Lugdunin induces LL-37 and CXCL8/MIP-2 in human keratinocytes and mouse skin .
|
-
- HY-105048
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Omiganan is a cationic antimicrobial peptide. Omiganan as an analogue of indolicidin shows activity against gram-positive and gram-negative bacteria but also Candida spp. isolates. Omiganan can be used for the research of alcohol nose and acne .
|
-
- HY-P5670
-
|
|
Bacterial
|
Infection
|
|
Maximin 31 is an antimicrobial peptide derived from the toad brain. Maximin 31 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 37.5, 75 μg/mL, respectively .
|
-
- HY-P10895
-
|
|
Biochemical Assay Reagents
|
Others
|
|
HR97 TFA is a cell-penetrating peptide that can be combined with engineered melanin to prepare eye drops HR97-SunitiGel. The peptide-drug conjugate in HR97-SunitiGel can provide sustained ocular drug delivery .
|
-
- HY-P1701
-
|
|
Opioid Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Morphiceptin is a potent and specific agonist for morphine (μ) receptors. Morphiceptin, as a synthetic peptide, is the amide of a fragment of the milk protein β-casein. Morphiceptin has morphinelike activities and is highly specific for morphine (μ) receptors but not for enkephalin (⸹) receptors .
|
-
- HY-134578
-
|
|
Drug Intermediate
|
Others
|
|
H-Arg-Ser-Arg-OH is a short peptide. H-Arg-Ser-Arg-OH is a motif of di-leucine and RSRR, it can be used to design larger peptides and compound .
|
-
- HY-P5693
-
|
|
Bacterial
CMV
HSV
|
Infection
|
|
HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
|
-
- HY-P5671
-
|
|
Bacterial
|
Infection
|
|
Maximin 32 is an antimicrobial peptide derived from the toad brain. Maximin 32 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 9.4, 18.8 μg/mL, respectively .
|
-
- HY-P5672
-
|
|
Bacterial
|
Infection
|
|
Maximin 39 is an antimicrobial peptide derived from the toad brain. Maximin 39 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 18.8, 37.5 μg/mL, respectively .
|
-
- HY-P4079
-
-
- HY-P2880
-
|
|
GCGR
|
Others
|
|
PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides .
|
-
- HY-P5562
-
|
|
Bacterial
|
Infection
|
|
PP102 is an antimicrobial peptide is active against gram-positive B. subtilis (MIC: 25 uM), S. aureus (MIC: 13.3 uM), S. lutea (MIC: 63 uM), and B. pumilu (MIC: 23 uM) .
|
-
- HY-P1631
-
|
|
Bacterial
|
Infection
|
|
Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized into an amphiphilic, antiparallel β-hairpin by two disulfide bridges .
|
-
- HY-P2500
-
|
|
Fluorescent Dye
|
Others
|
|
(Arg)9, FAM-labeled, a cell-penetrating peptide (CPP), is a nona-arginine (ARG) with FAM label. CPPs have emerged as powerful tools for delivering bioactive cargoes into the cytosol of intact cells .
|
-
- HY-P4858
-
|
|
GSK-3
|
Cancer
|
|
C-Peptide 1 (rat), a peptide, is aβ-catenin/GSK-3β activator. C-Peptide 1 (rat) can regulate the Wnt/β-catenin signaling pathway. C-Peptide 1 (rat) can be used for the research of cancer .
|
-
- HY-P2702
-
|
|
Adenylate Cyclase
|
Others
|
|
Helodormin is a VIP-secretin-like peptide isolated from the venom of the Mexican monster lizard (Heloderma suspectum). Helodormin affects a variety of cellular functions by modulating intracellular signaling through activation of adenylate cyclase. Helodormin can be used to study the evolution and function of the secretin and VIP peptide families .
|
-
- HY-P0033
-
|
Acetyl hexapeptide-3
|
Calcium Channel
|
Neurological Disease
|
|
Argireline (Acetyl hexapeptide-3) is a non-toxic, skin-permeable, antiwrinkle peptide. Argireline significantly inhibits Ca 2+ dependent neurotransmitter release (acetylcholine) at the neuromuscular junction. Argireline has antiwrinkle and anti-aging activity .
|
-
- HY-106268
-
|
|
Gap Junction Protein
|
Infection
Inflammation/Immunology
|
|
Larazotideis a peptide which is an orally active zonulin antagonist. Larazotide shows antiviral activity to varicella-zoster virus (VZV) with EC50s of 44.14 and 59.06 μM for strain OKA and 07-1, respectively. Larazotide can be used for the research of celiac disease and infection .
|
-
- HY-35028
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu-Ofm is a peptide. Boc-Glu-Ofm has been used for the synthesis of ester insulin and cyclic peptide mixtures .
|
-
- HY-P10557
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
DAG peptide is a cyclic peptide. DAG peptide selectively recognizes a subset of astrocytes that are activated in Alzheimer's disease (AD) starting at an early stage of the disease. DAG peptide can be used as a tool to enhance the delivery of therapeutics and imaging agents to sites of vascular changes and astrogliosis in diseases associated with neuroinflammation .
|
-
- HY-P4463
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Pyr1)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P3526
-
-
- HY-P5702
-
|
|
Bacterial
Apoptosis
Fungal
|
Infection
|
|
EP3 is an antimicrobial peptide. EP3 has antibacterial and antifungal activities. EP3 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 12.85 μg/mL. EP3 also shows antitumor activity against cancer cells, and induces cell apoptosis .
|
-
- HY-P2669
-
-
- HY-P5666
-
|
|
Bacterial
|
Infection
|
|
Maximin 15 is an antimicrobial peptide derived from the toad brain. Maximin 15 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 9.4, 18.8, 75 μg/mL, respectively .
|
-
- HY-P5668
-
|
|
Bacterial
|
Infection
|
|
Maximin 28 is an antimicrobial peptide derived from the toad brain. Maximin 28 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 4.7, 9.4, 75 μg/mL, respectively .
|
-
- HY-P1513A
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P5788
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
-
- HY-P4536
-
|
|
GnRH Receptor
|
Others
|
|
(D-Leu6)-LHRH (1-8) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4351
-
|
|
HIV
|
Others
|
|
HIV-1 gag Protein p24 (194-210) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P3877
-
-
- HY-P10430
-
|
|
Transmembrane Glycoprotein
|
Neurological Disease
|
|
Stalk peptide is a GPR110 activator. Stalk peptide is released from GPCR Autoproteolysis INducing domain by autocatalytic process and then Stalk peptide is inserted into the ligand-binding pocket of the receptor to activate the receptor. Stalk peptide can promote nerve growth and synaptic formation. Stalk peptide can be used to study neurodevelopmental and neurodegenerative diseases .
|
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P2932
-
|
Cholecystokinin-33(human); CCK-33(human)
|
Cholecystokinin Receptor
|
Metabolic Disease
|
|
Cholecystokinin is a peptide hormone. Cholecystokinin, as a hunger suppressant, inhibits food intake and stimulates the digestion of fat and protein. Cholecystokinin can be used for the research of gastrointestinal system .
|
-
- HY-P0082
-
|
Glucagon
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-P4001
-
|
|
ADAMTS
|
Cardiovascular Disease
|
|
Adamtsostatin 4 is an anti-angiogenic peptide. Adamtsostatin 4 can be used for the research of anti-angiogenic .
|
-
- HY-P4000
-
|
|
ANGPTL
|
Cardiovascular Disease
|
|
Cartilostatin 1 is an anti-angiogenic peptide. Cartilostatin 1 can be used for the research of anti-angiogenic .
|
-
- HY-P2703
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
Endocrinology
|
|
Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system .
|
-
- HY-P3940
-
|
|
PKC
|
Others
|
|
Ac-MBP (4-14) Peptide is an acetylated MBP (4-14) peptide. MBP (4-14) Peptide is a very selective (protein kinase C) PKC substrate. Ac-MBP (4-14) Peptide can be used for PKC assay in extracts without prior purification to eliminate interfering protein kinases or phosphatases .
|
-
- HY-P4570
-
|
|
GnRH Receptor
|
Others
|
|
(D-Ser6,Azagly10)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P10612
-
|
|
Bacterial
|
Metabolic Disease
|
|
Tetanus toxin peptide is a specific peptide isolated from the toxin produced by Clostridium tetani. Tetanus toxin peptide can be used as an immunogen to induce diabetes in mice. Tetanus toxin peptide can be used in the study of type 1 diabetes .
|
-
- HY-P10689
-
|
|
SARS-CoV
|
Infection
|
|
NQK-A8 peptide is an immunodominant peptide of seasonal coronaviruses HKU1-CoV and OC43-CoV .
|
-
- HY-P5606
-
|
|
Bacterial
|
Infection
|
|
Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 3 has cytotoxicity on tumor cells and spermicidal effect. Maximin 3 has significant anti-HIV activity .
|
-
- HY-P10513
-
|
AP1-Z1
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
|
AcrAP1 (AP1-Z1) is an antimicrobial peptide found in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP1 has antimicrobial activity and can inhibit the growth of Gram-positive and Gram-negative bacteria as well as yeast. AcrAP1 exerts antitumor activity by promoting apoptosis of cancer cells and inhibiting angiogenesis. AcrAP1 can be used in cancer therapy research .
|
-
- HY-P5697
-
|
|
Bacterial
|
Infection
|
|
Tilapia piscidin 3 is an antimicrobial peptide with antibacterial activity against gram-positive and -negative bacteria (MIC: 2.44, 2.44, 9.78, 19.55, 0.61 μg/mL for V. vulnificus 204, V. alginolyticus, S. agalactiae 819, E. faecalis BCRC 10066, S. agalactiae BCRC 10787). Tilapia piscidin 3 has hemolytic activity in fish red blood cells .
|
-
- HY-P4538
-
|
|
GnRH Receptor
|
Others
|
|
(D-Leu6,Pro-NHEt9)-LHRH (4-9) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P3919
-
|
Pro-ADM-153-185 (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones .
|
-
- HY-P10510
-
|
|
Biochemical Assay Reagents
|
Others
|
|
R5 peptide is one of the repeating peptide sequences that form the protein diatom in Cylindrotheca fusiformis. R5 peptide can be used as a template for the synthesis of Pd (palladium) nanoparticles (NPs). R5 peptide forms complexes with metal ions through the amine groups in its sequence, and the self-assembled structure of the peptide provides a confined spatial environment for the reduction of metal ions and the nucleation of nanoparticles. R5 peptide can be used in the research of biomimetic nanomaterials .
|
-
- HY-P5853
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
-
- HY-P5227
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
Acetyl hexapeptide-49 (example 13) is a bioactive peptide with anti-allergen effect and has been reported used as a cosmetic ingredient. Acetyl hexapeptide-49 can alleviate stimulation of mammalian skin cells and protect cell vitality .
|
-
- HY-P0133
-
|
Nona-L-arginine; Peptide R9
|
Ser/Thr Protease
|
Neurological Disease
|
|
(Arg)9 (Nona-L-arginine) is a cell-penetrating peptide (CPP) made up of 9 arginine residues, which is an inhibitor of serine endoprotease Furin. (Arg)9 has neuroprotective property, exhibits neuroprotective activity with an IC50 of 0.78 μM in the glutamic acid model .
|
-
- HY-P10158
-
|
Porcine cathelicidin PMAP-36
|
Bacterial
|
Infection
|
|
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
|
-
- HY-P4534
-
|
(D-His2)-Triptorelin
|
GnRH Receptor
|
Others
|
|
(D-His2,D-Trp6)-LHRH ((D-His2)-Triptorelin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P10382
-
|
|
MHC
|
Inflammation/Immunology
|
|
M133 peptide is a coronavirus-specific CD4 T cell epitope. M133 peptide is immunodominant in mice infected with the neurotropic coronavirus (the JHM strain of mouse hepatitis virus). M133 peptide forms a complex with MHC II molecules, which is recognized by specific TCRs, thereby activating CD4 T cells .
|
-
- HY-P5709
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
HG4 is a fast-acting antimicrobial peptide. HG4 shows anti-biofilm and anti-inflammatory activities. HG4 is active against Gram-positive pathogens, especially against MRSA strains (MIC: 32-64?μg/mL). HG4 can bind to bacterial lipids and reduces ATP concentration in S. aureus MRSA USA300 cells .
|
-
- HY-P5706
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
HG2 is a fast-acting antimicrobial peptide. HG2 shows anti-biofilm and anti-inflammatory activities. HG2 is active against Gram-positive pathogens, especially against MRSA strains (MIC: 16-32?μg/mL). HG2 can bind to bacterial lipids and reduces ATP concentration in S. aureus MRSA USA300 cells .
|
-
- HY-P2687
-
|
Urodilatin (human)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
-
- HY-P5704
-
|
|
Bacterial
|
Infection
|
|
K11 is an antimicrobial peptide. K11 is active against MDR/XDR K. pneumoniae isolates (MIC: 8-512 μg/mL), and inhibits bacterial biofilm formation. K11 can act synergistically with antibiotics (Chloramphenicol (HY-B0239), Meropenem (HY-13678), Rifampicin (HY-B0272), etc.) against drug-resistant K. pneumoniae. K11 has high thermal and wide pH stability .
|
-
- HY-P5703
-
|
|
Bacterial
Apoptosis
Fungal
|
Infection
|
|
EP5-1 is an antimicrobial peptide. EP5-1 has antibacterial and antifungal activities. EP5-1 also shows antitumor activity against cancer cells, and induces cell apoptosis. EP5-1 has antiviral activity against pseudorabies virus (PRV) .
|
-
- HY-P5563
-
|
|
Bacterial
|
Infection
|
|
PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive bacteria, E.coli (MIC: 73.3 uM), B. subtilis (MIC: 23.3 uM), S. aureus (MIC: 13 uM), S. lutea (MIC: 16.7 uM), and B. pumilu (MIC: 23.3 uM) .
|
-
- HY-P3942
-
-
- HY-P2670
-
|
|
NF-κB
|
Others
|
|
SN50M, a mutant peptide of SN50 (HY-P0151), is a cell membrane-permeable inactive control peptide .
|
-
- HY-P10659
-
|
|
EGFR
|
Cancer
|
|
Self-assembling peptide pY1 is a peptide that assemblies around cancer cells and targets EGFR. When co-cultured with Ovalbumin (OVA), pY1 can effectively block the endocytosis of OVA .
|
-
- HY-P4442
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Gly10,D-His2,D-Trp6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4467
-
|
(Des-Pyr1)-Leuprolide
|
GnRH Receptor
|
Others
|
|
(Des-Pyr1,Des-Gly10,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4447
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Gly10,D-Pyr1,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4440
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Gly10,Des-Ser4,D-Leu6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4445
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Gly10,D-Leu6,Orn8,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P10799
-
-
- HY-P1508
-
|
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
- HY-P1165
-
-
- HY-60265
-
-
- HY-P5560
-
|
|
Bacterial
|
Infection
|
|
PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. subtilis (MIC: 13.3 uM), S. aureus (MIC: 23.3 uM), S. lutea (MIC: 8.0 uM), and B. pumilu (MIC: 9.0 uM) .
|
-
- HY-P0133B
-
|
Nona-L-arginine acetate; Peptide R9 acetate
|
Ser/Thr Protease
|
Neurological Disease
|
|
(Arg)9 (Nona-L-arginine) acetate is a cell-penetrating peptide (CPP) made up of 9 arginine residues. (Arg)9 acetate has neuroprotective property, exhibits neuroprotective activity with an IC50 of 0.78 μM in the glutamic acid model .
|
-
- HY-P4441
-
|
|
GnRH Receptor
|
Others
|
|
(Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt9)-LHRH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-17571
-
|
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P3384
-
|
|
Antibiotic
|
Others
Inflammation/Immunology
|
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
-
- HY-P6009
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P4890
-
-
- HY-P5957
-
|
|
Parasite
|
Infection
|
|
Omphalotin A is a cyclic peptide, and shows nematicidal activity .
|
-
- HY-P0003A
-
|
Brain Natriuretic Peptide-32 human acetate; BNP-32 acetate
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
Cancer
|
|
Nesiritide (Brain Natriuretic Peptide-32 human) acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate can be used for the research of heart failure .
|
-
- HY-P5282
-
|
|
Acyltransferase
|
Others
|
|
ApoA-I mimetic peptide (PVLDLFRELLNELLEALKQKLK) has good lecithin:cholesterol acyl transferase (LCAT) activation potency. ApoA-I mimetic peptide can be used for synthesis of peptide/lipid complex .
|
-
- HY-P6009A
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP TFA is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P1481A
-
-
- HY-P10476
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 can be used for researches of muscle atrophic disorders .
|
-
- HY-P0133A
-
|
Nona-L-arginine TFA; Peptide R9 TFA
|
Ser/Thr Protease
|
Neurological Disease
|
|
(Arg)9 (Nona-L-arginine) TFA is a cell-penetrating peptide (CPP) made up of 9 arginine residues. (Arg)9 TFA has neuroprotective property, exhibits neuroprotective activity with an IC50 of 0.78 μM in the glutamic acid model .
|
-
- HY-P1222
-
|
|
Bacterial
|
Infection
|
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P4410
-
|
|
Drug Derivative
|
Metabolic Disease
|
|
(D-Asp28)-Exenatide is an Exenatide (HY-13443) impurity. Exenatide is a long-acting glucagon-like peptide-1 receptor agonist .
|
-
- HY-P4407
-
-
- HY-P10422
-
|
ML-peptide, Multi-Leucine (ML)-peptide
|
Autophagy
|
Cancer
|
|
Multi-Leu peptide (ML-peptide) is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
|
-
- HY-P5786
-
-
- HY-P10306
-
|
|
Bacterial
|
Infection
|
|
Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials .
|
-
- HY-117483
-
|
|
iGluR
|
Neurological Disease
|
|
Gly-Pro-Glu is a neuroactive peptide with a potent action on acetylcholine release. Gly-Pro-Glu is the N-terminal tripeptide of insulin-like growth factor-I. Gly-Pro-Glu inhibits glutamate binds to N-methyl-D-aspartate (NMDA) receptor with an IC50 value of 14.7 μM. Gly-Pro-Glu can be used for the research of neuroprotection .
|
-
- HY-P5680
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
SpHistin is an antimicrobial peptide (AMP). SpHistin can bind to LPS (HY-D1056) and permeabilize the bacterial membrane. SpHistin combined with Rifampicin (HY-B0272) and Azithromycin (HY-17506) promotes the intracellular uptake of the antibiotics and subsequently enhances the bactericidal activity of both agents against P. aeruginosa .
|
-
- HY-P4890A
-
-
- HY-136934
-
|
[Boc-Glu(Obzl)]2-Lys-Ome
|
P-glycoprotein
|
Cancer
|
|
Reversin 205 ([Boc-Glu(Obzl)]2-Lys-Ome) is a P-glycoprotein (ABCB1) inhibitor. Reversin 205 is a peptide chemosensitizer .
|
-
- HY-P5986
-
|
|
ERK
|
Others
|
|
mSIRK (L9A) is a cell-permeable, N-myristoylated G-Protein Binding Peptide (mSIRK). mSIRK (L9A) contains a single point mutation (Leu9 to Ala). mSIRK (L9A) cannot enhance ERK1/2 phosphorylation. mSIRK (L9A) can be used as a control peptide .
|
-
- HY-P10176
-
|
|
Opioid Receptor
|
Others
|
|
Acetalin-2 is an opioid peptide with a sequence of Ac-Arg-Phe-Met-Trp-Met-Arg-NH2. Acetalin-2 is selectively bound to [ 3H]DAMGO with a K i value of 93.3 nM .
|
-
- HY-P5713
-
|
|
Bacterial
|
Infection
|
|
Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity .
|
-
- HY-106374
-
|
|
VEGFR
|
Cancer
|
|
Elpamotide is an epitope peptide derived from VEGFR2. Elpamotide induces cytotoxic T lymphocytes (CTLs) to kill VEGFR2-expressing endothelial cells. Elpamotide has potential immunostimulatory and antineoplastic activities. Elpamotide can be used in the research of cancer, such as pancreatic cancer .
|
-
- HY-P3502
-
|
RA101495; RA3193
|
Complement System
|
Inflammation/Immunology
|
|
Zilucoplan (RA101495), a 15-amino acid macrocyclic peptide, is a potent complement component 5 (C5) inhibitor. Zilucoplan can be used in research of immune-mediated necrotising myopathy (IMNM) .
|
-
- HY-P10651
-
|
|
Bacterial
|
Infection
|
|
Lifeact peptide is a fusion structure of BP100 bound to actin. BP100 (KKLFKKILKYL-amide) is an antimicrobial peptide against plant pathogens that acts as a fast and effective cell penetrant to transport fluorescent test cargo into the cytoplasm of plant cell walls .
|
-
- HY-P10040
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Gln22)β-Amyloid (1-40) human is an amyloid beta protein (Aβ)-containing peptide used in Alzheimer's disease research .
|
-
- HY-P10511
-
|
|
Apoptosis
|
Infection
Cancer
|
|
Pantinin-3 is an antimicrobial peptide with antitumor activity found in the venom of the emperor scorpion (Pandinus imperator). Pantinin-3 shows selective toxicity against breast cancer cells (MDA-MB-231) and prostate cancer cells (DU-145). Pantinin-3 can induce apoptosis in tumor cells. Pantinin-3 can be used in cancer research .
|
-
- HY-P4198
-
-
- HY-P5812
-
|
|
Integrin
|
Inflammation/Immunology
|
|
IDR-1002 is an anti-infective peptide that enhances the ability of human monocytes to migrate toward chemokines on fibronectin. IDR-1002 also induces adhesion and activation of β1-integrin, a mechanism that promotes monocyte recruitment .
|
-
- HY-P10168
-
|
|
Phosphatase
|
Others
|
|
11R-CaN-CON is a control inactive peptide and can be used as a negative control for 11R-CaN-AID (HY-P10167) .
|
-
- HY-41121
-
|
Boc-Ala-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-Ala-OH (Boc-Ala-OH) shows excellent affinity with ATP. Boc-L-Ala-OH contains an amino acid moiety, and an acylamide bond like that of the peptide and protein .
|
-
- HY-P2019
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus .
|
-
- HY-P5681
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
-
- HY-P10736
-
|
|
GCGR
|
Metabolic Disease
|
|
AMG133 peptide payload is a GLP-1 agonist that can be used as a peptide linker conjugate of AMG133 (HY-164535) .
|
-
- HY-P3913
-
|
|
Bacterial
|
Infection
|
|
Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of Streptococcus pyogenes cell surface adhesin that acts as an antimicrobial peptide to specifically inhibit the binding of adhesin to salivary receptors and prevent recolonization of Streptococcus pyogenes .
|
-
- HY-P5206
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakB is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS, GakB with GakA, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P2169
-
-
- HY-P5109
-
-
- HY-P5694
-
|
|
HPV
Parasite
|
Infection
|
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
-
- HY-P10516
-
|
|
DNA/RNA Synthesis
RAD51
|
Cancer
|
|
BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence .
|
-
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
-
- HY-P3142
-
-
- HY-P2360
-
|
Ras 5-17
|
Ras
|
Others
|
|
G12 (Ras 5-17) is a wild-type Ras peptide consisted of amino acids 5-17 (KLVVVGAGGVGKS). G12 can be used as a control of mutant Ras peptides studies (such V12) .
|
-
- HY-P10184
-
|
|
Transmembrane Glycoprotein
|
Inflammation/Immunology
|
|
CD36 Peptide P (93-110), Cys conjugated is a Cys labelled CD36 Peptide, and can block binding of CD36 to immobilized thrombospondin and partially inhibited collagen-induced platelet aggregation .
|
-
- HY-P10796
-
|
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
YARA peptide, a cell-penetrating peptide, is a MK2 inhibitor. YARA-loaded nanoparticles decreases the levels of inflammatory cytokines (IL-1β, IL-6, and TNF-α) in an ex vivo skin culture model. YARA peptide is promising for research of atopic dermatitis (AD) .
|
-
- HY-P10495
-
|
|
Transmembrane Glycoprotein
|
Others
Cancer
|
|
GPR110 peptide agonist P12 is a peptide that acts as a GPR110 agonist. GPR110 peptide agonist P12 can significantly enhance the initial rate of GPR110 stimulated G protein GTPγS binding. GPR110 peptide agonist P12 mimics the action of natural ligands, causing the extracellular domain (ECD) of the GPR110 to dissociate from the seven transmembrane domains (7TM), exposing the β-strand-13/stalk region at the N-terminus of the 7TM domain, which acts as an agonist to activate G protein signaling. GPR110 peptide agonist P12 can be used in the study of developmental disorders and cancers related to GPR110 .
|
-
- HY-P10862
-
|
|
Virus Protease
|
Cancer
|
|
AH-D peptide is an antiviral peptide that selectively disrupts membrane structures within the size range of exosomes, inducing T-EXO depletion and enhancing cancer immunotherapy .
|
-
- HY-P3763
-
-
- HY-137199
-
-
- HY-P3207A
-
-
- HY-P10370
-
|
|
Bacterial
Apoptosis
|
Infection
Cancer
|
|
d-(KLAKLAK)2, as an antibacterial and anti-tumor polypeptide, is a representative of the antimicrobial peptide group, and also has good anticancer properties. d-(KLAKLAK)2 is able to kill bacteria by damaging their cell membranes, causing cell contents to leak out. d-(KLAKLAK)2 can also inhibit tumor cell proliferation by causing mitochondrial swelling and mitochondrial membrane destruction, triggering apoptosis (programmed cell death) .
|
-
- HY-P10800
-
|
|
Deubiquitinase
|
Cancer
|
|
T20-M is a lead peptide that shows good potential for binding affinity towards UBE2C .
|
-
- HY-P4156
-
|
|
mAChR
|
Neurological Disease
|
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA .
|
-
- HY-P2355A
-
-
- HY-P10541
-
|
|
HSP
|
Others
|
|
HSP70/DnaK substrate peptide is a short peptide that the HSP70/DnaK molecular chaperone can bind and act on. HSP70/DnaK substrate peptide can be used to study the mechanism of action of HSP70/DnaK in molecular chaperone function .
|
-
- HY-P35433
-
|
T-1249
|
HIV
|
Inflammation/Immunology
|
|
Tifuvirtide (T-1249) is a peptide human immunodeficiency virus type-1 (HIV-1) fusion inhibitor. Tifuvirtide is a synthetically designed hybrid retroviral envelope polypeptide. Tifuvirtide has antiretroviral activity. Tifuvirtide can be used for the research of HIV infection .
|
-
- HY-P1188
-
|
|
Integrin
|
Cancer
|
|
LDV-FITC, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC can be used to detect α4β1 integrin affinity .
|
-
- HY-P2360A
-
|
Ras 5-17 TFA
|
Ras
|
Others
|
|
G12 (Ras 5-17) TFA is a wild-type Ras peptide consisted of amino acids 5-17 (KLVVVGAGGVGKS). G12 TFA can be used as a control of mutant Ras peptides studies (such V12) .
|
-
- HY-P10818
-
|
|
Huntingtin
|
Neurological Disease
|
|
Polyglutamine binding peptide 1 (QBP1) is a peptide inhibitor of polyglutamine (polyQ). Polyglutamine binding peptide 1 inhibits polyQ protein aggregation in vitro and suppresses polyQ-induced cell death in cell culture .
|
-
- HY-P1118
-
-
- HY-P2355
-
-
- HY-P2243A
-
-
- HY-P2064
-
|
|
Bacterial
|
Infection
|
|
Lariatins is a novel anti-mycobacterial peptides with a lasso structure produced by Rhodococcus jostii K01-B0171 .
|
-
- HY-P10471B
-
|
|
MARCKS
PKC
|
Others
|
|
Ala-MPSD is a control peptide for MPSD (HY-P10471). In Ala-MPSD, the four serine residues of MPSD are substituted by alanines .
|
-
- HY-P3586
-
|
Hunter-killer peptide ao; Prohibitin-targeting peptide 1; prohibitin-TP01; Adipotide
|
Apoptosis
|
Cancer
|
|
HKPao (Hunter-killer peptide ao) is a biologically active peptide. HKPao (Hunter-killer peptide ao) has anti-obesity and anti-tumor pro-apoptotic activity to cause release of cytochrome c from vesicles .
|
-
- HY-P1118A
-
-
- HY-P1723
-
Spexin
1 Publications Verification
Neuropeptide Q
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Spexin is a conserved peptide plays roles of neurotransmitter/neuromodulator and endocrine factor. Spexin peptide contains numerous aromatic amino acids and is probably amidated .
|
-
- HY-P2599
-
-
- HY-P2480
-
|
|
CDK
|
Others
|
|
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .
|
-
- HY-P10076
-
|
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
- HY-P2276A
-
-
- HY-P2244A
-
|
|
YAP
|
Cancer
|
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of?YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM) .
|
-
- HY-P1188A
-
|
|
Integrin
|
Cancer
|
|
LDV-FITC TFA, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC TFA binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC TFA can be used to detect α4β1 integrin affinity .
|
-
- HY-P5156
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
-
- HY-P10738A
-
|
|
Formyl Peptide Receptor (FPR)
|
Infection
|
|
N-Formyl-MMYALF TFA is a mitochondrial N-formyl peptide that has the activity of depleting calcium ions in the endoplasmic reticulum. N-Formyl-MMYALF TFA can inhibit the FPR-1-mediated chemotactic response of PMNs to bacterial peptides .
|
-
- HY-P2243
-
|
|
JNK
|
Neurological Disease
|
|
D-JBD19 is an impermeable peptide that serves as an inactive control for the JNK inhibitor D-JNKI1 (HY-P0069). D-JNKI1 has neuroprotective effects .
|
-
- HY-107024
-
|
OGP(10-14); Historphin
|
Src
|
Others
|
|
Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor .
|
-
- HY-P4003
-
-
- HY-P5588
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P4336
-
|
|
Carboxypeptidase
|
Others
|
|
Dansyl-Ala-Arg is a synthetic peptide. Dansyl-Ala-Arg can be used for various biochemical studies .
|
-
- HY-P3920
-
|
|
PKA
|
Cancer
|
|
Cys-Kemptide is a cysteine-terminated substrate peptide that can used to measure protein kinase A (PKA) activity .
|
-
- HY-P3782
-
-
- HY-P6010
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP is a selective αvβ6 binding peptide, and can be used for molecular imaging .
|
-
- HY-P0179
-
-
- HY-P3615
-
-
![[Asn18] Endothelin-1, human](//file.medchemexpress.com/product_pic/hy-p3615.gif)
- HY-P10533
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Cysteine peptide is a heptapeptide containing a cysteine residue whose thiol group makes it susceptible to a range of oxidative modifications. Cysteine peptide is used to detect the skin sensitization potential of chemicals including cosmetic ingredients .
|
-
- HY-P1138
-
|
FSVYWAQADR
|
Gap Junction Protein
|
Others
|
|
Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
|
-
- HY-P10409
-
|
Small humanin-like peptide 2
|
Apoptosis
|
Others
|
|
SHLP2 (Small humanin-like peptide 2) is a small molecule peptide encoded by mitochondrial DNA, belonging to mitochondria derived peptide. SHLP2 has the activity of regulating apoptosis and inhibits cell death. SHLP2 can be used in the study of diseases related to mitochondrial dysfunction and anti-aging diseases .
|
-
- HY-P10738
-
|
|
Formyl Peptide Receptor (FPR)
|
Infection
|
|
N-Formyl-MMYALF is a potent mitochondrial N-formyl peptide (mtFP) that has the activity of depleting calcium ions in the endoplasmic reticulum. N-Formyl-MMYALF can inhibit the FPR-1-mediated chemotactic response of polymorphonuclear leukocytes (PMNs) to bacterial peptides .
|
-
- HY-W540122
-
-
- HY-P2162
-
|
|
Myosin
|
Cancer
|
|
Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .
|
-
- HY-P3129
-
|
|
Ras
|
Inflammation/Immunology
Cancer
|
|
KRAS G13D peptide, 25 mer, a KRAS activating oncogene mutation peptide, is an immune potentiator extracted from patent WO2018144775A1. KRAS G13D peptide, 25 mer can be used to prepare KRAS vaccine .
|
-
- HY-P3797
-
|
|
Furin
|
Cancer
|
|
Furin Substrate is an peptide. Furin Substrate can be used for the research of various biochemical .
|
-
- HY-P6010A
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP TFA is a selective αvβ6 binding peptide, and can be used for research of molecular imaging .
|
-
- HY-P0179A
-
-
- HY-P4086
-
|
|
RABV
|
Infection
|
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction .
|
-
- HY-P2005
-
|
|
Reactive Oxygen Species
SOD
|
Others
|
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
-
- HY-P2457
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS .
|
-
- HY-P3550
-
-
- HY-P10686
-
|
|
EGFR
|
Cancer
|
|
CH401 peptide is a HER2-derived antigen peptide. After being bound to the artificial viral capsid by a self-assembled β-cyclic peptide, CH401 peptide is encapsulated in a lipid bilayer containing the lipid adjuvant α-GalCer, and can be studied as a self-adjuvant anti-breast cancer vaccine candidate .
|
-
- HY-P5425A
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
Tetanus Toxin (830–844) TFA is a biological active peptide. (tetanus toxin-derived peptide TT830–844 CD4 + T-cell epitope. This promiscuous CD4 + T-cell epitope can bind to a wide range of HLA–DRB molecules and is thus expected to activate CD4 + T-cell responses in a large part of the human population) .
|
-
- HY-P2292A
-
|
|
Bacterial
Fungal
|
Infection
|
|
Omiganan, FITC labeled TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections .
|
-
- HY-P3774
-
-
![[Tyr8]-Atrial Natriuretic Peptide (5-27), rat](//file.medchemexpress.com/product_pic/hy-p3774.gif)
- HY-P10200
-
|
|
Bacterial
|
Infection
|
|
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .
|
-
- HY-P3814
-
|
|
Ribosomal S6 Kinase (RSK)
|
Cancer
|
|
S6 Kinase Substrate Peptide 32 is a substrate of Ribosomal S6 Kinase (RSK). S6 Kinase Substrate Peptide 32 can be used to measure the activity of RSKs which phosphorylate ribosomal protein S6 .
|
-
- HY-151496
-
|
|
Others
|
Others
|
|
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences .
|
-
- HY-P2170
-
|
XOMA-629
|
Antibiotic
Bacterial
|
Infection
Inflammation/Immunology
|
|
XMP-629 (XOMA-629), a cationic α-helical peptide, is a potent endotoxin inhibitor. XMP-629 exhibits broad-spectrum antimicrobial activity via an immunomodulatory mechanism. XOMA 629 has antimicrobial activity against Propionibacterium acnes, Staphylococcus aureus and Streptococcus pyogenesand .
|
-
- HY-13443
-
-
- HY-P0270
-
|
Magainin II
|
Bacterial
Antibiotic
Fungal
|
Infection
|
|
Magainin 2 (Magainin II) is an?antimicrobial?peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa . Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes .
|
-
- HY-P10508
-
|
|
Bacterial
Apoptosis
|
Infection
Cancer
|
|
Pantinin-1 is an antimicrobial peptide found in the venom of the Pandinus imperator scorpion. Pantinin-1 has potent antimicrobial activity against Gram-positive bacteria and fungi, weak antimicrobial activity against Gram-negative bacteria, and very low hemolytic activity against human erythrocytes. Pantinin-1 also has anticancer activity and can induce apoptosis in tumor cells .
|
-
- HY-P3921
-
|
|
Casein Kinase
|
Cancer
|
|
Casein Kinase II Substrate is a casein kinase II (CK2) peptide substrate that can be selectively phosphorylated by CK2 .
|
-
- HY-P3588
-
|
|
Biochemical Assay Reagents
|
Others
|
|
N-Acetyl semax amidate is a biologically active peptide. N-Acetyl semax amidate can be used for the research of various biochemical studies.
|
-
- HY-P1333
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A can induce neuronal death, and can be used in the research of neurological disease .
|
-
- HY-P10338
-
-
- HY-P4334
-
|
Bz-Arg-Gly-Phe-Phe-Leu-4MβNA
|
Fluorescent Dye
|
Others
|
|
Bz-RGFFL-4MβNA (Bz-Arg-Gly-Phe-Phe-Leu-4MβNA) is a peptide and can be used fluorogenic substrate .
|
-
- HY-P10570
-
|
|
Histone Methyltransferase
|
Cancer
|
|
[Nle20] H4 peptide (16−23) is a peptide with strong inhibitory activity against histone methyltransferase SETD8 (Kd=0.14 μM), which inhibits SETD8's methylation of histone H4 by competing with SETD8's substrate binding site. [Nle20] H4 peptide (16−23) can be used as a lead compound for anticancer therapy .
|
-
![[Nle20] H4 peptide (16−23)](//file.medchemexpress.com/product_pic/hy-p10570.gif)
- HY-W046355
-
-
- HY-16027A
-
|
|
GnRH Receptor
|
Endocrinology
|
|
Acyline TFA, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels .
|
-
- HY-W048209
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Lys(Palmitoyl)-OH is a Fmoc-amino acid with long alkyl chains. Fmoc-Lys(Palmitoyl)-OH can be used for peptide synthesis .
|
-
- HY-P10540
-
|
|
Bacterial
|
Infection
|
|
Pantinin-2 is a cysteine-free toxic peptide found in the emperor scorpion (paninus imperator). Pantinin-2 has high activity against Gram-positive bacteria but weak activity against Gram-negative bacteria. Pantinin-2 also exhibits activity against Candida tropicalis and has relatively mild hemolytic activity against human erythrocytes. Pantinin-2 can be used in the development of antimicrobial drugs for drug-resistant pathogens .
|
-
- HY-P1402
-
|
|
PKC
|
Others
|
|
[Glu27]-PKC (19-36) is an inactive control for protein kinase C (PKC) (19-36). PKC (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C, it may be responsible for maintaining the enzyme in the inactive form in the absence of allosteric activators such as phospholipids .
|
-
![[Glu27]-PKC (19-36)](//file.medchemexpress.com/product_pic/hy-p1402.gif)
- HY-W101495
-
|
N-Boc-L-leucine monohydrate
|
Amino Acid Derivatives
|
Others
|
|
Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .
|
-
- HY-P10501
-
|
|
Antifolate
|
Cancer
|
|
FRα-targeting peptide C7 is a selective peptide ligand for folate receptor α (FRα) that has specific binding to FRα expressing cells and in vivo tumor targeting ability. FRα-targeting peptide C7 can be used in the research of tumor diagnosis and treatment .
|
-
- HY-P1610
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Asudemotide (S-588410) is a peptide of human DEP domain-containing protein 1A. Asudemotide is an immunostimulant. Asudemotide has a sequence of H-Glu-Tyr-Tyr-Glu-Leu-Phe-Val-Asn-Ile-OH. Asudemotide induces a tumor immune response in esophageal cancer. .
|
-
- HY-P3557A
-
-
- HY-P10814
-
|
|
Bacterial
|
Infection
|
|
MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation .
|
-
- HY-P5939
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Angiotensinogen (1-13) (human) is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .
|
-
- HY-P4232
-
-
- HY-P5555
-
|
|
Bacterial
|
Infection
|
|
LMW peptide is an antimicrobial peptide. LMW peptide is active against Gram-positive and Gram-negative bacterial, such as B. subtilis, L. monocytogenes, E. coli, P. aeruginosa, V. cholera .
|
-
- HY-P10565
-
|
|
Bacterial
|
Infection
|
|
(RFR)4XB is a cationic membrane-penetrating peptide. (RFR)4XB carries its cargo (the antisense oligomer) across the outer membrane of gram-negative bacteria .
|
-
- HY-P2292
-
|
|
Bacterial
Fungal
|
Infection
|
|
Omiganan, FITC labeled is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines .
|
-
- HY-P3738
-
-
- HY-P10082
-
|
|
Caspase
|
Others
|
|
Ac-VETD-AMC is a synthetic peptide substrate for caspase 8. Ac-VETD-AMC also has potential to assess functional activity of recombinant phytaspase .
|
-
- HY-P3302
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sialylglycopeptide is a complex N-glycan, bearing a short peptide fragment. Sialylglycopeptide, as a starting material for the semi-synthesis of N-glycans, can be used for various researches .
|
-
- HY-W002450
-
|
|
Drug Derivative
|
Cardiovascular Disease
|
|
L-Cyclohexylalanine is an amino acid derivative. L-Cyclohexylalanine modifies an atrial natriuretic peptide, regulates homeostasis of body fluid and blood pressure homeostasis and vasodilation activity .
|
-
- HY-P2784
-
-
![[Tyr8]-Substance P](//file.medchemexpress.com/product_pic/hy-p2784.gif)
- HY-P0261A
-
|
|
Bacterial
|
Infection
|
|
Indolicidin acetate is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils .
|
-
- HY-P0328
-
|
|
VSV
|
Infection
|
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10544
-
|
|
Interleukin Related
|
Others
|
|
Humanized anti-tac (HAT) binding peptide is a peptide that can specifically bind to the Fc region of HAT. HAT is a humanized monoclonal antibody against the low affinity p55 subunit of the interleukin IL-2 receptor. Humanized anti-tac (HAT) binding peptide can be used to develop affinity chromatography media to purify specific monoclonal antibodies .
|
-
- HY-P4118
-
|
Penetrating analog
|
Amino Acid Derivatives
|
Others
|
|
EB1 peptide (Penetrating analog), a Penetratin peptide derivative, is an amphipathic cell-penetrating peptide (CPP). EB1 peptide has the potential for intracellular drug delivery research .
|
-
- HY-P3820
-
-
![[Dehydro-Pro4] Substance P (4-11)](//file.medchemexpress.com/product_pic/hy-p3820.gif)
- HY-P10609
-
|
|
Btk
|
Others
|
|
Btk substrate peptide is a peptide substrate corresponding to residues 217-229 of human Bruton’s tyrosine kinase (Btk), of which the tyrosine at residue 223 is the major autophosphorylation site of Btk. Btk substrate peptide is used as a substrate in in vitro kinase assays to evaluate the activity of Btk or other tyrosine kinases .
|
-
- HY-P1556
-
|
|
PKG
|
Cardiovascular Disease
|
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P2473
-
|
|
Calmodulin
PKC
CaMK
PKA
|
Neurological Disease
|
|
Neurogranin (48-76), human is a dominant endogenous peptide in Alzheimer's disease (AD) brain tissue. Neurogranin (48-76) is a potential biomarker for synaptic function in AD .
|
-
- HY-P3610
-
|
|
Endothelin Receptor
|
Others
|
|
[Ala18] Endothelin-1, human is a biologically active peptide. [Ala18] Endothelin-1, human can be used for the research of various biochemical studies.
|
-
![[Ala18] Endothelin-1, human](//file.medchemexpress.com/product_pic/hy-p3610.gif)
- HY-P5556
-
|
|
Bacterial
|
Infection
|
|
KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. aeruginosa. .
|
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P3543
-
-
- HY-P3147
-
|
|
Drug Metabolite
|
Others
|
|
IYPTNGYTR, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR can be used to monitor in vivo Trastuzumab metabolism .
|
-
- HY-P3147A
-
|
|
Drug Metabolite
|
Others
|
|
IYPTNGYTR acetate, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR acetate can be used to monitor in vivo Trastuzumab metabolism .
|
-
- HY-P3141
-
-
- HY-P5811
-
|
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
-
- HY-P0261B
-
|
|
Bacterial
|
Infection
|
|
Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils .
|
-
- HY-P10546
-
|
pALA
|
Bacterial
|
Infection
|
|
Polyalanine peptide (pALA) is an antimicrobial peptide that targets biofilms and Gram-negative bacteria and is non-toxic to mammalian cells. Polyalanine peptide forms an α-helical conformation that effectively permeabilizes Gram-negative bacterial membranes, thereby inducing lethal cell leakage. Polyalanine peptide can be used in anti-infection research .
|
-
- HY-P0239
-
|
|
Influenza Virus
|
Inflammation/Immunology
|
|
HA Peptide (HA tag) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry.
|
-
- HY-P0223
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
FLAG peptide is a multifunctional fusion tag for the purification of recombinant proteins. FLAG peptide maintances the natural folding of its fusing proteins. FLAG peptide can be removed by enterokinase, and eluted under non-denaturing conditions .
|
-
- HY-P4111
-
|
|
CXCR
|
Cancer
|
|
Peptide R, a cyclic peptide, is a specific CXCR4 antagonist. Peptide R shows outstanding capacities to profoundly remodel the tumor stroma. Peptide R has the potential for tumor research .
|
-
- HY-P1312
-
-
- HY-P3258
-
|
|
Cholinesterase (ChE)
|
Infection
|
|
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
|
-
- HY-P1556A
-
|
|
PKG
|
Metabolic Disease
|
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P3149B
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK acetate, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK acetate can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α .
|
-
- HY-P3149
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α .
|
-
- HY-P2311
-
-
- HY-P10000
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion .
|
-
- HY-P4135
-
|
|
Fluorescent Dye
|
Others
|
|
FITC-LC-Antennapedia Peptide is a FITC labeled Antennapedia Peptide (HY-P0307). Antennapedia Peptide is a cellular-membrane permeable peptides (CPP). FITC-LC-Antennapedia Peptide has good penetration in 3T3 cell line, which was rapidly accumulated into nuclei .
|
-
- HY-P4108
-
|
|
Influenza Virus
|
Infection
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
- HY-P5558
-
|
|
VEGFR
|
Inflammation/Immunology
|
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
- HY-P3759
-
-
- HY-P3551
-
|
|
Biochemical Assay Reagents
|
Others
|
|
[Ala2] Met-Enkephalinamide is an active peptide. [Ala2] Met-Enkephalinamide can be used for the research of various biochemical studies .
|
-
![[Ala2] Met-Enkephalinamide](//file.medchemexpress.com/product_pic/hy-p3551.gif)
- HY-P1312A
-
-
- HY-P3146
-
|
|
Drug Metabolite
|
Cancer
|
|
FTISADTSK is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM) .
|
-
- HY-P3146A
-
|
|
Drug Metabolite
|
Cancer
|
|
FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM) .
|
-
- HY-P5960
-
|
PTBP1 α3-helix derived peptide P6 TFA
|
DNA/RNA Synthesis
|
Others
|
|
PTBP1-RNA-binding inhibitor P6 (PTBP1 α3-helix derived peptide P6) TFA is a stapled peptide inhibitor of the splicing factor PTBP1, which inhibits alternative splicing events regulated by PTBP1. PTBP1 binds RNA through its RNA recognition motif .
|
-
- HY-P1054
-
|
YNVYGIEEVKI
|
PKC
|
Neurological Disease
|
|
pep2-EVKI (YNVYGIEEVKI) is an inhibitor peptide that selectively blocks PICK1 interactions, caused the opposite effects on synaptic AMPAR function to PICK1 expression .
|
-
- HY-P6020
-
|
|
Biochemical Assay Reagents
|
Others
|
|
HBpep-SA is a cell membrane-permeable peptide condensate that phase separates to form stable droplets at pH values below 6.5. HBpep-SA is able to directly and efficiently deliver a variety of macromolecules, ranging from therapeutic peptides as small as 726 Da to large enzymes as large as 430 kDa, and the loaded condensates remain stable under near-physiological and serum conditions until internalized by cells. HBpep-SA can be used for intracellular delivery of large numbers of macromolecules and as a vector for mRNA-based vaccines .
|
-
- HY-P6020B
-
|
|
Biochemical Assay Reagents
|
Others
|
|
HBpep-SA acetate is a cell membrane-permeable peptide condensate that phase separates to form stable droplets at pH values below 6.5. HBpep-SA acetate is able to directly and efficiently deliver a variety of macromolecules, ranging from therapeutic peptides as small as 726 Da to large enzymes as large as 430 kDa, and the loaded condensates remain stable under near-physiological and serum conditions until internalized by cells. HBpep-SA acetate can be used for intracellular delivery of large numbers of macromolecules and as a vector for mRNA-based vaccines .
|
-
- HY-P0319
-
|
|
Biochemical Assay Reagents
|
Others
|
|
3X FLAG peptides are FLAG-tagged peptides containing three repeats of the Asp-Tyr-Lys-Xaa-Xaa-Asp motif. 3X FLAG peptide can be used for protein separation and purification, and competitive elution with target proteins.
|
-
- HY-P3062
-
-
![[Tyr11]-Somatostatin](//file.medchemexpress.com/product_pic/hy-p3062.gif)
- HY-W000665
-
|
Dmt
|
Opioid Receptor
|
Neurological Disease
|
|
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides .
|
-
- HY-131092
-
-
- HY-P3915
-
|
|
Bacterial
|
Infection
|
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity .
|
-
- HY-P3149A
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK TFA, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK TFA can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α .
|
-
- HY-P5638
-
|
|
Bacterial
|
Infection
|
|
FLGFVGQALNALLGKL-NH2 is an antimicrobial peptide of frog origin. FLGFVGQALNALLGKL-NH2 has activity against Staphylococcus aureus ATCC 29213 (MIC=32 μM) .
|
-
- HY-P10805
-
|
|
HIV
|
Infection
|
|
Capsid assembly inhibitor is a 12-mer peptide that binds the capsid (CA) domain of Gag and inhibits assembly of immature- and mature-like HIV-1 capsid particles in vitro .
|
-
- HY-P3440
-
|
|
Radionuclide-Drug Conjugates (RDCs)
PD-1/PD-L1
|
Cancer
|
|
WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression .
|
-
- HY-P10163
-
|
|
Fluorescent Dye
|
Others
|
|
α-Secretase Substrate II, Fluorogenic is an internally quenched fluorogenic peptide substrate for α-Secretase that contains the α-secretase cleavage site of β-Amyloid precursor protein (APP) .Ex/Em = 340/490 nm
|
-
- HY-P0132
-
|
Laminin Fragment 929-933
|
NO Synthase
|
Cancer
|
|
YIGSR is a peptide that can inhibit the tumour growth and metastasis of leukaemic cells . YIGSR blocks the cellular binding to laminin I via a 67-kDa laminin-binding protein, and inhibits shear-induced increase in eNOS expression of laminin cells .
|
-
- HY-P5038
-
|
c(GRGDSP)
|
Integrin
|
Cancer
|
|
Cyclo(Gly-Arg-Gly-Asp-Ser-Pro) (c(GRGDSP)) is an RGD-containing inhibitory peptide. Cyclo(Gly-Arg-Gly-Asp-Ser-Pro) is a synthetic α5β1 integrin ligand that competitively inhibits the binding of invasin (Inv) to α5β1 integrin expressed on Caco-2 cells .
|
-
- HY-P10164
-
|
|
Wnt
|
Cancer
|
|
Pen-N3 is a PDZ peptide. Pen-N3 inhibits Wnt/b-catenin signaling by recognizing dishevelled protein .
|
-
- HY-P5164
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel， with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively .GrTx1 can be used for neurological disease research .
|
-
- HY-W013123
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Phe(4-CF3)-OH is Phenylalanine derivative. Fmoc-D-Phe(4-CF3)-OH can be used for the research of peptide inhibitors of protein-protein interactions .
|
-
- HY-P3414
-
|
|
Proteasome
|
Neurological Disease
|
|
Proteasome-activating peptide 1 is a peptide, which increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1 prevents protein aggregation in a cellular model of amyotrophic lateral sclerosis .
|
-
- HY-131094
-
|
|
Others
|
Others
|
|
H-Gly-D-Tyr-OH is used for the the solid-phase peptide synthesis.
|
-
- HY-P5913
-
-
![[Tyr6]-Angiotensin II](//file.medchemexpress.com/product_pic/hy-p5913.gif)
- HY-P1280
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P3914
-
|
Oct-CA(1-7)M(2-9)
|
Bacterial
|
Infection
|
|
Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide with antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative aerobic bacteria, as well as antimalarial activity, without the adverse hemolytic properties of bee venom peptides .
|
-
- HY-P10675
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
Peptide K is a self-assembling peptide fiber that can be used to prepare fibrous nanocomposite hydrogels. The fibrous nanocomposite hydrogels have a dynamic network that adapts to cells and enhances cell-matrix and cell-cell interactions, thus significantly promoting the mechanotransduction, metabolic energy, and osteogenesis of encapsulated stem cells .
|
-
- HY-P0014
-
-
- HY-P2178
-
|
|
HDAC
|
Cancer
|
|
Dihydrochlamydocin analog-1 (compound 2) is a Chlamydocin (HY-115761) analogue that inhibits histone H4 peptide deacetylation with IC50 of 30 nM .
|
-
- HY-P10604
-
|
|
Antibiotic
Bacterial
|
Others
|
|
SP2 is a 14-amino acid long active peptide that can induce growth arrest in MTLa cells of the mating type locus of Candida albicans .
|
-
- HY-P4055
-
-
- HY-P3715
-
|
|
MHC
|
Inflammation/Immunology
|
|
OVA peptide mainly exists in egg white, it is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC). OVA peptide has been widely studied in allergy research .
|
-
- HY-P10803
-
|
|
SARS-CoV
|
Infection
|
|
FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to SARS-CoV-2 receptor-binding domain (RBD). FLDKFNHEAEDLFYQSSL inhibits the entry of SARS-Cov-2. FLDKFNHEAEDLFYQSSL also interacts with binding residues (Leu455, Phe456, Ala475 and Gln493) .
|
-
- HY-P10628
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β Amyloid (1-14), human is a peptide fragment of β-amyloid protein (Aβ), which is obtained by hydrolysis of Aβ1-40 peptide by catalytic antibody light chain #7TR. β Amyloid (1-14), human can be used for Alzheimer's disease research .
|
-
- HY-P2043
-
|
|
Ser/Thr Protease
|
Others
|
|
Cyanopeptolin 954 is a sedimentation peptide isolated from the freshwater cyanobacterium Microcystis aeruginosa NIVA Cya 43. Cyanopeptolin 954 inhibits chymosin with an IC50 value of 45 nM .
|
-
- HY-P3580
-
|
Human N-acetyl GIP
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P10169
-
|
|
Proteasome
|
Others
|
|
Acetyl-Calpastatin(184-210)(human), Negative Control is a control scramble peptide of Acetyl-Calpastatin(184-210)(human) (HY-P1081). Acetyl-Calpastatin(184-210)(human) is a potent, selective and reversible calpain inhibitor .
|
-
- HY-N7122
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
Cancer
|
|
Thymopentin is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs) .
|
-
- HY-N7122A
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
Cancer
|
|
Thymopentin acetate is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin acetate is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin acetate enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs) .
|
-
- HY-P3555
-
-
- HY-P5916
-
|
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Others
Potassium Channel
|
Neurological Disease
|
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
-
- HY-P4391
-
-
- HY-P10613
-
|
|
Amyloid-β
|
Neurological Disease
|
|
RERMS are bioactive peptides produced from the active regions of amyloid-β and A4 protein precursors that promote fibroblast growth and can be used in the study of neurodegenerative diseases .
|
-
- HY-P1439
-
-
- HY-P10548
-
|
|
Bacterial
|
Infection
|
|
Cyclic L27-11 is a cyclic peptide-like antibiotic with strong antibacterial activity against specific bacteria such as Pseudomonas sp. Cyclic L27-11 shows nanomolar antibacterial activity against Pseudomonas sp., especially Pseudomonas aeruginosa. Cyclic L27-11 interferes with the function of bacterial outer membrane protein LptD, preventing the normal transport of lipopolysaccharide (LPS), leading to the accumulation of membrane-like substances in bacterial cells, which in turn affects the survival of bacteria. Cyclic L27-11 can be used in the development of antibacterial agents .
|
-
- HY-P10224
-
|
|
EGFR
|
Cancer
|
|
G7-18NATE is a peptide inhibitor of Grb7. HY-P10224 binds to the Grb7-SH2 domain with micromolar affinity (KD = 18.1 μM). G7-18NATE inhibits cell proliferation, motility, cell invasion and 3D culture formation in several cancer cell lines .
|
-
- HY-P3580A
-
|
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P1962
-
|
[Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)
|
Beta-secretase
|
Neurological Disease
|
|
β-Secretase inhibitor ([Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)) is a β-secretase and BACE1 inhibitor (IC50: 25 nM for β-secretase) .
|
-
- HY-P10846
-
|
|
Isotope-Labeled Compounds
|
Cardiovascular Disease
|
|
HYNIC-CTP is a conjugate of HYNIC and CTP (cardiac-targeting peptide). HYNIC-CTP can bind with the radionuclide 99mTc through HYNIC acting as a chelator, forming 99mTc-HYNIC-CTP. 99mTc-HYNIC-CTP is specifically taken up by the heart and used for cardiac imaging, thereby facilitating research into heart diseases .
|
-
- HY-W714002
-
|
|
HIV
Bacterial
|
Infection
|
|
Feglymycin is a HIV replication inhibitor. Feglymycin is also an antibiotic peptide that has antibacterial activity (MIC: 32-64 μg/mL for Staphylococcus aureus) .
|
-
- HY-P10706
-
-
- HY-P3555A
-
|
|
Opioid Receptor
|
Others
|
|
D-Ala-Gly-Phe-Met-NH2 monoacetate, an opioid peptide, is a potent opiate δ-receptor agonist .
|
-
- HY-P1520
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P1520A
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P3540
-
-
- HY-P10825
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
p21PBP, a 20 amino-acid peptide, is an inhibitor of DNA replication. p21PBP specifically binds to purified proliferating cell nuclear antigen (PCNA) in tumour cell extracts. p21PBP is promising for research of cancers .
|
-
- HY-P1866A
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .
|
-
- HY-P1043
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide containing the Asn-Gly-Arg (NGR) motif. NGR peptide binds to APN/CD13. NGR peptide is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-P0136F
-
|
|
AMPK
|
Others
|
|
FAM-SAMS is a 5-FAM (HY-66022) labeled SAMS (HY-P0136). SAMS peptide is a specific substrate for the AMP-activated protein kinase (AMPK) .
|
-
- HY-P3744
-
|
|
EGFR
|
Others
|
|
pp60v-src Autophosphorylation site is a synthetic peptide. pp60v-src Autophosphorylation site can be used for various biochemical studies .
|
-
- HY-P10547
-
|
MAC-1 peptide
|
Bacterial
|
Infection
|
|
Macropin (MAC-1 peptide) is an antimicrobial peptide found in the venom of the solitary bee Macropis fulvipes. Macropin has antibacterial activity against both Gram-positive and Gram-negative bacteria, and also exhibits inhibitory activity against fungi and moderate hemolytic activity against human erythrocytes. Macropin can be used in research on anti-infective therapy .
|
-
- HY-P1856
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
Proinsulin C-peptide (human) is a 31-amino-acid peptide that links the A and B chains of proinsulin, ensuring its correct folding, which is biologically active and modulates cellular function .
|
-
- HY-P0312
-
|
|
c-Myc
|
Cancer
|
|
c-Myc Peptide (TFA) is a synthetic peptide corresponding to the C-terminal amino acids (410-419) of human c-myc protein, and participates in regulation of growth-related gene transcription.
|
-
- HY-P10437
-
|
human α1-AT(353-372)
|
HIV
|
Infection
|
|
VIRIP (human α1-AT(353-372)) is a HIV-1 inhibitor. VIRIP blocks the entry of HIV-1 by interacting with gp41 fusion peptide. VIRIP can be used for virus research .
|
-
- HY-P1426A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P10224A
-
|
|
EGFR
|
Cancer
|
|
G7-18NATE TFA is a peptide inhibitor of Grb7. G7-18NATE TFA binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM). G7-18NATE TFA inhibits cell proliferation, motility, cell invasion and 3D culture formation in several cancer cell lines .
|
-
- HY-P1363
-
|
Amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-W097054
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-L-cysteic acid is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize triarylsulfonium compounds for radiolabeling of peptides .
|
-
- HY-P5923
-
|
|
CXCR
|
Inflammation/Immunology
|
|
E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
|
-
- HY-P2452
-
|
|
Integrin
|
Cancer
|
|
Vitronectin (367-378) is a peptide corresponding to residues 367-378 of Vitronectin. Vitronectin is a multifunctional glycoprotein known in several human tumors for its adhesive role in processes such as cell growth, angiogenesis and metastasis .
|
-
- HY-P3981
-
-
- HY-W048739
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-α-Me-Leu-OH is a leucine derivative with an Fmoc protecting group, which can be used to synthesize peptides with oxytocin receptor agonist activity .
|
-
- HY-P3596
-
|
Mouse growth hormone-releasing factor
|
GHSR
|
Endocrinology
|
|
GHRF, mouse, a mouse growth hormone-releasing factor, is a peptide containing 44 amino acids. GHRF, mouse stimulates the release and synthesis of growth hormone .
|
-
- HY-P3707
-
|
|
Apoptosis
|
Cancer
|
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice .
|
-
- HY-P4042
-
|
hepatitis B peptide 4980
|
HBV
|
Infection
Inflammation/Immunology
|
|
Hepatitis B Virus Receptor Binding Fragment (hepatitis B peptide 4980) is a synthetic peptide analog which specifically binds to Hep G2 cells. Hepatitis B Virus Receptor Binding Fragment is a promising immunogen expected to elicit protective antibodies based on the concept of the attachment blockade pathway of virus neutralization .
|
-
- HY-P1453
-
|
|
STAT
|
Cancer
|
|
CMD178 is a lead peptide that consistently reduced the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling and inhibits Treg cell development .
|
-
- HY-P4058
-
|
CGRP free acid
|
CGRP Receptor
|
Neurological Disease
|
|
Calcitonin gene-related peptide (CGRP) free acid is the deamidated form of α-CGRP(human) (HY-P1071). Calcitonin gene-related peptide can be used to study the effect of C-terminal amidation on CGRP .
|
-
- HY-P3508
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-27, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 is an anticancer peptide. PNC-27 can be used in acute myeloid leukemia research .
|
-
- HY-P4111A
-
|
|
CXCR
|
Cancer
|
|
Peptide R (TFA) is a synthetic and specific CXCR4 antagonist. Peptide R (TFA) shows outstanding capacities to remodel the tumor stroma. Peptide R (TFA) can be used for solid tumor (glioblastoma, etc.) research .
|
-
- HY-P0120
-
|
LY2189265
|
GCGR
|
Metabolic Disease
|
|
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Dulaglutide can be uesd for the research of type 2 diabetes (T2D) .
|
-
- HY-P3278
-
|
|
Proton Pump
|
Metabolic Disease
|
|
Caloxin 2A1 is an extracellular plasma membrane Ca 2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 does not affect basal Mg 2+-ATPase or Na +-K +-ATPase .
|
-
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P3621
-
|
|
GCGR
|
Metabolic Disease
|
|
Biotinyl-Glucagon (1-29), human, bovine, porcine is a biotinylated glucagon. Glucagon is a peptide hormone, produced by α-cells of the pancreas, can increase concentration of glucose and fatty acids in the bloodstream .
|
-
- HY-P2196
-
-
- HY-P3414A
-
|
|
Proteasome
|
Neurological Disease
|
|
Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1 TFA prevents protein aggregation in a cellular model of amyotrophic lateral sclerosis .
|
-
- HY-148197
-
-
- HY-P1453A
-
|
|
STAT
|
Cancer
|
|
CMD178 TFA is a lead peptide that consistently reduced the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling and inhibits Treg cell development .
|
-
- HY-16498
-
|
PCK-3145
|
Apoptosis
|
Cancer
|
|
Tigapotide (PCK-3145) is an anti-tumour peptide that reduces the development of skeletal metastases associated with prostate cancer. Tigapotide induces apoptosis and reduces tumour parathyroid hormone-related peptide (PTHrP) levels .
|
-
- HY-P3695
-
|
|
FGFR
|
Cancer
|
|
VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation .
|
-
- HY-P0191
-
-
- HY-P3863
-
|
|
Ser/Thr Protease
|
Inflammation/Immunology
|
|
Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas .
|
-
- HY-W019032
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Dab(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize peptides with antibacterial activity .
|
-
- HY-138982
-
-
- HY-P4931
-
|
Mca-Lys-Pro-Leu-Gly-Leu-Dpa-Ala-Arg-NH2
|
MMP
|
Cancer
|
|
Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 (FS-6) is a fluorescent peptide that is a quenched MMP peptide substrate. Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 can be used for real-time quantification of MMP enzymatic activity. Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is an elongated peptide of MMP substrate (FS-1) and is active against collagenases (MMP-1, MMP-8, MMP-13 ) and MT1-MMP with higher specificity constants than FS-1 . (Ex/Em=325 nm/400 nm)
|
-
- HY-P3632
-
|
DADAD
|
Opioid Receptor
|
Neurological Disease
Metabolic Disease
|
|
[DAla2, DArg6] Dynorphin A, (1-13) (porcine) (DADAD) is an opioid peptide (dynorphinl-13, DYN) derivative found in porcine pituitary extracts. DYN is highly potent at the peripheral opioid receptors GPI and MVD, but is readily and rapidly degraded in vivo. [DAla2, DArg6] Dynorphin A, (1-13) (porcine) has some resistance to enzymatic cleavage and prevents peptide cleavage by enzymes .
|
-
![[DAla2, DArg6] Dynorphin A, (1-13) (porcine)](//file.medchemexpress.com/product_pic/hy-p3632.gif)
- HY-P3278A
-
|
|
Proton Pump
|
Metabolic Disease
|
|
Caloxin 2A1 TFA is an extracellular plasma membrane Ca 2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 TFA does not affect basal Mg 2+-ATPase or Na +-K +-ATPase .
|
-
- HY-P10741
-
-
- HY-P3722
-
|
|
Fluorescent Dye
MMP
|
Others
|
|
Mca-PLAQAV-Dpa-RSSSR-NH2 is a fluorescent peptide and as one of fluorescent substrates of TNF-α converting enzyme (TACE; ADAM17), ADAM 9 and ADAM 10. Mca-PLAQAV-Dpa-RSSSR-NH2 is a substrate based on fluorescence resonance energy transfer, and its activity can be determined by the change of fluorescence intensity during pyrolysis .
|
-
- HY-P3722A
-
|
|
Fluorescent Dye
MMP
|
Others
|
|
Mca-PLAQAV-Dpa-RSSSR-NH2 is a fluorescent peptide and as one of fluorescent substrates of TNF-α converting enzyme (TACE): ADAM17, ADAM 9 and ADAM 10. Mca-PLAQAV-Dpa-RSSSR-NH2 is a substrate based on fluorescence resonance energy transfer, and its activity can be determined by the change of fluorescence intensity during pyrolysis .
|
-
- HY-P3695A
-
|
|
FGFR
|
Cancer
|
|
VSPPLTLGQLLS TFA is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS TFA inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation .
|
-
- HY-P4096
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
HAP-1 is a synovial-targeted transduction peptide. HAP-1 facilitates specific internalization of protein complexes into human and rabbit synovial cells. HAP-1 fused to an antimicrobial peptide, (KLAK)2, to generate a proapoptotic peptide DP2 .
|
-
- HY-P10649
-
|
|
Fluorescent Dye
|
Cancer
|
|
CPP12 is a small, amphipathic, cyclic cell penetrating peptide (CPP). CPPs bind directly to the plasma membrane phospholipids and enter mammalian cells via endocytosis, followed by efficient release from the endosome. CPP12 can be used for intracellular delivery of therapeutic agents and chemical probes .
|
-
- HY-P10644
-
|
|
Fluorescent Dye
|
Cancer
|
|
CPP9 is a small, amphipathic, cyclic cell penetrating peptide (CPP). CPPs bind directly to the plasma membrane phospholipids and enter mammalian cells via endocytosis, followed by efficient release from the endosome. CPP9 can be used for intracellular delivery of therapeutic agents and chemical probes .
|
-
- HY-P3784
-
-
- HY-P1486
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .
|
-
- HY-109538
-
|
|
Secretin Receptor
|
Neurological Disease
Metabolic Disease
|
|
Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine cell subsets and can be prompted by fatty acids. Secretin stimulates the secretion of pancreatic water and bicarbonate. Secretin exerts various effects in organs, can be used for the research of digestive system, central nervous system and energy metabolism .
|
-
- HY-P3417
-
|
|
Bacterial
|
Infection
|
|
Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing potent and nontoxic antimicrobial agents. Amp1EP9 has the potential for the research of multidrug-resistant bacterial infections .
|
-
- HY-147279
-
|
|
LDLR
|
Others
|
|
Milpocitide is a low-density lipoprotein receptor (human LDL receptor, LDLR), (293-333)-peptide fragment (EGF-like domain 1) .
|
-
- HY-W140465
-
|
|
Drug Derivative
|
Others
|
|
L-Homotyrosine is a tyrosine derivative that can be used for solid-phase peptide synthesis .
|
-
- HY-P4136
-
|
|
ERK
|
Cancer
|
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM .
|
-
- HY-P0282
-
|
|
HIV
|
Infection
|
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-W036160
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .
|
-
- HY-P5020
-
|
|
Bacterial
|
Infection
Cancer
|
|
Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer .
|
-
- HY-P10114
-
|
PpYLKTK-mts; STAT3 PI
|
STAT
|
Cancer
|
|
STAT3-IN-24, cell-permeable (PpYLKTK-mts) is a STAT3 peptide inhibitor. STAT3-IN-24, cell-permeable inhibits recruitment of STAT3 to Jak2 and phosphorylation of Y705, thus preventing the dimerization and the nuclear translocation of STAT3 .
|
-
- HY-P4051
-
-
- HY-P5721
-
|
|
Bacterial
|
Infection
|
|
Apidaecin IA is an antibacterial peptide that can be found in honeybees .
|
-
- HY-P5943
-
-
- HY-P5942
-
-
- HY-P1421
-
|
|
PERK
GHSR
Apoptosis
|
Metabolic Disease
|
|
Obestatin(human) is a 23-amino acid amidated peptide that regulates appetite and gastrointestinal motility via its interaction with GPR39. Obestatin(human) can be used for weight loss. Obestatin(human) cannot penetrate the cell membrane .
|
-
- HY-P10116
-
|
APTscr-9R
|
STAT
|
Others
|
|
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
|
-
- HY-W008876
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II .
|
-
- HY-W010922
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bicyclic peptide tachykinin NK2 antagonists .
|
-
- HY-P10620
-
|
|
Bacterial
|
Others
|
|
GGGYK-Biotin is a substrate peptide designed to study the substrate specificity of Sortase A. GGGYK-Biotin can be used to develop Sortase A variants with different substrate specificities .
|
-
- HY-P5533
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
-
- HY-P1486A
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human TFA is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .
|
-
- HY-P10269
-
|
GZR18
|
GLP Receptor
|
Metabolic Disease
|
|
Bofanglutide (GZR18) is an analog of glucagon-like peptide-1 (GLP-1), which exhibits agonistic activity for GLP-1 receptor, with an EC50 of 0.677 nM. GZR18 ameliorates type 2 diabetes .
|
-
- HY-P5807A
-
|
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
-
- HY-P0282A
-
|
|
HIV
|
Infection
|
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-108988
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Albicidin is a peptide antibiotic with activity against various Gram-positive and Gram-negative microorganisms .
|
-
- HY-P3603
-
-
- HY-P0327
-
|
|
Biochemical Assay Reagents
|
Others
|
|
T7 Tag Peptide is a protein tag derived from the N-terminal 11 residues of the major T7 capsid protein, gp 10. T7 Tag Peptide can be used in different immunoassays as well as affinity purification .
|
-
- HY-P2244
-
|
|
YAP
|
Cancer
|
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of?YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM) .
|
-
- HY-W077219
-
|
Boc-Arg(Mtr)-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-Arg(Mtr)-OH (Boc-Arg(Mtr)-OH) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antithrombotic activity .
|
-
- HY-P2341
-
|
|
LDLR
|
Cancer
|
|
Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
-
- HY-P1026
-
-
- HY-P4083
-
|
|
Fluorescent Dye
|
Others
|
|
(Arg)9,TAMRA-labeled is a TAMRA-labeled cell permeable peptide. (Arg)9 is a cell-permeable peptide used for drug delivery .
|
-
- HY-P10519
-
|
|
Bacterial
|
Infection
|
|
Brevicidine is a non-ribosomally synthesized antimicrobial peptide with potent antibacterial activity against Gram-negative pathogens. Brevicidine disrupts the morphology of bacteria by binding to polysaccharides (LPS) on bacterial cell membranes to form holes .
|
-
- HY-P5107
-
|
LMWP
|
VEGFR
|
Cancer
|
|
Low molecular weight protamine is a cell-penetrating peptide with vascular endothelial growth factor (VEGF) inhibitory activity. Low molecular weight protamine can inhibit tumor growth and is used in cancer research .
|
-
- HY-P10601
-
-
- HY-P5727
-
|
|
Bacterial
|
Infection
|
|
HR1 is a mastoid protease. HR1 can increase the permeability of human erythrocyte membrane. HR1 can induce cytoplasmic membrane permeation in bacteria and mast cells .
|
-
- HY-106244A
-
|
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
DOTATATE acetate is a DOTA-conjugated peptide. DOTATATE acetate can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE (acetate) can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-106244
-
|
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
DOTATATE is a DOTA-conjugated peptide. DOTATATE can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) . DOTATATE can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-P4125
-
|
|
HIV
|
Others
|
|
FITC-LC-TAT (47-57) is a FITC labeled TAT peptide. TAT is a cell-penetrating peptide (CPP). TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-W101889
-
|
N-Boc-N'-xanthyl-L-glutamine
|
Amino Acid Derivatives
|
Others
|
|
Boc-Gln(Xan)-OH (N-Boc-N'-xanthyl-L-glutamine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antigenic activity .
|
-
- HY-P10684
-
|
|
Bacterial
|
Infection
|
|
Polyphemusin II is an antimicrobial peptide which can be isolated from Limulus polyphemus hemocytes. Polyphemusin II exhibits antimicrobial activities against various Gram (+)/(-) bacteria and fungi .
|
-
- HY-P2198
-
-
- HY-W013154
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as the biotinylated derivative of the opioid receptor antagonist TIPP .
|
-
- HY-P4776
-
-
- HY-P3429
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
- HY-78927
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-Boc-L-Prolinal is a proline with a Boc protecting group, which can be used to synthesize biologically active peptide mimetics, such as the synthesis of Dolastatin 10 (HY-15580) analogs with anti-colon cancer activity .
|
-
- HY-P4270
-
|
|
Neprilysin
|
Neurological Disease
|
|
Met-Arg-Phe-Ala is a peptide. Met-Arg-Phe-Ala also is a potent competitive inhibitor for enkephalin-generating endopeptidase (EGE). Met-Arg-Phe-Ala can be used for the research of neurological disease .
|
-
- HY-P2515
-
|
|
Histone Acetyltransferase
|
Others
|
|
Transcriptional Intermediary Factor 2 (TIF2) (740-753) is a TIF-2 coactivator peptide composed of 14 amino acids and covers the residue range 740-753 of TIF-2 protein .
|
-
- HY-P3798
-
|
|
Ser/Thr Protease
|
Others
|
|
Eglin c (41-49) is a peptide fragment related to eglin c. Eglin c (41-49) shows inhibitory effects to cathepsin G and α-chymotrypsin with Ki values of 42 and 20 μM, respectively .
|
-
- HY-D0889
-
-
- HY-P0104
-
-
- HY-P0261
-
|
|
Bacterial
|
Infection
|
|
Indolicidin is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
|
-
- HY-P0006
-
-
- HY-P5719
-
|
|
Bacterial
|
Infection
|
|
Andropin is a male-specific antibacterial peptide that can be found in Drosophila melanogaster .
|
-
- HY-P3530
-
|
|
Integrin
|
Others
|
|
G-{d-Arg}-GDSP is an RGD peptide analogue that binds to the adhesion receptor of integrins and inhibits cellular fibronectin attachment as well as osteoclast resorption .
|
-
- HY-P10802
-
|
|
Enterovirus
Virus Protease
|
Infection
|
|
ER-DRI is a potent peptide inhibitor that tagets EV-A71. ER-DRI directly bounds to 3A and specifically abrogates viral suppressor of RNAi activity, which unlocked the antiviral RNAi response that is suppressed by 3A. ER-DRI also potently inhibits another enterovirus, Coxsackievirus-A16, dependently of RNAi .
|
-
- HY-P4045
-
|
|
HBV
|
Infection
|
|
HBV Seq2 aa:208-216, a HBsAg derived CD8 epitope peptide, is studied as part of Large envelope protein from Hepatitis B virus .
|
-
- HY-P2198A
-
-
- HY-W101305
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .
|
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P3539
-
|
|
GCGR
|
Neurological Disease
Endocrinology
|
|
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis .
|
-
- HY-P10556
-
|
|
Bacterial
|
Infection
|
|
(KFF)3K is a cell penetrating peptide that can promote the absorption of other antibiotics by disrupting the outer membrane of bacteria. (KFF)3K can be introduced into a hydrocarbon scaffold to induce its antibacterial properties, making it an effective antimicrobial peptide. (KFF)3K can be used in the development of new antimicrobial agents .
|
-
- HY-P99906
-
|
|
β-catenin
|
Cancer
|
|
Sirexatamab is an active peptide. Sirexatamab can be used for various biochemical studies.
|
-
- HY-149205
-
|
|
PI3K
ERK
|
Inflammation/Immunology
|
|
CXJ-2 is a cyclic peptide, and exhibits moderate affinity toward elastin derived peptides (EDPs). CXJ-2 exhibits potent activities to inhibit the PI3K/ERK pathway and decrease hepatic stellate cell proliferation and migration. CXJ-2 possesses potent antifibrotic efficacy .
|
-
- HY-P0092
-
-
- HY-P4127A
-
-
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P1116A
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
PBP10 is a cell permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1 . PBP10 is a 10-AA peptide with rhodamine conjugated at its N terminus, exerts bactericidal activity against gram-positive and gram-negative bacteria and limits microbial-induced inflammatory effects .
|
-
- HY-109538R
-
|
|
Secretin Receptor
|
Neurological Disease
Metabolic Disease
|
|
Secretin (swine) (Standard) is the analytical standard of Secretin (swine). This product is intended for research and analytical applications. Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine cell subsets and can be prompted by fatty acids. Secretin stimulates the secretion of pancreatic water and bicarbonate. Secretin exerts various effects in organs, can be used for the research of digestive system, central nervous system and energy metabolism .
|
-
- HY-P3429A
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
- HY-P3791
-
|
|
Fluorescent Dye
|
Others
|
|
N-Succinyl-Ile-Ile-Trp-AMC is a peptide-based fluorescent substrate or probe for carboxypeptidase Y (CPY) .
|
-
- HY-P3506
-
|
LY3437943
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide can be used for the research of obesity .
|
-
- HY-P3506B
-
|
LY3437943 acetate
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Retatrutide (LY3437943) acetate is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide acetate inhibits human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide acetate can be used for the research of obesity .
|
-
- HY-P1271A
-
|
|
nAChR
|
Cardiovascular Disease
|
|
Catestatin TFA is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin TFA is an endogenous peptide that regulates cardiac function and blood pressure . Catestatin TFA is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release .
|
-
- HY-157277
-
|
|
Others
|
Cancer
|
|
AdBeSA is a hapten. AdBeSA can influence peptide binding by MHC II .
|
-
- HY-P2565
-
-
- HY-103281
-
|
|
Bombesin Receptor
|
Metabolic Disease
|
|
Litorin, an amphibian bombesin peptide derivative, is an bombesin receptor agonist. Litorin stimulates the contraction of smooth muscle, stimulates gastrin, gastric acid, and pancreatic secretion, and suppresses the nutriment in vivo .
|
-
- HY-P3933
-
-
![[Tyr8,Nle11] Substance P](//file.medchemexpress.com/product_pic/hy-p3933.gif)
- HY-P3503
-
|
BMN 111
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
- HY-P1601
-
-
- HY-P0100
-
-
- HY-W729010
-
-
- HY-P5520
-
|
|
Bombesin Receptor
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
GB-6 is a short linear peptide that targets the gastrin releasing peptide receptor (GRPR). GRPR is overexpressed in pancreatic cancer. Based on the tumor selectivity and tumor-specific accumulation properties of GB-6, GB-6 labeled with near infrared (NIR) fluorescent dyes or radionuclide netium-99m (99mTc) can be used as a high-contrast imaging probe. GB-6 has excellent in vivo stability, with tumor to pancreatic and intestinal fluorescence signal ratios of 5.2 and 6.3, respectively, in SW199 0 subcutaneous xenograft models. GB-6 can rapidly target tumors and accurately delineate tumor boundaries, which has broad application prospects .
|
-
- HY-P3506A
-
|
LY3437943 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Retatrutide (LY3437943) TFA is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide TFA binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide TFA can be used for the research of obesity .
|
-
- HY-P0136AF
-
|
|
Fluorescent Dye
|
Others
|
|
FAM-SAMS TFA is a 5-FAM (HY-66022) labeled SAMS (HY-P0136). SAMS peptide is a specific substrate for the AMP-activated protein kinase (AMPK) .
|
-
- HY-153549
-
|
|
Radionuclide-Drug Conjugates (RDCs)
CXCR
|
Others
|
|
Pentixafor is a peptide that targets CXCR4. Pentixafor is capable of being labelled with 68Gallium ( 68Ga) for positron emission tomography (PET) imaging . Pentixafor can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-P3108
-
-
- HY-W009118
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-5-Ava-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize fatty acid-based dimeric peptides with PSD-95 inhibitory activity .
|
-
- HY-128113
-
-
- HY-P10115
-
|
|
STAT
|
Cancer
|
|
APT STAT3 is a specific STAT3-binding peptide. APT STAT3 can bind STAT3 with high specificity and affinity (～231 nmol/L). APT STAT3 is a tractable agent for translation to target the broad array of cancers harboring constitutively activated STAT3 .
|
-
- HY-P4805
-
-
- HY-P3828
-
|
|
Fluorescent Dye
|
Neurological Disease
|
|
Biotin-myelin basic protein (94-102) is a peptide fragemt. Myelin basic protein is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin, it plays an important role in the process of myelination of nerves in the nervous system. Myelin basic protein also acts as a membrane actin-binding protein, which might allow it to participate in transmission of extracellular signals to the cytoskeleton in oligodendrocytes and tight junctions in myelin .
|
-
- HY-138106
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Cit-OH is citrulline with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as H-Dmt-D-Cit-Aba-b-Ala-NMe-30,50-(CF3)2-Bn and H-Dmt-D-Cit-Aba-b-Ala-NMe-Bn with neurokinin-1 antagonist activity .
|
-
- HY-P1632A
-
|
|
Bacterial
|
Infection
Cancer
|
|
Tachyplesin I TFA is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I TFA exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P5288
-
|
|
Antibiotic
|
Infection
Cancer
|
|
BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer .
|
-
- HY-P1179
-
|
|
Guanylate Cyclase
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P3912
-
|
|
COX
Interleukin Related
|
Infection
|
|
Endotoxin inhibitor a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor inhibits the febrile response to LPS with very low toxicity and lethality .
|
-
- HY-P0267
-
-
- HY-P5175
-
|
|
mAChR
|
Neurological Disease
|
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
-
- HY-P1334
-
-
- HY-P4094
-
CTP
1 Publications Verification
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
|
CTP is a cardiac targeting peptide. CTP transduces cardiomyocytes in vitro. CTP leads to efficient and specific transduction of heart tissue in mice model. CTP can be used to deliver therapeutic peptides, proteins and nucleic acid specifically to the heart .
|
-
- HY-P3432
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
-
- HY-P3930
-
|
IP20-amide
|
PKA
|
Neurological Disease
|
|
PKI (5-24),amide (IP20-amide) is a 20-residue peptide that corresponds to the active portion of the heat-stable inhibitor protein of cAMP-dependent protein kinase. PKI (5-24),amide is a potent cAMP-dependent protein kinase (PKA) (PKA) inhibitor with a Ki of 2.3 nM .
|
-
- HY-125053A
-
|
|
Glycoprotein VI
|
Cardiovascular Disease
|
|
Batifiban TFA, a cyclic peptide, is an antagonist of platelet glycoprotein GPⅡb/Ⅲa and inhibits platelet aggregation. Batifiban blocks the binding of circulating vitronectin to integrin ανβ3 .
|
-
- HY-P3813
-
|
|
Tyrosinase
|
Inflammation/Immunology
Cancer
|
|
Tyrosinase (206-214), human (AFLPWHRLF), a 9-amino acid peptide, is a tyrosinase epitope. Tyrosinase (206-214), human can be recognized by HLA-A24 restricted, tumor-infiltrating lymphocytes (TIL) .
|
-
- HY-P3606
-
|
GAP (1-24), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (1-24), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 1-24 fragment (hGAP-1-24). GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
-
- HY-P5971
-
|
Mifomelatide
|
Melanocortin Receptor
|
Metabolic Disease
|
|
TCMCB07, a cyclic nonapeptide peptide, is an orally active and brain-penetrant melanocortin receptor 4 (MC4R) antagonist. TCMCB07 plays an important role in cachexia .
|
-
- HY-W337672
-
|
|
Biochemical Assay Reagents
|
Others
|
|
H-Pro-Hyp-OH is a collagen peptide composed of proline (Pro) and hydroxyproline (Hyp). H-Pro-Hyp-OH can be used in research on slowing down facial aging .
|
-
- HY-P1235
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-15944
-
|
5(6)-Carboxytetramethylrhodamine
|
Fluorescent Dye
|
Others
|
|
5(6)-TAMRA is a fluorescent dye molecule widely used as a label for peptides and proteins.
|
-
- HY-P3859
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) can be used in research of Alzheimer's disease .
|
-
- HY-114174
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing and mediates APP proteolytic processing .
|
-
- HY-P4370
-
|
|
Bacterial
Fungal
|
Infection
|
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
-
- HY-W041989
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Oic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg 10]HOE 140, which has bradykinin B1 antagonist activity .
|
-
- HY-P3625
-
|
|
Endogenous Metabolite
Opioid Receptor
|
Neurological Disease
|
|
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation .
|
-
- HY-P5188A
-
-
- HY-P1145
-
|
HuGLP-1
|
GCGR
|
Metabolic Disease
|
|
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
|
-
- HY-P5714
-
|
|
Bacterial
|
Infection
|
|
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain .
|
-
- HY-P5248
-
-
- HY-P1463
-
|
Thyrocalcitonin eel
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
-
- HY-P1179A
-
|
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P5334A
-
|
|
Tau Protein
|
Neurological Disease
|
|
AADvac 1 TFA is an active tau peptide vaccine for Alzheimer's disease research. AADvac 1 TFA is composed of a regulatory peptide 294KDNIKHVPGGGS 305 that drives tau oligomerization conjugated to Aplysia hemocyanin (KLH) and formulated with aluminum hydroxide .
|
-
- HY-P1781A
-
|
|
Secretin Receptor
|
Cancer
|
|
Peptide C105Y TFA, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .
|
-
- HY-W013153
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg 10]HOE 140, which has bradykinin B1 antagonist activity .
|
-
- HY-P99924
-
|
|
GHR
|
Others
|
|
Efpegsomatropin is a human growth hormone-Fc conjugate peptide. Efpegsomatropin can be used for various biochemical studies.
|
-
- HY-P10685
-
|
[Tyr5,12,Lys7]-Polyphemusin II
|
HIV
CMV
|
Infection
|
|
T-22 (polyphemusin II with [Tyr5,12,Lys7]) is a new synthetic peptide that fights HIV, with an EC50 of 0.008 μg/mL and a CC50 of 54 μg/mL. T22 promotes plant height, photosynthesis, total chlorophyll content, and gas exchange in tomatoes, and it can resist CMV .
|
-
- HY-P10411
-
|
|
Bacterial
|
Infection
|
|
BING is an antimicrobial peptide that can be isolated from Japanese medaka fish. BING shows a broad-spectrum toxicity against pathogenic bacteria including drug-resistant strains. BING induces a deregulation of periplasmic peptidyl-prolyl isomerases in gram-negative bacteria, and reduces the RNA level of cpxR, which plays a crucial role in the development of antimicrobial resistance .
|
-
- HY-P5971A
-
|
|
Melanocortin Receptor
|
Metabolic Disease
|
|
TCMCB07 TFA, a cyclic nonapeptide peptide, is an orally active and brain-penetrant melanocortin receptor 4 (MC4R) antagonist. TCMCB07 TFA plays an important role in cachexia .
|
-
- HY-120521
-
-
- HY-P0122
-
|
c(CRGDKGPDC)
|
Integrin
|
Cancer
|
|
iRGD peptide is a 9-amino acid cyclic peptide, triggers tissue penetration of agents by first binding to αv-integrins, then proteolytically cleaved in the tumor to produce CRGDK/R to interact with neuropilin-1, and has tumor-targeting and tumor-penetrating properties.
|
-
- HY-106268A
-
|
|
Gap Junction Protein
|
Inflammation/Immunology
|
|
Larazotide acetate is a peptide which is an orally active zonulin antagonist. Larazotide acetate shows antiviral activity to varicella-zoster virus (VZV) with EC50s of 44.14 and 59.06 μM for strain OKA and 07-1, respectively. Larazotide acetate can be used for the research of celiac disease and infection.
|
-
- HY-P5617
-
|
|
Bacterial
|
Others
|
|
Cathepsin G(1-5) is an antimicrobial peptide that can be found in the clostripain-digested cathepsin G mixture .
|
-
- HY-P5256
-
|
|
Bacterial
|
Others
|
|
Oligopeptide-20 is a bioactive peptide with skin repair effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P2656
-
|
hBD-4
|
Bacterial
|
Infection
|
|
β-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity .
|
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P0052
-
|
T20; DP178
|
HIV
|
Infection
|
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P10302
-
|
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-P4093
-
-
- HY-P0269A
-
|
Magainin I TFA
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .
|
-
- HY-P10560
-
|
|
Biochemical Assay Reagents
|
Others
|
|
M918 is a cell-penetrating peptide. M918 is internalized by cells through endocytosis and can effectively penetrate a variety of cells in a non-toxic manner. M918 can be used in gene therapy and drug delivery system research .
|
-
- HY-P0264
-
|
Avexitide
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH) .
|
-
- HY-P10564
-
|
|
Bacterial
|
Infection
|
|
Pardaxin P 4 is an antimicrobial peptide found in the secretions of Red Sea Moses sole. Pardaxin P 4 acts as a biomembrane perforator that can interact with phospholipid bilayers of different compositions and induce cytotoxicity and pore formation. Pardaxin P 4 can be used in the research of antimicrobial drugs .
|
-
- HY-P2272
-
|
|
Wnt
β-catenin
|
Cancer
|
|
NLS-StAx-h is a selective, cell permeable, stapled peptide Wnt signaling inhibitor with an IC50 of 1.4 μM. NLS-StAx-h efficiently inhibits β-catenin-transcription factor interactions. NLS-StAx-h shows anti-proliferation of cancer cells .
|
-
- HY-P10425
-
|
|
Histone Methyltransferase
|
Cancer
|
|
T2857W is a mutant peptide that has inhibitory effect on KIX-MLL interaction (IC50=5.67 μM). T2857W can be used for protein-protein interaction (PPI) and for the study of diseases related to KIX-MLL interaction, such as leukemia, cancer, etc .
|
-
- HY-P0207
-
|
Endothelin-2 (human, canine); Human endothelin-2
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P10795
-
|
Antibiotic NK 2
|
Parasite
Bacterial
Fungal
|
Infection
|
|
NK-2 (Antibiotic NK 2), a shortened linear amphipathic NK-Lysin analog (comprising residues 39 to 65 of NK-lysin), is an antimicrobial peptide that exhibits potent activities against trypanosoma cruzi, Candida albicans, gram-positive and gram-negative bacteria. NK-2 can kill trypanosomes residing inside the human glioblastoma cell line 86HG39, left the host cells apparently unharmed .
|
-
- HY-P3579
-
|
GIP (1-42), porcine
|
Insulin Receptor
|
Endocrinology
|
|
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism .
|
-
- HY-157280
-
|
|
MHC
|
Inflammation/Immunology
|
|
AdCaPy is an MHC II antigen loading catalyst that accelerates the loading of peptide antigens by MHC II. AdCaPy is a useful molecular tool for enhancing immune responses .
|
-
- HY-P10797
-
-
- HY-P10627
-
|
|
Amyloid-β
|
Neurological Disease
|
|
SOD1 (147-153) human is a peptide fragment of Cu/Zn superoxide dismutase (SOD1) with a high propensity to form amyloid fibrils. SOD1 (147-153) human may trigger the aggregation of full-length SOD1 and is a common molecular determinant of familial amyotrophic lateral sclerosis (fALS) and sporadic amyotrophic lateral sclerosis (sALS) .
|
-
- HY-P10823
-
|
|
Amyloid-β
|
Neurological Disease
|
|
RI-OR2, a retro-inverso peptide, is an amyloid-β (Aβ) oligomerization inhibitor. RI-OR2 binds to immobilized β-Amyloid (1-42) (HY-P1363A) monomers and fibrils, with an apparent Kd of 9-12 μM, and also acted as an inhibitor of Aβ(1-42) fibril extension .
|
-
- HY-P1847
-
|
|
NF-κB
|
Cancer
|
|
IKKγ NBD Inhibitory Peptide is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-P1111A
-
|
|
Src
Interleukin Related
|
Inflammation/Immunology
|
|
Lyn peptide inhibitor TFA is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor TFA blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor TFA can be used for study of asthma, allergic, and other eosinophilic disorders .
|
-
- HY-P5250
-
|
|
MMP
|
Others
|
|
Palmitoyl tripeptide-5 is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P2663
-
|
|
TNF Receptor
|
Others
|
|
Acetyl tetrapeptide-2 is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P1097F
-
-
- HY-P2785
-
-
- HY-146133
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
LA-Bac8c is a Lipoic acid modified antimicrobial peptide with enhanced antimicrobial properties. LA-Bac8c inhibits S. aureus, MRSA, S. epidermidis, E. coli, and P. aeruginosa with MICs of 1, 4, 8, 8, and 8 μg/mL .
|
-
- HY-P10820
-
|
|
HIV
|
Infection
|
|
N36Mut(e,g) is a gp41-targeted HIV fusion peptide inhibitor. N36Mut(e,g) acts by disrupting the homotrimeric coiled-coil of N-terminal helices in the pre-hairpin intermediate to form heterotrimers .
|
-
- HY-131326
-
-
- HY-P0069A
-
-
- HY-P10341
-
|
|
GCGR
|
Metabolic Disease
|
|
ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research .
|
-
- HY-P3533
-
|
|
Integrin
|
Cardiovascular Disease
|
|
EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis .
|
-
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
-
- HY-P10555
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
(D-Arg2, Sar 4)-Dermorphin (1-4) is a tetrapeptide derivative of the peptide Dermorphin (HY-P0244) found in amphibian skin. (D-Arg2, Sar 4)-Dermorphin (1-4) has significant analgesic effects by binding to the μ-opioid receptor (MOR) in the body. (D-Arg2, Sar 4)-Dermorphin (1-4) can be used in the development of analgesic drugs .
|
-
- HY-P1051
-
|
Amyloid β-Protein (12-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (Amyloid β-Protein (12-28)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) shows aggregation properties. β-Amyloid (12-28) has the potential for Alzheimer’s disease research .
|
-
- HY-P4110
-
|
|
iGluR
|
Metabolic Disease
Inflammation/Immunology
|
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
-
- HY-P0173B
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
-
- HY-P4874
-
|
|
Melanocortin Receptor
|
Metabolic Disease
|
|
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity .
|
-
- HY-34738
-
|
3-(Boc-amino)-1-propanol
|
Amino Acid Derivatives
|
Others
|
|
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity .
|
-
- HY-W729138
-
|
|
ADC Linker
|
Others
|
|
Fmoc-D-homoArg(Et)2-OH (hydrochloride) is a Fmoc-protected derivative of D-Homoarginine (HArg) that renders peptides and proteins resistant to proteolysis by trypsin. Fmoc-D-homoArg(Et)2-OH (hydrochloride) can be used as a cleavable ADC linker to synthesize antibody-drug conjugates (ADCs) .
|
-
- HY-125053
-
|
|
Integrin
|
Cardiovascular Disease
|
|
Batifiban, a cyclic peptide, is a platelet glycoprotein GPⅡb/Ⅲa antagonist, and inhibits platelet aggregation. Batifiban blocks circulating vitronectin binding to integrin ανβ3, Batifiban can be used for research of acute coronary syndromes .
|
-
- HY-P10598
-
|
|
Biochemical Assay Reagents
|
Others
|
|
BIMAX1 is a tool peptide used in experiments to examine the interaction of RBBP4 with importin β1 and the effects on the nuclear import pathway. BIMAX1 can be used to study the role of RBBP4 in regulating nuclear import efficiency and cellular senescence .
|
-
- HY-P10349
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Pap12-6 is a 12-mer peptide derived from the antimicrobial peptide Papiliocin of yellow butterfly larva. Pap12-6 kills bacteria by penetrating and disrupting their membranes, exhibiting strong antibacterial activity. Pap12-6 exerts its anti-inflammatory effects through the TLR4-mediated NF-κB signaling pathway .
|
-
- HY-P2231
-
|
MEDI0382
|
GCGR
|
Metabolic Disease
|
|
Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D) .
|
-
- HY-106275
-
|
Fibrin-derived peptide Bβ15-42
|
Flavivirus
Dengue Virus
|
Cardiovascular Disease
|
|
FX-06 (Fibrin-derived peptide Bβ15-42) is a fibrin Bbeta chain-derived peptide. FX-06 binds to VE-cadherin and inhibits leukocyte transmigration and initiates VE-cadherin-mediated signaling. FX-06 can be used in the research of ischemia/reperfusion injury, Dengue shock syndrome (DSS) .
|
-
- HY-P4105
-
-
- HY-150241
-
|
|
Liposome
|
Others
|
|
DOPE-NHS is a linker. DOPE-NHS can be used for peptides to be conjugated to exosomes and possibly other membrane-based nanoparticles. DOPE-NHS can be used for drug delivery .
|
-
- HY-P1847A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
IKKγ NBD Inhibitory Peptide TFA is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide TFA acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide TFA could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits .
|
-
- HY-P1566
-
|
|
HIV
|
Infection
|
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
-
- HY-P5963
-
-
- HY-103304
-
|
|
CGRP Receptor
|
Neurological Disease
|
|
CGRP antagonist 4 is an antagonist of calcitonin gene-related peptide (CGRP) receptor. CGRP antagonist 4 shows the highest affinity for CGRP receptors in the human brain. CGRP antagonist 4 can be used to study the binding properties of non-peptide calcitonin gene-related peptide (CGRP) receptor antagonist (gepants) in rat, pig and human menes .
|
-
- HY-P2252
-
|
|
Histone Methyltransferase
|
Cancer
|
|
H3K27(Me) (15-34), a histone peptide, is a repressive chromatin markderived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me) .
|
-
- HY-P0082A
-
|
Glucagon hydrochloride
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-N6708
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Alamethicin, isolated from Trichoderma viride, is a channel-forming peptide antibiotic and induces voltage-gated conductance in model and cell membranes .
|
-
- HY-P1465
-
-
- HY-105069A
-
|
TP508 amide acetate
|
Thrombin
|
Metabolic Disease
Inflammation/Immunology
|
|
Rusalatide acetate (TP508 amide acetate), a regenerative peptide, mitigates radiation-induced gastrointestinal damage by activating stem cells and preserving crypt integrity .
|
-
- HY-P10489
-
|
|
Kisspeptin Receptor
|
Others
Cancer
|
|
Kisspeptin-14 human is a peptide hormone encoded by the KiSS-1 gene. Kisspeptin-14 human, along with several other similar peptide hormones, is produced from a common precursor protein by cleavage by different proteases. Kisspeptin-14 human has the same receptor binding efficiency and potency as full-length kisspeptin. Kisspeptin-14 human binds to its receptor GPR54 and is able to activate this G protein-coupled receptor and activate multiple intracellular signaling pathways. Kisspeptin-14 human can be used to study reproductive development and tumor metastasis .
|
-
- HY-P1051A
-
|
Amyloid β-Protein (12-28) (TFA); Amyloid Beta-Peptide (12-28) (human) TFA; β-Amyloid protein fragment(12-28) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (TFA) (Amyloid β-Protein (12-28) (TFA)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) (TFA) shows aggregation properties. β-Amyloid (12-28) (TFA) has the potential for Alzheimer’s disease research .
|
-
- HY-D1405
-
-
- HY-P1535
-
|
Porcine secretin acetate
|
Secretin Receptor
|
Inflammation/Immunology
|
|
Secretin, porcine (Porcine secretin acetate) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
|
-
- HY-P3452
-
|
|
Tyrosinase
|
Inflammation/Immunology
|
|
Tetrapeptide-30 is a skin-brightening peptide consisting of four amino acids. Tetrapeptide-30 can act as a tyrosinase inhibitor, lightening hyperpigmentation and evening out skin tone by reducing the amount of tyrosinase and inhibiting melanocyte activation .
|
-
- HY-P0207A
-
|
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Cancer
|
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
-
- HY-P0154
-
|
ε-V1-2; EAVSLKPT
|
PKC
|
Inflammation/Immunology
|
|
Epsilon-V1-2 (ε-V1-2), a PKCε-derived peptide, is a selective PKCε inhibitor. Epsilon-V1-2 inhibits the translocationof PKCε, but not α-, β-, and δPKC .
|
-
- HY-P1121A
-
|
|
Formyl Peptide Receptor (FPR)
|
Inflammation/Immunology
|
|
WKYMVM-NH2 TFA is a potent N-formyl peptide receptor (FPR1) and FPRL1/2 agonist, also activates several leukocyte effector functions such as chemotaxis, mobilization of complement receptor-3, and activation of the NADPH oxidase .
|
-
- HY-P10572
-
-
- HY-P4029
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (484-499) is a peptide consisting of 16 amino acids. HCV-1 e2 Protein (484-499) is derived from the envelope 2 protein of hepatitis C virus in the sera from individuals with antibodies to HCV .
|
-
- HY-147050
-
-
- HY-P10147
-
|
|
Caspase
|
Cancer
|
|
Ac-LDESD-AMC is a caspase-2 inhibitor. Ac-LDESD-AMC has a peptide sequence of Leu-Asp-Glu-Ser-Asp .
|
-
- HY-P3111
-
|
|
Potassium Channel
|
Others
|
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
-
- HY-P2576
-
|
|
Bacterial
|
Infection
|
|
Polistes mastoparan is an antimicrobial peptide. Polistes mastoparan increases S. aureus cell K + efflux and inhibits cell viability with EC50 of 5 μM .
|
-
- HY-P0062
-
-
- HY-P1419
-
|
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
|
|
AP 811 is a selective atrial natriuretic peptide clearance receptor (ANP-CR, NPR3) antagonist with a Ki of 0.48 nM. AP 811 displays >20000-fold selectivity for NPR3 over NPR1. AP 811 abolishes ANP-induced pump stimulation .
|
-
- HY-P10631
-
|
|
HSP
|
Inflammation/Immunology
|
|
Gp96-II is a gp96-blocking peptide that antagonizes gp96-mediated LPS(HY-D1056)-induced cytokine production. Gp96-II can be utilized in research on inflammatory disease .
|
-
- HY-P1419A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
AP 811 acetate is a selective atrial natriuretic peptide clearance receptor (ANP-CR, NPR3) antagonist with a Ki of 0.48 nM. AP 811 acetate displays >20000-fold selectivity for NPR3 over NPR1. AP 811 acetate abolishes ANP-induced pump stimulation .
|
-
- HY-P5915
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
FAM-DEALA-Hyp-YIPMDDDFQLRSF-NH2, a 5-FAM labeled HIF-1α peptide, is a substrate of VHL. FAM-DEALA-Hyp-YIPMDDDFQLRSF-NH2 binds to VHL protein with a KD of 3 nM. Ex/Em (λ) = 485/520 nm .
|
-
- HY-P5623B
-
|
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-Y1169
-
|
4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is an aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .
|
-
- HY-P3711
-
|
|
Na+/K+ ATPase
|
Others
|
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase .
|
-
- HY-Y1636
-
-
- HY-P2191
-
|
|
Kisspeptin Receptor
|
Endocrinology
|
|
KISS1-305, the Metastin/Kisspeptin analog, is a prototype peptide and a chemical probe. KISS1-305 has suboptimal KISS1R agonistic activity, and resists plasma protease degradation .
|
-
- HY-P0211
-
|
|
GCGR
|
Cardiovascular Disease
|
|
[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human), a growth hormone releasing factor (GRF) analogue, is a vasoactive intestinal peptide (VIP) antagonist .
|
-
![[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human)](//file.medchemexpress.com/product_pic/hy-p0211.gif)
- HY-129269
-
|
A-68567
|
Antibiotic
Bacterial
|
Infection
|
|
Pacidamycin I (A-68567) is a nucleoside peptide antibiotic that is highly specific for Pseudomonas aeruginosa .
|
-
- HY-P3622
-
|
|
GCGR
|
Metabolic Disease
|
|
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion .
|
-
- HY-147050A
-
-
- HY-P4373
-
|
|
Cathepsin
MMP
|
Metabolic Disease
|
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
-
- HY-P4154
-
|
ALM-488
|
Fluorescent Dye
|
Neurological Disease
Cancer
|
|
Bevonescein (ALM-488) is a novel, intravenously-administrated fluorescein-conjugated peptide that binds nerve-associated connective tissue, labels peripheral nerves under real-time fluorescence imaging (FL) in living mice and human ex vivo nerve tissue. Bevonescein is a peptide-linked tracer which fluorescently labeled both intact and degenerated nerves .
|
-
- HY-P3325
-
|
D-P8RI
|
VEGFR
|
Inflammation/Immunology
|
|
P8RI (D-P8RI) is a biomimetic peptide of CD31 and a CD31 agonist. P8RI binds to the juxtamembrane amino acid sequence of the ectodomain of CD31, shows an immunosuppressive effect through restoration of the CD31 inhibitory pathway .
|
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
- HY-P4327
-
|
|
Bacterial
|
Infection
|
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative .
|
-
- HY-P4060
-
-
- HY-D0889R
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Glycylglycine (Standard) is the analytical standard of Glycylglycine. This product is intended for research and analytical applications. Glycylglycine is the simplest of all peptides and could function as a gamma-glutamyl acceptor.
|
-
- HY-P5623
-
|
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-P10697
-
|
|
LDLR
|
Metabolic Disease
|
|
VH4127 is a cyclic peptide targeting the low density lipoprotein receptor (LDLR) with a KD of 18 nM for hLDLR. VH4127, bearing non-natural amino acid residues, specifically binds to rodent and human epidermal growth factor (EGF) homology domain of LDLR .
|
-
- HY-D1592
-
|
|
Fluorescent Dye
|
Others
|
|
BODIPY TMR C5-maleimide is a fluorescent dye. BODIPY TMR C5-maleimide is a high quantum yield fluorophore which can be coupled with peptides .
|
-
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P1159
-
-
![[D-p-Cl-Phe6,Leu17]-VIP](//file.medchemexpress.com/product_pic/hy-p1159.gif)
- HY-P10574
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
Phosphorylated CHKtide is a synthetic peptide substrate derived from CDC25C, which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. Phosphorylated CHKtide is used in the assays of cell cycle checkpoint kinases 1 and 2 (CHK1/CHK2) and salt-inducible kinases (SIKs) .
|
-
- HY-P3328
-
|
|
Bacterial
|
Infection
|
|
MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa .
|
-
- HY-P3328A
-
|
|
Bacterial
|
Infection
|
|
MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa .
|
-
- HY-P10603
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
SP1 is an α-peptide encoded by the mating pheromone MFα1 gene in Candida albicans, which can induce cell growth arrest at the mating type locus MTLa in Candida albicans. SP1 can be used in the study of the prevention and treatment of Candida albicans infection .
|
-
- HY-P1115
-
|
|
Akt
|
Others
|
|
AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-P10101
-
|
APTscr
|
STAT
|
Others
|
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
-
- HY-17446
-
|
HOE 140
|
Bradykinin Receptor
|
Endocrinology
|
|
Icatibant (HOE-140) is a potent and specific peptide antagonist of bradykinin B2 receptor with IC50 and Ki of 1.07 nM and 0.798 nM respectively .
|
-
- HY-P3163
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Hexapeptide-9 is a collagen peptide, with anti-aging activity. Hexapeptide-9 is commonly used as the ingredient in skin care products for improving the appearance of the skin .
|
-
- HY-P2136
-
COG1410
2 Publications Verification
|
Apoptosis
|
Neurological Disease
Inflammation/Immunology
|
|
COG1410 is an apolipoprotein E-derived peptide and an apoptosis inhibitor. COG1410 exerts neuroprotective and antiinflammatory effects in a murine model of traumatic brain injury (TBI). COG1410 can be used for the research of neurological disease .
|
-
- HY-P0069
-
|
AM-111; XG-102
|
JNK
|
Others
|
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
-
- HY-P3605
-
|
GAP (25-53), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (25-53), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 25-53 fragment (hGAP-25-53), can be used as immunogen to generate antiseras including MC-1, MC-2, and MC-3. GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
-
- HY-P2483A
-
|
|
Bacterial
|
Others
|
|
Octaarginine TFA is a cell-penetrating peptide (CPP). CPPs show membrane translocation activities. CPPs are used for intracellular delivery of various membrane-impermeable bioactive agents because of their intrinsic ability to gain access to cell interiors. CPPs have also been used to deliver antibacterial agents to target intracellular bacteria .
|
-
- HY-P1535A
-
|
Porcine secretin TFA
|
Secretin Receptor
|
Inflammation/Immunology
|
|
Secretin, porcine TFA (Porcine secretin TFA) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid .
|
-
- HY-P10097
-
|
|
VEGFR
|
Others
|
|
Flt2 11 is a anti‐angiogenic peptide, and specifically binds NRP‐1. Flt2 11 inhibits NRP‐1/sVEGFR‐1 interaction.
|
-
- HY-P1159A
-
|
|
PACAP Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
[D-p-Cl-Phe6,Leu17]-VIP TFA is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP TFA has no activity on glucagon, secretin or GRF receptors .
|
-
![[D-p-Cl-Phe6,Leu17]-VIP TFA](//file.medchemexpress.com/product_pic/hy-p1159a.gif)
- HY-P3908
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-Amyloid β-Protein (1-42) ammonium is a FITC tagged Aβ1-42 monomer peptide. Aβ1-42 plays a key role in the pathogenesis of Alzheimer’s disease .
|
-
- HY-P5057B
-
|
|
Fluorescent Dye
Bacterial
|
Infection
|
|
5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity .
|
-
- HY-113003
-
|
γ-Glutamylglutamine; γ-Glu-Gln
|
Amino Acid Derivatives
|
Others
Cancer
|
|
H-γ-Glu-Gln-OH is a hydrophilic peptide and can be conjugated to drugs. The carrier composed of H-γ-Glu-Gln-OH has the characteristics of high water solubility and drug-loading capacity, good biocompatibility, low toxicity, improved tumor targeting ability, and anti-tumor efficacy .
|
-
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P0089
-
|
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
-
- HY-A0162
-
|
|
Bacterial
|
Infection
|
|
Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits .
|
-
- HY-106171
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
NBI-6024, an altered peptide ligand (APL), is an epitope recognized by inflammatory interferon-gamma-producing T helper lymphocytes in type 1 diabetic patients .
|
-
- HY-P3270
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Capreomycin is a macrocyclic peptide antibiotic. Capreomycin can be used for anti-multidrug-resistant-tuberculosis research. Capreomycin can inhibit phenylalanine synthesis in in mycobacterial ribosomes translation
|
-
- HY-W010712
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-His(Trt)-OH has trityl (Trt) group to protect the side-chain of His. Fmoc-His(Trt)-OH has Fmoc group to protect -αNH2. Fmoc-His(Trt)-OH can be used for solid phase synthesis of peptides, providing protection against racemization and by-product formation .
|
-
- HY-P10602
-
|
RII phosphopeptide
|
PKA
|
Others
|
|
PKA Regulatory Subunit II Substrate (RII phosphopeptide) is a tool peptide derived from the regulatory subunit Type II (RII) of cyclic AMP-dependent protein kinase (PKA). PKA Regulatory Subunit II Substrate is commonly used to mimic the phosphorylation of protein kinases and as a specific substrate for protein phosphatases to assess the activities of these enzymes .
|
-
- HY-P1115A
-
|
|
Akt
|
Others
|
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-W048682
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-1-methyl-L-histidine is a Fmoc protected amino acid and can be used as an intermediate for peptide synthesis .
|
-
- HY-P3669
-
-
- HY-P0033A
-
|
Acetyl hexapeptide-3 acetate
|
Calcium Channel
|
Neurological Disease
|
|
Argireline acetate (Acetyl hexapeptide-3 acetate) is a non-toxic, skin-permeable, antiwrinkle peptide. Argireline acetate significantly inhibits Ca 2+ dependent neurotransmitter release (acetylcholine) at the neuromuscular junction. Argireline acetate has antiwrinkle and anti-aging activity .
|
-
- HY-P5177
-
-
- HY-P5954
-
|
|
Calcium Channel
|
Others
|
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
-
- HY-P4998
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
Chemotactic Domain of Elastin is an elastin-derived peptide with chemotactic effects on certain tumor cells, such as M27 tumor cells. Chemotactic Domain of Elastin can be used in cancer research .
|
-
- HY-P1975
-
|
Basifungin
|
Fungal
Parasite
|
Infection
Inflammation/Immunology
|
|
Aureobasidin A (Basifungin) is a cyclic peptide antibiotic with oral activity. Aureobasidin A is an inhibitor of inositol phosphorylated ceramide synthetase AUR1. Aureobasidin A has antifungal and antiparasitic activity .
|
-
- HY-P0062B
-
-
- HY-P5318
-
|
|
Reactive Oxygen Species
|
Inflammation/Immunology
|
|
MDYYFEER is an antioxidant active peptide that can be isolated from pancreatin hydrolysate of C-phycocyanin. MDYYFEER has high DPPH and ABTS radical scavenging ability. MDYYFEER protects zebrafish larvae from H2O2-induced oxidative damage .
|
-
- HY-P3548
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
[D-Ala2]-Met-Enkephalinamide, an opioid peptide, is a potent opioid agonist. [D-Ala2]-Met-Enkephalinamide decreases bile flow by a central mechanism. [D-Ala2]-Met-Enkephalinamide has analgesic properties .
|
-
![[D-Ala2]-Met-Enkephalinamide](//file.medchemexpress.com/product_pic/hy-p3548.gif)
- HY-P3350
-
|
|
Bacterial
|
Infection
|
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
-
- HY-125411
-
|
|
Endogenous Metabolite
|
Others
|
|
Berninamycin D is a cyclic peptide fungal metabolite isolated from ermentation of Streptomyces bernensis .
|
-
- HY-W087027
-
-
- HY-P1261
-
-
- HY-P1262
-
-
- HY-P4103
-
-
- HY-P3585
-
|
|
TNF Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Epobis, a dendrimeric peptide, is a recombinant form of erythropoietin. Epobis is a potent erythropoietin receptor agonist. Epobis promotes neuritogenesis in primary motoneurons. Epobis decrease TNF release and crosses the blood-brain barrier. Epobis has anti-inflammatory and memory enhancing properties .
|
-
- HY-147021
-
|
|
ADC Linker
|
Cancer
|
|
MC-Val-D-Cit-PAB-PNP is a cleavable peptide linker molecule used in the synthesis of antibody-drug conjugates (ADCs). MC-Val-D-Cit-PAB-PNP contains a maleimidocaproyl (Mc) group that can be conjugated to an antibody and a p-nitrophenol (PNP) group that allows the peptide to be linked to antitumor compounds.
|
-
- HY-P5317
-
|
|
Reactive Oxygen Species
|
Inflammation/Immunology
|
|
MAQAAEYYR is an antioxidant active peptide that can be isolated from pancreatin hydrolysate of C-phycocyanin. MAQAAEYYR has high DPPH, ABTS radical and ROS-scavenging ability. MAQAAEYYR protects zebrafish larvae from H2O2-induced oxidative damage .
|
-
- HY-P1752
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II (human) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior .
|
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P10618
-
|
|
Bacterial
|
Infection
|
|
BTM-P1 is a polycationic peptide that exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. BTM-P1 can form ion-permeable channels in the inner mitochondrial membrane to interfere with mitochondrial energy processes .
|
-
- HY-16215
-
|
G-202
|
Peptide-Drug Conjugates (PDCs)
PSMA
Calcium Channel
|
Cancer
|
|
Mipsagargin (G-202) is a novel thapsigargin-based targeted proagent consisting of a prostate-specific membrane antigen (PSMA)-specific peptide coupled to an analog of the potent sarcoplasmic/endoplasmic reticulum calcium adenosine triphosphatase (SERCA) pump inhibitor Thapsigargin (HY-13433). Mipsagargin is activated by PSMA-mediated cleavage of an inert masking peptide. Mipsagargin has the potential for refractory, advanced or metastatic solid tumours research .
|
-
- HY-162946
-
|
|
Ligands for Target Protein for PROTAC
|
Cancer
|
|
Alkyne-P60 is a potent 15-mer peptide inhibitor of Foxp3. Alkyne-P60 can bind with Foxp3, hinder its nuclear translocation, and diminish Foxp3-mediated inhibition of NFKB and NFAT functions. Alkyne-P60 is a ligand for target protein for PROTAC (HY-162943).
|
-
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
- HY-P1262A
-
-
- HY-P1261A
-
-
- HY-P2297
-
-
- HY-133803
-
-
- HY-118060
-
-
- HY-P0202
-
-
- HY-105077A
-
|
INN 00835 diTFA
|
5-HT Receptor
|
Neurological Disease
|
|
Nemifitide diTFA (INN 00835 diTFA) is a synthetic pentapeptide antidepressant with a potential for rapid onset of action . Nemifitide diTFA is a peptide analog of melanocyte-inhibiting factor (MIF) . Nemifitide diTFA can cross the blood-brain barrier .
|
-
- HY-17571A
-
|
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-N10583
-
|
|
Others
|
Others
|
|
Motuporin is a cyclic peptide. Motuporin was initially isolated from T. swinhoei .
|
-
- HY-P2295
-
|
|
SARS-CoV
|
Others
|
|
Dabcyl-KTSAVLQSGFRKME-Edans TFA is a fluorogenic peptide. Dabcyl-KTSAVLQSGFRKME-Edans TFA is used as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKME-Edans TFA has the potential for study 2019-nCoV (COVID-19) infection .
|
-
- HY-138126A
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
Dansyl-Tyr-Val-Gly TFA is a substrate of peptidylglycine monooxygenase (PHM). Peptidylglycine monooxygenase is an essential enzyme for the posttranslational amidation of neuroendocrine peptides .
|
-
- HY-W090942
-
-
- HY-155667A
-
|
|
Cathepsin
|
Others
|
|
Z-Nle-Lys-Arg-AMC acetate is a fluorogenic peptide substrate that specifically monitors cathepsin B activity over a broad pH range .
|
-
- HY-P3146S
-
|
|
Isotope-Labeled Compounds
|
Cancer
|
|
FTISADTSK- 13C6, 15N2 TFA is 13C- and 15N-labeled FTISADTSK (HY-P3146). FTISADTSK is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM) .
|
-
- HY-P2297A
-
-
- HY-P1575
-
|
|
HIV
|
Infection
|
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
- HY-P5718
-
|
|
Bacterial
|
Infection
|
|
Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity .
|
-
- HY-P5247
-
-
- HY-P0062A
-
-
- HY-P10271
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
RG7697 is a dual agonist for glucagon-like peptide receptor (GLP Receptor) and glucosedependent insulinotropic polypeptide receptor (GIPR), with EC50 of 5 and 3 pM, respectively. RG7697 exhibits antihyperglycemic property .
|
-
- HY-131091
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu(OBzl)-OSu can be used for the solid-phase peptide synthesis containing glutamate benzyl ester residues.
|
-
- HY-135414
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine5 NHS ester chloride is a red emitting fluorescent dye for labeling of amino-groups in peptides, proteins, and oligonucleotides .
|
-
- HY-P5317A
-
|
|
Reactive Oxygen Species
|
Inflammation/Immunology
|
|
MAQAAEYYR TFA is an antioxidant active peptide that can be isolated from pancreatin hydrolysate of C-phycocyanin. MAQAAEYYR TFA has high DPPH, ABTS radical and ROS-scavenging ability. MAQAAEYYR TFA protects zebrafish larvae from H2O2-induced oxidative damage .
|
-
- HY-126810A
-
|
|
Fungal
|
Infection
|
|
NP213 TFA is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide (AMP), has anti-fungal activities. NP213 TFA targets the fungal cytoplasmic membrane and plays it role via membrane perturbation and disruption. NP213 TFA is effective and well-tolerated in resolving nail fungal infections .
|
-
- HY-P3223
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .
|
-
- HY-P1508A
-
|
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
- HY-P0311
-
|
|
Bacterial
|
Infection
|
|
LAH4, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 possesses high plasmid DNA delivery capacities. LAH4 has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes .
|
-
- HY-D1618
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine3 maleimide tetrafluoroborate is a specific labeling reagent for sulfhydryl groups with the λex of 550 nm and λem of 580 nm. Cyanine3 maleimide tetrafluoroborate can be used for protein and peptide labeling .
|
-
- HY-P1222A
-
|
|
Bacterial
|
Infection
|
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P5803A
-
|
|
Bacterial
|
Infection
|
|
Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM .
|
-
- HY-P3365
-
|
|
Bacterial
|
Inflammation/Immunology
Cancer
|
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory .
|
-
- HY-P5708
-
|
Dermaseptin b2
|
Antibiotic
Fungal
Bacterial
|
Infection
|
|
Adenoregulin (Dermaseptin b2) is an antimicrobial peptide antibiotic. Adenoregulin is active against Gram-negative and Gram-positive bacteria, yeast and fungi. Adenoregulin also enhances the binding of agonists to the A1 adenosine receptor .
|
-
- HY-105088
-
|
MSI 78 free base
|
Bacterial
|
Infection
|
|
Pexiganan (MSI 78 free base) is a synthetic analog of magainin 2. Pexiganan is a potent and orally active broad-spectrum antimicrobial peptide. Pexiganan can be used in the research of infections, such as diabetic foot ulcer infections .
|
-
- HY-P5723
-
|
|
Bacterial
|
Infection
|
|
Api137 is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 inhibits protein synthesis by trapping of release factors on the 70S ribosome following hydrolysis of the nascent polypeptide chain .
|
-
- HY-P0262
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Endocrinology
|
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM) .
|
-
- HY-P4373A
-
|
|
Cathepsin
MMP
|
Inflammation/Immunology
|
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
-
- HY-147429A
-
|
Abx MCP TFA; RG6006 TFA
|
Antibiotic
Bacterial
|
Infection
|
|
Zosurabalpin TFA is a tethered macrocyclic peptide antibiotic, acting specifically on A. baumannii. Zosurabalpin TFA inhibits lipopolysaccharide-transport .
|
-
- HY-P2253
-
|
|
Histone Demethylase
|
Cancer
|
|
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me) .
|
-
- HY-P0311A
-
|
|
Bacterial
|
Infection
|
|
LAH4 TFA, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 TFA possesses high plasmid DNA delivery capacities. LAH4 TFA has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes .
|
-
- HY-P2458
-
|
|
Bacterial
|
Infection
|
|
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research .
|
-
- HY-P10530
-
|
|
Keap1-Nrf2
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Nrf2 (69-84) is a peptide fragment of Nrf2 protein that contains the key ETGE motif, which is an important region for binding to the Kelch domain of Keap1 protein. Nrf2 (69-84) can be used to study the role of Nrf2 in the development and progression of diseases, especially in cancer, neurodegenerative diseases and inflammatory diseases .
|
-
- HY-106428
-
|
ITF1697
|
P-selectin
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Icrocaptide (ITF1697) is a stable Lys-Pro-containing peptide that inhibits the intracellular Ca 2+-dependent fusion of Weibel-Palade bodies with the plasma membrane. Icrocaptide exerts its activity at the early stages of endothelial activation and inhibits P-selectin and von Willebrand factor secretion. Icrocaptide can be used for the study of a variety of microvascular disorders .
|
-
- HY-P10371
-
|
|
Reactive Oxygen Species
Thrombopoietin Receptor
|
Inflammation/Immunology
Cancer
|
|
PKHB1 is a thrombospondin-1 peptide mimic with antitumor effects. PKHB1 induces mitochondrial alterations, ROS production, intracellular Ca 2+ accumulation, as well calcium-dependent cell death in breast cancer cells. PKHB1 induces immune system activation through immunogenic cell death induction in breast cancer cells .
|
-
- HY-P0256
-
Apamin
4 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P3037
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P10364
-
|
UBI(29-41)
|
Bacterial
Antibiotic
|
Inflammation/Immunology
|
|
Ubiquicidin(29-41) is an antimicrobial peptide highly homologous to S30. Ubiquicidin(29-41) targets bacterial and fungal. Ubiquicidin(29-41) can be used as a membrane-specific infection localizer .
|
-
- HY-P10345
-
|
|
Bacterial
|
Infection
|
|
OP-145, an cathelicidin LL-37 derivative, is an antimicrobial peptide, and shows antibacterial activity against several MRSA strains. OP-145 can be used for research of chronic suppurative otitis media .
|
-
- HY-P5552
-
|
|
Bacterial
Parasite
Fungal
|
Infection
|
|
Melimine is a hybrid antimicrobial peptide of Melittin (HY-P0233) and Protamine. Melimine is active against P. aeruginosa and S. aureus. Melimine has broad spectrum activity against bacteria, fungi and protozoa .
|
-
- HY-P5930
-
|
MDM2 32-46
|
Ligands for E3 Ligase
|
Cancer
|
|
HOXB7 8–25 (MDM2 32-46) is an MDM2-derived peptide epitope and can elicit antigen-specifc and tumor-reactive CD4 + T cell responses .
|
-
- HY-P1471
-
|
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P3916
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
GVLSNVIGYLKKLGTGALNAVLKQ is an antimicrobial peptide with 24-amino acid. GVLSNVIGYLKKLGTGALNAVLKQ can potentially form α-helix. GVLSNVIGYLKKLGTGALNAVLKQ (PGQ) has activity against Gram-negative, Gram-positive bacteria and the yeast Candida albicans .
|
-
- HY-P2842
-
-
- HY-P5798
-
|
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
-
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
- HY-P5162
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
-
- HY-P1575A
-
|
|
HIV
|
Infection
|
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
|
-
- HY-P3975
-
|
pGlu-His-Pro-Gly-NH2
|
GnRH Receptor
|
Endocrinology
|
|
Glp-His-Pro-Gly-NH2 (pGlu-His-Pro-Gly-NH2) is a peptide containing 4 amino acids. Glp-His-Pro-Gly-NH2 stimulates gonadotrophin, luteinizing hormone (LH) and follicle stimulating hormone (FSH) release .
|
-
- HY-W345510
-
|
|
Neprilysin
|
Neurological Disease
|
|
Opiorphin, an opioid peptide, is a potent enkephalin-inactivating zinc ectopeptidases in human inhibitor. Opiorphin inhibits two enkephalin-catabolizing ectoenzymes, human neutral ecto-endopeptidase, hNEP (EC 3.4.24.11) with an IC50 value of 11 μM, and human ecto-aminopeptidase, hAP-N (EC 3.4.11.2). Opiorphin displays potent analgesic activity by activating endogenous opioid-dependent transmission .
|
-
- HY-P5285
-
|
|
Parasite
|
Infection
Inflammation/Immunology
Cancer
|
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells .
|
-
- HY-108312A
-
|
|
Caspase
|
Neurological Disease
|
|
AC-VEID-CHO (TFA) is a peptide-derived caspase inhibitor and has potency of inhibition for Caspase-6, Caspase-3 and Caspase-7 with IC50 values of 16.2 nM, 13.6 nM and 162.1 nM, respectively. AC-VEID-CHO (TFA) can be used for the research of neurodegenerative conditions including Alzheimer’s and Huntington’s disease .
|
-
- HY-P10173
-
|
|
Angiotensin-converting Enzyme (ACE)
|
Others
|
|
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .
|
-
- HY-W039519
-
|
|
Fluorescent Dye
|
Cancer
|
|
7-Methoxycoumarin-3-carboxylic acid is a fluorescent dye with an excitation peak at 355 nm and an emission peak at 405 nm. 7-Methoxycoumarin-3-carboxylic acid can be used to label peptide .
|
-
- HY-P1821A
-
|
MHP4-14 TFA
|
PKC
|
Neurological Disease
|
|
Myelin Basic Protein (MHP4-14) TFA, a synthetic peptide comprising residues 4-14 of myelin basic protein, is a very selective PKC substrate (Km=7 μM). Myelin Basic Protein TFA is not phosphorylated by cyclic AMP-dependent protein kinase, casein kinases I and II, Ca 2+/calmodulin-dependent protein kinase II, or phosphorylase kinase, and can be routinely used for the assay of protein kinase C with low background in the crude tissue extracts .
|
-
- HY-P1821
-
|
MHP4-14
|
PKC
|
Neurological Disease
|
|
Myelin Basic Protein (MHP4-14), a synthetic peptide comprising residues 4-14 of myelin basic protein, is a very selective PKC substrate (Km=7 μM). Myelin Basic Protein is not phosphorylated by cyclic AMP-dependent protein kinase, casein kinases I and II, Ca 2+/calmodulin-dependent protein kinase II, or phosphorylase kinase, and can be routinely used for the assay of protein kinase C with low background in the crude tissue extracts .
|
-
- HY-P10827
-
|
|
Complement System
|
Inflammation/Immunology
|
|
PIC1 PA, a 15 amino-acid peptide, is a potent PIC1 analog that inhibits classical pathway mediated complement activation. PIC1 PA functionally disrupts the C1s-C1r-C1r-C1s/MASPs interaction with collagen-like region (CLR) of C1q/MBL, respectively. PIC1 PA specifically binds to the CLR of C1q and bounds to purified C1q with a mean equilibrium dissociation constant (KD) of 33.3 nM .
|
-
- HY-W142073
-
|
7-Methyltryptophan
|
Amino Acid Derivatives
|
Infection
|
|
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .
|
-
- HY-P3419
-
-
- HY-P4122
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled is a cell-penetrating peptide (CPP). TAT (47-57), FAM-labeled has the potential for intracellular drug delivery research .
|
-
- HY-P3616
-
|
|
GCGR
|
Metabolic Disease
|
|
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin .
|
-
- HY-P5553
-
|
|
Bacterial
|
Infection
|
|
cPcAMP1/26 is an antimicrobial peptide. cPcAMP1/26 effectively kills A.hydrophila and S. aureus. cPcAMP1/26 induces depolarization of the bacterial plasma membrane, and increases intracellular ROS levels .
|
-
- HY-P5785
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P10526
-
|
|
Bacterial
|
Infection
|
|
CRAMP (1-39) is an antimicrobial peptide. CRAMP (1-39) has shown potent bactericidal effects against multiple strains of Neisseria meningitidis in vitro. CRAMP (1-39) can be used to study drug-resistant bacterial infections .
|
-
- HY-122297
-
|
|
Endogenous Metabolite
|
Others
|
|
H-Arg-Phe-OH is an amphipathic peptide. H-Arg-Phe-OH has the ability to induce native-like protein aggregation. H-Arg-Phe-OH can induce aggregation of the neutral model protein yeast alcohol dehydrogenase (ADH) .
|
-
- HY-W539893
-
|
NODAG
|
Biochemical Assay Reagents
|
Cancer
|
|
NODAGA-tris(t-Bu ester) (NODAG) is a NODAGA derivative. NODAGA-tris(t-Bu ester) can be used to label peptides, antibodies, etc., and subsequently radiolabeled for PET imaging .
|
-
- HY-P0142
-
|
|
PKG
|
Cardiovascular Disease
|
|
DT-3 is a membrane-permeable protein kinase G Iα (PKG Iα) inhibitory peptide and shows pharmacological blockade of the cGMP-PKG signalling .
|
-
- HY-P1801
-
|
Cys-[HIV-Tat (47-57)]
|
HIV
|
Infection
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P1801A
-
|
Cys-[HIV-Tat (47-57)] TFA
|
HIV
|
Infection
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P10272
-
|
PTG-300
|
Ferroportin
|
Others
|
|
Rusfertide is a peptide mimetic of natural hepcidin, which targets and degrades ferroportin, reduces serum iron and transferrin-saturation, and thus regulates the production of red blood cells. Rusfertide ameliorates the polycythemia vera, β-thalassemia and hereditary hemochromatosis .
|
-
- HY-P1285
-
|
Con-R
|
iGluR
|
Neurological Disease
|
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
-
- HY-17446R
-
|
|
Bradykinin Receptor
|
Endocrinology
|
|
Icatibant (Standard) is the analytical standard of Icatibant. This product is intended for research and analytical applications. Icatibant (HOE-140) is a potent and specific peptide antagonist of bradykinin B2 receptor with IC50 and Ki of 1.07 nM and 0.798 nM respectively .
|
-
- HY-P5549
-
|
|
Bacterial
Fungal
|
Infection
|
|
Hb 98-114, the amino acids 98-114 of the alpha subunit of bovine hemoglobin, is an antimicrobial peptide. Hb 98-114 is active against several yeast and filamentous fungi (MIC: 2.1 μM-12.5 μM) .
|
-
- HY-P2096
-
|
|
Reactive Oxygen Species
ATM/ATR
MDM-2/p53
|
Infection
|
|
Hexapeptide-11 is a bioactive peptide with anti-aging effect. Hexapeptide-11 protects fibroblasts against oxidative stress-mediated premature cellular senescence by mediating a downregulation of cellular proteins, such as ataxia telangiectasia mutated (ATM) and p53 .
|
-
- HY-P5765
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin (1-13)-spantide I is a chimeric peptide composed of the N-terminal fragment of galanin (amino acids 1-13) and spantide, a known substance P receptor antagonist. Galanin (1-13)-spantide I has a high affinity for spinal galanin receptor (Kd=1.16 nM). Galanin (1-13)-spantide I can be used to study the effects of galanin on feeding behavior .
|
-
- HY-P4886A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) TFA is a precursor of Pyr peptide. Pyroglutamic acid-modified Aβ (pEAβ) (3-42) is the core of the amyloid plaque in Alzheimer's disease. pEAβ (3-42) accelerates the aggregation of Aβ(1-42), while Aβ(1-42) significantly slows down the primary and secondary nucleation of pEAβ(3-42).
|
-
- HY-P2707
-
|
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research .
|
-
- HY-P1210
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
-
- HY-155667
-
|
|
Cathepsin
Fluorescent Dye
|
Others
|
|
Z-Nle-Lys-Arg-AMC is a fluorogenic peptide substrate that specifically monitors cathepsin B activity over a broad pH range .
|
-
- HY-D0819A
-
|
Cy5 NHS Ester triethylamine salt; Sulfo-Cyanine5 Succinimidyl Ester triethylamine salt
|
Fluorescent Dye
|
Others
|
|
Cy5-SE (Cy5 NHS Ester) triethylamine salt is a reactive dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Cy5-SE triethylamine salt is ideal for very cost-efficient labeling of soluble proteins, as well as all kinds of peptides and oligonucleotides Ex=649 nm; Em=670 nm) .
|
-
- HY-P10625
-
|
|
Apoptosis
|
Metabolic Disease
Cancer
|
|
SHLP-6 is a mitochondrial-derived peptide, a biologically active microprotein encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP6 increases apoptosis in insulinoma cells NIT1 and human prostate cancer cell 22Rv1. SHLP6 can be used in the study of diabetes and cancer .
|
-
- HY-162371
-
|
|
Aminoacyl-tRNA Synthetase
|
Infection
|
|
NRPSs-IN-1 (Compound 7) is a cell-penetrating inhibitor of non-ribosomal peptide synthetase (NRPSs). NRPSs-IN-1 K inhibits gramicidin S synthetase A (GrsA) with a Kd value of 16.6 nM .
|
-
- HY-P2460
-
|
|
Bacterial
Fungal
|
Infection
Inflammation/Immunology
|
|
SMAP-29, a promising antiinfective agent, is a broad spectrum antibacterial and antifungal α-helical cathelicidin-derived peptide. SMAP-29 acts by permeabilizing bacterial membranes and inducing remarkable changes in the surface morphology of susceptible microorganism .
|
-
- HY-P3519
-
|
|
Drug Intermediate
|
Others
|
|
ACV Tripeptide is a key biosynthetic precursor of penicillin and cephalosporins and is found in Penicillium chrysogenum and Acremonium chrysogenum. ACV Tripeptide is synthesized by a large non-ribosomal peptide synthase called ACV synthase, which is encoded by the 11 kb The pchAB gene encodes this enzyme .
|
-
- HY-P4123
-
|
|
HIV
|
Others
|
|
TAT (47-57) GGG-Cys(Npys) is a cell-penetrating peptide (CPP). TAT (47-57) GGG-Cys(Npys) has the potential for intracellular drug delivery research .
|
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P0316
-
|
|
Thrombin
NO Synthase
|
Cardiovascular Disease
|
|
TP508 is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 activates endothelial cells and stem cells to revascularize and regenerate tissues .
|
-
- HY-P4886
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the amyloid template block in Alzheimer's disease. pEAβ(3-42) accelerated the aggregation of Aβ(1-42), while Aβ(1-42) significantly slowed the primary and secondary nucleation of pEAβ(3-42) .
|
-
- HY-P1045
-
|
|
Arp2/3 Complex
|
Others
|
|
187-1, N-WASP inhibitor, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein .
|
-
- HY-P5557
-
|
|
Bacterial
Necroptosis
|
Cancer
|
|
TP4 (Nile tilapia piscidin) is an orally active piscidin-like antimicrobial peptide. TP4 inhibits multiple gram positive and negative strains (MIC: 0.03-10 μg/mL). TP4 shows hemolytic activities. TP4 enhances immune response, antioxidant activity, and intestinal health against bacterial infections. TP4 also has anti-tumor effect, and induces necrosis by triggering mitochondrial dysfunction in cancer cells .
|
-
- HY-P1416
-
|
|
Wnt
|
Cancer
|
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-106228
-
|
|
Fungal
Bacterial
Glutathione Peroxidase
|
Infection
|
|
HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .
|
-
- HY-W016413
-
-
- HY-164794
-
-
- HY-P10649A
-
|
|
Fluorescent Dye
|
Cancer
|
|
CPP12 TFA is a small, amphiphilic, cyclic cell-penetrating peptide (CPP) in salt form. CPP12 TFA binds directly to plasma membrane phospholipids, enters mammalian cells via endocytosis, and is then efficiently released from endosomes. CPP12 TFA can be used for intracellular delivery of drugs and chemical probes .
|
-
- HY-P3051
-
|
|
Reverse Transcriptase
|
Inflammation/Immunology
|
|
CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
|
-
- HY-P1410B
-
-
- HY-P5865
-
|
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
-
- HY-P3509
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-28 is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 can be used for pancreatic cancer research .
|
-
- HY-P0276
-
|
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
-
- HY-P3332A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DYKDDDDK peptide (FLAG) is a useful tool for investigating the function and localization of proteins whose antibodies (Abs) are not available. Often it is also used in a 3X FLAG format (3x DYKDDDDK Tag TFA) for purifying difficult proteins that accumulate in low abundance .
|
-
- HY-P10486
-
|
|
Bacterial
|
Infection
|
|
AIP-II is a macrocyclic peptide signaling molecule used for quorum sensing, which can be produced be Staphylococcus aureus. AIP-II binds to AgrC-II receptor, regulates the virulence gene expression in Staphylococcus aureus. AIP-II is an antagonist for AgrC-I receptor .
|
-
- HY-P1930
-
|
|
Integrin
|
Inflammation/Immunology
|
|
Risuteganib is a synthetic RGD (arginyl-glycyl-aspartic acid)-class peptide. Risuteganib is an anti-integrin that downregulates oxidative stress and restores homeostasis, and targets three integrin receptors that are implicated in dry age-related macular degeneration (AMD) in order to restore homeostasis in the retina .
|
-
- HY-P10534
-
|
|
Prion Protein
|
Infection
Neurological Disease
|
|
CCβ is a simple 17-amino acid peptide designed in research. CCβ is able to mimic the conformational transition of proteins from α-helix to β-sheet, which is a key step in the aggregation of proteins associated with many diseases, such as Alzheimer's disease and prion disease. CCβ can be used to study diseases related to protein aggregation .
|
-
- HY-P1630
-
|
|
Bacterial
|
Infection
|
|
Buforin II, derived from buforin I, a protein isolated from the stomach of the Asian toad Bufo bufo gargarizans, is a potent antimicrobial peptide. Buforin II has antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria .
|
-
- HY-P1210A
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
-
- HY-P0316A
-
|
|
Thrombin
NO Synthase
|
Cardiovascular Disease
|
|
TP508 TFA is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 TFA activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 TFA activates endothelial cells and stem cells to revascularize and regenerate tissues .
|
-
- HY-17571AR
-
|
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (acetate) (Standard) is the analytical standard of Oxytocin (acetate). This product is intended for research and analytical applications. Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P1815
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P3512
-
|
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
Cancer
|
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
- HY-P5547
-
|
|
Bacterial
|
Infection
|
|
Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection
|
-
- HY-P5179
-
|
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P5180
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P5546
-
|
|
Bacterial
|
Infection
|
|
Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-256 μg/mL for methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection
|
-
- HY-P1293
-
|
|
iGluR
|
Neurological Disease
|
|
Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. Conantokin G inhibits NMDA-evoked currents in murine cortical neurons with an IC50 of 480 nM. Conantokin G has neuroprotective properties .
|
-
- HY-P5863
-
|
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
-
- HY-P0027
-
|
|
Arp2/3 Complex
Fungal
|
Infection
Cancer
|
|
Jasplakinolide is a potent actin polymerization inducer and stabilizes pre-existing actin filaments. Jasplakinolide binds to F-actin competitively with phalloidin with a Kd of 15 nM. Jasplakinolide, a naturally occurring cyclic peptide from the marine sponge, has both fungicidal and anti-cancer activity .
|
-
- HY-P5498
-
|
|
HIV
|
Others
|
|
N36 peptide is a biological active peptide. (HIV-1 gp41 fusion peptide)
|
-
- HY-W755222
-
|
(S)-NODAG
|
Biochemical Assay Reagents
|
Cancer
|
|
(S)-NODAGA-tris(t-Bu ester) ((S)-NODAG) is a NODAGA derivative. (S)-NODAGA-tris(t-Bu ester) can be used to label peptides, antibodies, etc., and subsequently radiolabeled for PET imaging .
|
-
- HY-W591317
-
|
(R)-NODAG
|
Radionuclide-Drug Conjugates (RDCs)
|
Cancer
|
|
(R)-NODAGA-tris(t-Bu ester) ((R)-NODAG) is a NODAGA derivative. (R)-NODAGA-tris(t-Bu ester) can be used to label peptides, antibodies, etc., and subsequently radiolabeled for PET imaging .
|
-
- HY-P5561
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Aurein 2.2 is a major component of the skin secretion of L.aurea. Aurein 2.2 is an antibiotic with broad-spectrum antibacterial activity against Gram positive bacteria such as Staphylococcus aureus and S. epidermidis .
|
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
- HY-W006069
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
H-Phe(3,5-DiF)-OH is a difluorophenylalanines in the L-configuration [L-(F2)Phe]. H-Phe(3,5-DiF)-OH can be incorporated into the thrombin receptor-tethered ligand peptide SFLLRNP to identify the phenyl hydrogens of the Phe-2 residue involved in the CH/π receptor interaction .
|
-
- HY-P1045A
-
|
|
Arp2/3 Complex
|
Others
|
|
187-1, N-WASP inhibitor TFA, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor TFA potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor TFA prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein .
|
-
- HY-14743
-
|
SCV 07; Gamma-D-glutamyl-L-tryptophan
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod (SCV-07), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod (SCV-07) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod (SCV-07) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2) .
|
-
- HY-P1416A
-
|
|
Wnt
|
Cancer
|
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model .
|
-
- HY-P10230
-
|
|
Bacterial
|
Infection
|
|
Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM .
|
-
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P3507
-
|
ShK-186
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
|
Dalazatide (ShK-186) is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease .
|
-
- HY-P1791
-
|
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
-
- HY-P1815A
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P10440
-
|
|
CDK
|
Neurological Disease
|
|
Cdk5i peptide is a 12-amino acid peptide fragment derived from Cdk5. Cdk5i peptide is an inhibitor of Cdk5 peptide. Cdk5i peptide can be used in the stud y of neurodegenerative diseases .
|
-
- HY-P1222B
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P3816
-
|
|
PKC
|
Others
|
|
PKCε Inhibitor Scramble Peptide is a scrambled peptide with identical amino acid composition to PKCε inhibitor peptide.
|
-
- HY-150242A
-
|
|
Liposome
|
Others
|
|
Cbz-Ala-Ala-Asn TFA is a peptide that designed based on the sequence of the substrate of legumain. Legumain is a cysteine protease. Cbz-Ala-Ala-Asn TFA can be applied as a scaffold for drug delivery .
|
-
- HY-132988
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Tyr(3-F,tBu)-OH is a cyclic peptide compound with high membrane permeability and can specifically binds to a target molecule (extracted from patent WO2018225864A1) .
|
-
- HY-P10464
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
-
- HY-W088805
-
|
Fmoc-3-carboxypiperidine
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-NIP-OH (Fmoc-3-carboxypiperidine) is a Fmoc-protected amino acid derivative commonly used in peptide synthesis .
|
-
- HY-P1512
-
|
|
SOD
|
Cancer
|
|
Antioxidant peptide A is a short peptide, which contains alternative aromatic or sulfur-containing amino acid. The side chains of Antioxidant peptide A are believed to contribute to strong radical scavenging activities of peptides in the cancer cell.
|
-
- HY-105063
-
|
|
HSP
|
Metabolic Disease
Inflammation/Immunology
|
|
DiaPep277 is a 24 amino acid peptide derived from positions 437-460 in HSP60. DiaPep277 arrests the progression of β-cell destruction in NOD mice. DiaPep277 has an immune modulatory effect on diabetogenic T cells in animal models of diabetes .
|
-
- HY-P1346
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P5551
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells .
|
-
- HY-P10552
-
|
|
CXCR
|
Inflammation/Immunology
|
|
pCXCL8-1aa is an anti-inflammatory peptide. pCXCL8-1aa competitively inhibits the binding of CXCL8 to glycosaminoglycans such as heparin sulfate (HS) by binding with high affinity. This reduces the presentation of CXCL8 on the surface of vascular endothelial cells, thereby inhibiting neutrophil migration and inflammatory responses. pCXCL8-1aa can be used to study inflammatory diseases such as rheumatoid arthritis .
|
-
- HY-P3513
-
|
|
ERK
MMP
|
Neurological Disease
|
|
β-Neo-Endorphin is an endogenous opioid peptide. β-Neo-Endorphin is a hypothalamic “big” Leu-enkephalin of porcine origin. β-Neo-Endorphin shows activation of the Erk1/2, MMP-2 and MMP-9 .
|
-
- HY-P3386A
-
|
Cpne7-DP acetate
|
Calcium Channel
|
Metabolic Disease
|
|
Selcopintide (Cpne7-DP) acetate consists of a synthetic peptide corresponding to the 10 amino acid residue 344-353 fragment of the hCPNE7 protein. Selcopintide acetate highly reproduces the in vitro effects of CPNE7 by upregulating odontoblast marker genes, DSPP, and Nestin. Selcopintide acetate promotes dentin regeneration in dentinal defects of various degrees and that the regenerated hard tissue demonstrates the characteristics of true dentin .
|
-
- HY-P3386
-
|
Cpne7-DP
|
Calcium Channel
|
Metabolic Disease
|
|
Selcopintide (Cpne7-DP) consists of a synthetic peptide corresponding to the 10 amino acid residue 344-353 fragment of the hCPNE7 protein. Selcopintide highly reproduces the in vitro effects of CPNE7 by upregulating odontoblast marker genes, DSPP, and Nestin. Selcopintide promotes dentin regeneration in dentinal defects of various degrees and that the regenerated hard tissue demonstrates the characteristics of true dentin .
|
-
- HY-P2317
-
|
|
Bacterial
Endogenous Metabolite
|
Infection
|
|
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection .
|
-
- HY-P1346A
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1651
-
|
|
TRP Channel
|
Cancer
|
|
SOR-C13, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 has anticancer activity .
|
-
- HY-P5016
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
Cancer
|
|
CRAMP-18 (mouse) is an antibiotic peptide without hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has the potential to study antifungal, antibacterial and antitumor .
|
-
- HY-157269
-
|
|
Others
|
Inflammation/Immunology
|
|
J10-1 is a hapten. J10-1 promotes peptide exchange of all DR alleles (DR1, DR2, DR4 (DRB1*0401)) and promotes peptide binding to MHC II, which can be used in the study of immune regulation .
|
-
- HY-P4082
-
|
HER2-binding peptide
|
EGFR
|
Cancer
|
|
ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research .
|
-
- HY-P10810
-
|
|
Wnt
β-catenin
|
Cancer
|
|
QPH-FR, a quinoa peptide, is a leucine-rich repeat-containing G-protein-coupled receptor 5 (LGR5) inhibitor. QPH-FR competitively suppresses the formation of the LGR5/RSPO1 complex by binding to LGR5. QPH-FR causes RNF43/ZNRF3 to ubiquitinate the FZD receptor, thereby suppressing the Wnt/β-catenin signaling pathway and exerting stemness inhibition .
|
-
- HY-P2980
-
|
EC 3.4.2.1
|
Endogenous Metabolite
|
Others
|
|
Carboxypeptidase A, Bovine pancreas (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems .
|
-
- HY-P2981
-
|
Carboxypeptidase Y; EC 3.4.16.1
|
Carboxypeptidase
|
Others
|
|
Carboxypeptidase C is a carboxypeptidase, is often used in biochemical studies. Carboxypeptidase C removes COOH-terminal lysine, arginine, and proline, as well as all other neutral, aliphatic, aromatic, and the acidic protein amino acids of a peptide chain .
|
-
- HY-153686
-
-
- HY-P4073
-
|
GRN1005; Paclitaxel trevatide
|
Peptide-Drug Conjugates (PDCs)
LDLR
|
Cancer
|
|
ANG1005 (Paclitaxel trevatide) is a brain-penetrating peptide-drug conjugate. ANG1005, a taxane derivative, consists of three paclitaxel (HY-B0015) molecules covalently linked to Angiopep-2, designed to cross the blood-brain and blood-cerebrospinal barriers and to penetrate malignant cells via low density lipoprotein receptor-related protein (LRP1) transport system .
|
-
- HY-P2289
-
|
pBD-1
|
Bacterial
|
Infection
|
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P5931
-
|
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
-
- HY-P1404
-
|
|
Pim
|
Cancer
|
|
R8-T198wt is a cell-permeable carboxyl-terminal p27 Kip1 peptide exhibits anti-tumor activity by inhibiting Pim-1 kinase .
|
-
- HY-P1471A
-
|
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P10383A
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P10157
-
|
|
Biochemical Assay Reagents
|
Others
|
|
ARF(1-22) is potentially capable of intracellular penetration to deliver small molecules, proteins, imaging agents, and pharmaceutical nanocarriers .
|
-
- HY-N14923
-
|
|
Fungal
|
Infection
|
|
Nikkomycin Lz is a nucleoside peptide antifungal compound isolated from genetically engineered Streptomyces tendae TU901. Nikkomycin Lz has antifungal activity against Candida albicans .
|
-
- HY-P5410
-
|
|
MHC
|
Others
|
|
OVA-Q4 Peptide is a biological active peptide. (Q4 Peptide (SIIQFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).)
|
-
- HY-131083
-
-
- HY-P1513
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P1489
-
|
|
MHC
|
Inflammation/Immunology
|
|
OVA Peptide(257-264) is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
|
-
- HY-P2324
-
|
|
Bacterial
HIF/HIF Prolyl-Hydroxylase
Antibiotic
|
Infection
Cancer
|
|
Gramicidin A is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Gramicidin A is a highly hydrophobic channel-forming ionophore that forms channels in model membranes that are permeable to monovalent cations. Gramicidin A induces degradation of hypoxia inducible factor 1 α (HIF-1α) .
|
-
- HY-105172
-
|
CAP-232; TLN-232
|
Somatostatin Receptor
|
Inflammation/Immunology
Cancer
|
|
TT-232 (CAP-232), a somatostatin derivative, is a peptide SSTR1/SSTR4 agonist. TT-232 inhibits cancer cell proliferation and induces apoptosis. TT-232 is also a broad-spectrum anti-inflammatory and analgesic agent .
|
-
- HY-P1651A
-
|
|
TRP Channel
|
Cancer
|
|
SOR-C13 TFA, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 TFA has anticancer activity .
|
-
- HY-P5182
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P10701
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
|
Q11 peptide is a β-sheet-forming peptide that plays an important role in self-assembly and targeted applications. As a scaffold peptide, Q11 peptide can display immunogenic epitopes and is widely used in peptide-based immune vaccine research. Additionally, Q11 peptide can be conjugated with MUC1 glycopeptides for the study of self-assembling, adjuvant-free MUC1 glycopeptide vaccines. Q11 peptide holds great potential for research in the field of cancer immunology .
|
-
- HY-P10593
-
|
|
Transmembrane Glycoprotein
Influenza Virus
|
Cancer
|
|
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
|
-
- HY-P1489A
-
|
|
MHC
|
Inflammation/Immunology
|
|
OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
|
-
- HY-P1489B
-
|
|
MHC
|
Inflammation/Immunology
|
|
OVA Peptide(257-264) acetate salt is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb .
|
-
- HY-P10316
-
|
Calmodulin-Dependent Protein Kinase I (299-320) Binding Domain
|
CaMK
|
Others
|
|
CaMKI (299-320) refers to a peptide consisting of residues 299-320 of Calcium/calmodulin-dependent protein kinase I (CaMKI). CaMKI (299-320), as a protein kinase, has a high affinity interaction with Ca 2+-CAM (Kd≤1 nM≤1 nM), which can phosphorylate specific substrate proteins, thereby regulating their activity. CaMKI (299-320) contains the CAM-binding domain and the self-inhibition domain, and CaMKI (299-320) can be used to study cell physiological processes, including cell proliferation, differentiation, and apoptosis .
|
-
- HY-P10420
-
|
|
CD47
Interleukin Related
|
Cancer
|
|
RS17 is an anti-tumor peptide designed to bind specifically to the CD47 molecule and block the interaction between CD47 and its ligand, SIRPα, on the surface membrane of macrophages. The main regulatory mechanism of RS17 is to prevent CD47 from transmitting selective phagocytosis signals to SIRPα by binding to CD47, so that macrophages do not recognize tumor cells as their own tissue, but phagocytose them as foreign substances, thereby inhibiting immune escape of tumor cells. RS17 can be used to study the mechanism of anti-tumor response and immune escape .
|
-
- HY-P10384A
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-2 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-2 (HY-P10384). SPSB2-iNOS inhibitory cyclic peptide-2 TFA is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 21 nM. SPSB2-iNOS inhibitory cyclic peptide-2 TFA is reduction-resistant and oxidatively stable .
|
-
- HY-P0223A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
FLAG peptide TFA is the TFA salt form of FLAG peptide (HY-P0223). FLAG peptide TFA is a multifunctional fusion tag for the purification of recombinant proteins. FLAG peptide TFA maintances the natural folding of its fusing proteins. FLAG peptide TFA can be removed by enterokinase, and eluted under non-denaturing conditions .
|
-
- HY-P10536
-
|
|
Bacterial
|
Infection
|
|
Temporin SHF is a broad-spectrum antimicrobial peptide that is active against Gram-positive and Gram-negative bacteria and yeasts, but does not have hemolytic activity. Temporin SHF disrupts the acyl chain stacking of anionic lipid bilayers, leading to cracks and disintegration of microbial membranes. Temporin SHF can be used in the development of antimicrobial drugs .
|
-
- HY-P2505
-
|
|
Syk
|
Others
|
|
Syk Kinase Peptide Substrate is a Syk kinase peptide substrate.
|
-
- HY-P10404
-
|
|
α-synuclein
|
Others
Neurological Disease
|
|
Pdpe 1.3 is a peptide inhibitor, The main activity is to destroy the direct interaction between α-synuclein and CHarged Multivesicular body Protein 2B (CHMP2B). By interfering with this interaction, PDpep1.3 restores the degradation function of the endocytosomes and lysosomes, thereby reducing alpha-synuclein levels and protecting dopaminergic neurons from alpha-synuclein mediated degradation. Pdpe 1.3 can be used in the study of neurodegenerative diseases and protein-protein interactions .
|
-
- HY-13443A
-
-
- HY-P3777
-
|
|
Potassium Channel
|
Neurological Disease
|
|
β-Bag cell peptide is a neuroactive peptide. β-Bag cell peptide elevates cyclic AMP levels in the bag cell neurons. β-Bag cell peptide decreases the amplitudes of the voltage-dependent potassium currents .
|
-
- HY-107989
-
|
|
Antibiotic
|
Endocrinology
|
|
Urofollitropin is a protein extract of human menopausal urine. Urofollitropin has the function of promoting follicle development and maturation, but contains very small amounts of urinary proteins .
|
-
- HY-106882
-
|
MDL 62879
|
Bacterial
Antibiotic
|
Infection
|
|
GE 2270A (MDL 62879) is an antibiotic. GE 2270A inhibits gram-positive bacteria and anaerobes by inhibiting protein synthesis. GE 2270A can be used for the research of infection .
|
-
- HY-P5411
-
|
SIITFEKL, OVA (257-264) Variant
|
MHC
|
Others
|
|
OVA-T4 Peptide (SIITFEKL, OVA (257-264) Variant) is a biological active peptide. (T4 peptide (SIITFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).)
|
-
- HY-P10832
-
|
|
Apoptosis
Ras
Raf
MEK
ERK
Caspase
PARP
Bcl-2 Family
|
Cancer
|
|
ATWLPPRAANLLMAAS is a chimeric peptide with anti-angiogenic and potent anti-tumor effects. ATWLPPRAANLLMAAS can inhibit the proliferation, viability, migration, and invasion of human hepatocellular carcinoma cells, and induce apoptosis. .
|
-
- HY-P10616
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Salusin-α is an endogenous bioactive peptide with hemodynamic and cell proliferation activities. Salusin-α can stimulate the proliferation of quiescent vascular smooth muscle cells (VSMCs) and fibroblasts, leading to a rapid and significant decrease in blood pressure and heart rate, but its effect is weaker than that of Salusin-β (HY-P10617). Salusin-α has potential application value in cardiovascular disease research .
|
-
- HY-114350
-
|
|
Fluorescent Dye
|
Others
|
|
BDP FL maleimide is a thiol-reactive dye (Ex: 503 nm; Em: 509 nm). BDP FL maleimide can be used for protein labeling, peptide modification, and can replace fluorescein (FAM) for microscopy .
|
-
- HY-P1459
-
|
|
Bacterial
|
Infection
|
|
Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
|
-
- HY-P3576
-
|
|
Fluorescent Dye
|
Neurological Disease
Cancer
|
|
Biotin-Gastrin Releasing Peptide, human is a biotinylated gastrin releasing peptide (GRP). Gastrin-releasing peptide (GRP) is a neuropeptide with growth-stimulatory and tumorigenic properties .
|
-
- HY-P3964
-
|
|
Endogenous Metabolite
|
Endocrinology
|
|
TRH Precursor Peptide is a precursor peptide of thyrotropin-releasing hormone (TRH). TRH Precursor Peptide formation of TRH in rat brain and pituitary is zinc-dependent .
|
-
- HY-P3528
-
|
|
Caspase
Apoptosis
|
Neurological Disease
|
|
GPR is a three amino acid peptide. GPR can rescue cultured rat hippocampal neurons from Aβ-induced neuronal death by inhibiting caspase-3/p53 dependent apoptosis. GPR can be used for the research of Alzheimer's disease (AD).
|
-
- HY-P3708
-
-
- HY-148140
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Cross-linked dextran G 25 is a dextran chromatography medium. Cross-linked dextran G 25 separates from 1 to 5 kD (spherical proteins) and can be used for the separation of peptides as well as for the desalting and buffer replacement of large molecule proteins .
|
-
- HY-P10539
-
|
|
Bacterial
|
Infection
|
|
Hp1404 is a novel cationic antimicrobial peptide. Hp1404 has specific inhibitory activity against Gram-positive bacteria, including Staphylococcus aureus (MRSA) resistant to Laburnetin (HY-N7382). Hp1404 has antimicrobial activity, low toxicity, and is not prone to drug resistance, and can be used in the research of antimicrobial agents .
|
-
- HY-P5724
-
|
|
Bacterial
|
Infection
|
|
Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality .
|
-
- HY-P5203
-
|
EntK1
|
Bacterial
|
Infection
|
|
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections .
|
-
- HY-P10538
-
|
|
Bacterial
Fungal
|
Infection
|
|
Balteatide is an antimicrobial peptide, which can be found in skin secretion of Phyllomedusa baltea. Balteatide inhibits the gram-positive Staphylococcus aureus (MIC=435 μM), the gram-negative Escherichia coli (MIC=109 μM), and Candida albicans (MIC=27 μM). Balteatide lacks hemolytic activity (at 512 mg/L) and myotropic activity .
|
-
- HY-P5781
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
-
- HY-P3612
-
|
|
CXCR
|
Inflammation/Immunology
|
|
CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research .
|
-
- HY-P2168
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Demoxytocin, a heterodetic cyclic peptide, is an analog of oxytocin. Demoxytocin affects the permeability of the cell membrane, increasing the content of calcium ions in smooth muscle cells, increasing its contraction. Demoxytocin also stimulates the contraction of smooth muscles of the uterus. Demoxytocin has the function of oxytocin. Demoxytocin can be used to research stimulation of labor in cases of premature rupture .
|
-
- HY-P3356
-
|
|
Elastase
Proteasome
|
Inflammation/Immunology
|
|
Cyclotheonellazole A is a natural macrocyclic peptide and a potent elastase inhibitor (IC50=0.034 nM). Cyclotheonellazole A inhibits chymotrypsin with an IC50 value of 0.62 nM .
|
-
- HY-W044285
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-4-Aph(cBm)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize biologically active peptide mimetics, such as Ac-D2Nal-D4Cpa-D3Pal-Ser-4Aph/4Amf(P)-D4Aph/D4Amf(Q)-Leu-ILys-Pro-DAla-NH2 with gonadotropin-releasing hormone (GnRH) antagonist activity .
|
-
- HY-P1369
-
|
|
Dynamin
|
Neurological Disease
|
|
DynaMin inhibitory peptide, myristoylated is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated is a membrane-permeant form of the peptide that prevents endocytosis .
|
-
- HY-P5391
-
|
|
Bacterial
|
Others
|
|
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
|
-
- HY-D0819
-
|
Cy5 NHS Ester; Sulfo-Cyanine5 Succinimidyl Ester
|
Fluorescent Dye
|
Others
|
|
Cy5-SE (Cy5 NHS Ester) is a reactive dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. This dye requires small amount of organic co-solvent (such as DMF or DMSO) to be used in labeling reaction. This reagent is ideal for very cost-efficient labeling of soluble proteins, as well as all kinds of peptides and oligonucleotides. This reagent also works well in organic solvents for small molecule labeling.
Excitation (nm):649, Emission (nm): 670.
|
-
- HY-P3630
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Stick Insect Hypertrehalosaemic Factor II is a synthetic peptide. Stick Insect Hypertrehalosaemic Factor II has the same FAB spectra, reversed-phase high-performance liquid chromatographic behavior, and biological behavior as the natural material. Stick Insect Hypertrehalosaemic Factor II can be used for the research of hypertrehalosaemic effect .
|
-
- HY-P10385A
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-3 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-3 (HY-P10385). SPSB2-iNOS inhibitory cyclic peptide-3 TFA is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 7 nM .
|
-
- HY-P3418A
-
|
|
CCR
ERK
|
Inflammation/Immunology
|
|
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
|
-
- HY-P3418
-
|
|
CCR
ERK
|
Inflammation/Immunology
|
|
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research .
|
-
- HY-P10737
-
-
- HY-P1559
-
-
- HY-P1391
-
|
|
iGluR
|
Others
|
|
ZIP(Scrambled) is a scrambled control peptide for zeta inhibitory peptide (ZIP) .
|
-
- HY-P1491
-
|
|
HIV
|
Infection
|
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
-
- HY-P1333A
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A TFA is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A TFA is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A TFA can induce neuronal death, and can be used in the research of neurological disease .
|
-
- HY-P2534
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
C-Peptide 2, rat, 31-amino-acid peptide, is a component of proinsulin. C-Peptide 2, rat can inhibit glucose-induced insulin secretion .
|
-
- HY-P10778
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .
|
-
- HY-P10709
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Cancer
|
|
CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
-
- HY-P10839
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
NBD peptide inhibits NF-κB signaling pathway through inhibition of the NEMO-IKK complex combination. NBD peptide exhibits anti-inflammatory efficacy through block of pro-inflammatory cytokines production. NBD peptide exhibits immunosuppressive activity through regulation of immune cells. NBD peptide enhances its transmembrane ability by combining with cell-penetrating peptide HIV-TAT .
|
-
- HY-P5545
-
|
|
Bacterial
|
Infection
|
|
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection .
|
-
- HY-P5771
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
-
- HY-P1629
-
|
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Temporin A is a short alpha-helical antimicrobial peptide isolated from the skin of the frog Rana temporaria. Temporin A is effective against a broad spectrum of Gram-positive bacteria. Temporin A interacts directly with the cell membrane of the microorganism and it is non-toxic to erythrocytes at concentrations that are antimicrobial. Temporin A also has antifungal activities (against yeast-like Candida albicans) .
|
-
- HY-P5780
-
|
|
Sodium Channel
|
Neurological Disease
|
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
-
- HY-W324458
-
|
|
Fluorescent Dye
|
Others
|
|
MCA succinimidyl ester is a derivative of MCA (HY-W027544). MCA succinimidyl ester has succinimidyl ester can react selectively with amines. MCA succinimidyl ester can be used as peptide substrate for fluorescence resonance energy transfer .
|
-
- HY-P10596
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
Lasioglossin-III is an antimicrobial peptide that can be isolated from the venom of wild bees. Lasioglossin-III has high antibacterial activity against Gram-positive and Gram-negative bacteria, antifungal activity and antitumor activity. Lasioglossin-III has certain cytotoxicity against three cancer cell lines (HeLa S3, CRC SW 480 and CCRF-CEM T) with IC50 values of 4, 18 and 5 μM, respectively .
|
-
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
- HY-P2641
-
|
|
MMP
|
Cancer
|
|
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
|
-
- HY-P1369A
-
|
|
Dynamin
|
Neurological Disease
|
|
DynaMin inhibitory peptide, myristoylated TFA is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated TFA is a membrane-permeant form of the peptide that prevents endocytosis .
|
-
- HY-P3159
-
|
|
Biochemical Assay Reagents
|
Others
|
|
VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel .
|
-
- HY-P5432
-
|
IRAK-1 (360-380)
|
IRAK
|
Others
|
|
IRAK-4 Peptide substrate (IRAK-1 (360-380)) is a biological active peptide. (This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4)
|
-
- HY-P5439
-
|
|
PKC
MARCKS
|
Others
|
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P1756
-
-
- HY-P5456
-
|
|
PKC
|
Others
|
|
KRPpSQRHGSKY-NH2 is a biological active peptide. (This is a phosphorylated PKC substrate peptide)
|
-
- HY-P1546
-
|
|
Bacterial
|
Infection
|
|
Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.
|
-
- HY-P5359
-
-
- HY-P2547
-
|
|
Src
|
Others
|
|
Tyrosine Kinase Peptide 1 is a control substrate peptide for c-Src assay .
|
-
- HY-P1391A
-
|
|
PKC
|
Others
|
|
ZIP(Scrambled) TFA is a scrambled control peptide for zeta inhibitory peptide (ZIP) .
|
-
- HY-P5388
-
|
|
Renin
|
Others
|
|
Renin inhibitor peptide,rat is a biological active peptide. (A specific rat renin inhibitor.)
|
-
- HY-P1559A
-
-
- HY-P5910
-
|
|
MDM-2/p53
Apoptosis
|
Cancer
|
|
Azurin p28 peptide is a tumor-penetrated antitumor peptide. Azurin p28 peptide redues proteasomal degradation of p53 through formation of a p28: p53 complex. Azurin p28 peptide induces apoptosis or cell cycle arrest. Azurin p28 peptide inhibits p53-positive tumor growths. Azurin p28 peptide shows antiangiogenic effect by inhibiting phosphorylation of VEGFR-2, FAK and Akt .
|
-
- HY-P10383
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P1136B
-
-
- HY-P10736A
-
|
|
GCGR
|
Metabolic Disease
|
|
AMG133 peptide payload TFA is the TFA salt form of AMG133 peptide payload (HY-P10736). AMG133 peptide payload TFA is a GLP-1 agonist that can be used for synthesis of AMG133 (HY-164535) as a peptide linker conjugate .
|
-
- HY-W003592A
-
|
|
Drug Intermediate
|
Others
|
|
L-Orinithine lactam hydrochloride is a synthetic intermediate. L-Orinithine lactam (hydrochloride) can be used in the synthesis of dipeptidyl peptidase 4 (DPP-4) inhibitors, as well as signaling peptides .
|
-
- HY-P10634
-
|
|
TGF-beta/Smad
|
Others
|
|
P17 Peptide is a human TGF-β1 inhibitory peptide. P17 Peptide can block woodchuck TGF-β1 activity .
|
-
- HY-P5189A
-
|
|
Endogenous Metabolite
Cholinesterase (ChE)
|
Others
|
|
His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA, is a growth hormone releasing peptide, as well as a metabolite of GHRP-1. GHRP-1, or Ala-His-D-beta Nal-Ala-Trp-D-Phe-Lys-NH2, has the effect of promoting the release of growth hormone (GH). GHRP-1 increases GH release and increases [Ca2+]i levels in static monolayer cells of rat pituitary gland, but does not affect cAMP levels .
|
-
- HY-P10622
-
|
|
Apoptosis
Reactive Oxygen Species
|
Metabolic Disease
Cancer
|
|
SHLP-3 is a mitochondrial derived peptide encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP-3 increases cell viability and reduces apoptosis in insulinoma NIT-1β cells and human prostate cancer 22Rv1 cells. SHLP-3 increases mitochondrial function and exerts cytoprotective effects by increasing mitochondrial oxygen consumption rate (OCR), cellular ATP and reducing the ability to produce ROS. SHLP-3 can be used in the study of diabetes and cancer .
|
-
- HY-P10216
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
CAQK peptide selectively binds to injured mouse brain. CAQK peptide selectively targets demyelinating areas and it is absent from healthy tissue. The CAQK peptide target is a proteoglycan complex upregulated in brain injuries and is used for drug delivery. CAQK peptide can penetrate the blood-brain barrier .
|
-
- HY-P10242
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 can be used for researches of muscle atrophic disorders .
|
-
- HY-P5526
-
|
|
Casein Kinase
|
Others
|
|
CCK1-specific peptide substrate is a biological active peptide. (This peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated. It is a peptide substrate for Casein Kinase I (CK1). CK1 phosphorylates Ser10. Ser7 is phosphorylated by PKA in vivo.)
|
-
- HY-P4109
-
|
NT21MP; V1 peptide
|
CXCR
|
Inflammation/Immunology
Cancer
|
|
vMIP-II (1-21) (NT21MP) is an inhibitor of CXCR4. vMIP-II (1-21) interacts broadly with CC and CXC chemokine receptors. vMIP-II (1-21) inhibits CXCR4 by competing with 125I-SDF-1R for binding sites (IC50=190 nM) .
|
-
- HY-P5497
-
|
|
HIV
|
Others
|
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
-
- HY-P5450
-
|
|
PDK-1
|
Others
|
|
PDKtide is a biological active peptide. (This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).)
|
-
- HY-P2504
-
|
|
Syk
|
Others
|
|
Syk Kinase Peptide Substrate, Biotin labeled is a biotin-labled Syk kinase peptide substrate.
|
-
- HY-P5381
-
|
|
NADPH Oxidase
|
Others
|
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
-
- HY-P1878
-
-
- HY-P5433F
-
|
|
Insulin Receptor
|
Others
|
|
IRS-1 Peptide, FAM labeled is a biological active peptide. (Insulin receptor substrate)
|
-
- HY-P3946
-
-
- HY-P5165
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
-
- HY-P5324
-
|
|
Bcl-2 Family
|
Others
|
|
Bad BH3 (mouse) is a biological active peptide. (This is a bcl-2 binding peptide. This peptide is derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165.)
|
-
- HY-P1190
-
|
|
JNK
Apoptosis
|
Inflammation/Immunology
|
|
c-JUN peptide is a cell-permeable c-JUN-JNK interaction inhibitor. c-JUN peptide inhibits serum-induced c-Jun phosphorylation. c-JUN peptide induces apoptosis .
|
-
- HY-P1113
-
|
|
GSK-3
|
Others
|
|
Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases .
|
-
- HY-P1113A
-
|
|
GSK-3
|
Others
|
|
Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases .
|
-
- HY-P3159A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel .
|
-
- HY-D0177
-
|
Benzotriazole-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate
|
Biochemical Assay Reagents
|
Others
|
|
(Benzotriazol-1-yloxy)tripyrrolidinophosphonium hexafluorophosphate (Benzotriazole-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate) is a peptide coupling reagent and can be utilized in solid phase synthesis test .
|
-
- HY-P5910A
-
|
|
MDM-2/p53
Apoptosis
|
Cancer
|
|
Azurin p28 peptide TFA is a tumor-penetrated antitumor peptide. Azurin p28 peptide TFA redues proteasomal degradation of p53 through formation of a p28: p53 complex. Azurin p28 peptide TFA induces apoptosis or cell cycle arrest. Azurin p28 peptide TFA inhibits p53-positive tumor growths. Azurin p28 peptide TFA shows antiangiogenic effect by inhibiting phosphorylation of VEGFR-2, FAK and Akt .
|
-
- HY-P1136C
-
-
- HY-135414A
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine5 NHS ester bromide is a active compound, can be used to label amino groups in peptides, proteins, and oligonucleotides. Cyanine5 NHS ester bromide is a cyanine dye, fluorescence-labeling neurotensin (8-13) via arginine residues .
|
-
- HY-P5483
-
|
|
Bacterial
|
Others
|
|
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)
|
-
- HY-P10285
-
|
D-(KLAKLAK)2
|
Mitochondrial Metabolism
PARP
Caspase
|
Cancer
|
|
d-KLA Peptide is a synthetic pro-apoptotic peptide. d-KLA Peptide can specifically target mitochondria and induce apoptosis by destroying the mitochondrial membrane. d-KLA Peptide activates biochemical pathways associated with apoptosis, including the activation of caspase family proteins and PARP (poly ADP ribose polymerase). d-KLA Peptide can be used to carry and deliver genes or small molecules to enhance anti-tumor effects .
|
-
- HY-P2302
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
|
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
-
- HY-P2358
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
|
-
- HY-P3789
-
|
|
Orphan Receptor
|
Metabolic Disease
|
|
Prolactin-Releasing Peptide (12-31), rat is a fragment of the prolactin releasing peptide (PrRP). Prolactin-Releasing Peptide (12-31), rat shows high affinity for GPR10 receptors. Prolactin-Releasing Peptide (12-31), stimulates calcium mobilization in CHOK1 cells transfected with the PrRP receptor .
|
-
- HY-P10275
-
|
|
Apoptosis
|
Neurological Disease
|
|
Tat-NTS peptide is a cell-penetrating peptide with neuroprotective effects. Tat-NTS peptide can specifically inhibit the nuclear translocation of ANXA1 and reduce neuronal apoptosis in ischemic areas. Moreover, Tat-NTS peptide can reduce the volume of cerebral ischemic infarction and can be used in the research of ischemic stroke .
|
-
- HY-P5124
-
|
KLVFF
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
|
-
- HY-P10343
-
|
|
Autophagy
|
Inflammation/Immunology
|
|
Soybean peptide QRPR is an agonist of Autophagy. Soybean peptide QRPR activates cellular autophagy by upregulating the expression and activity of PIK3, AKT, and mTOR. Soybean peptide QRPR can reduce the inflammatory response .
|
-
- HY-P2469
-
-
- HY-P5463
-
|
|
Bacterial
|
Others
|
|
C18G is a biological active peptide. (C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.)
|
-
- HY-P10228
-
|
|
Fungal
Bacterial
|
Infection
|
|
S-Thanatin is an insect antimicrobial peptide with potent broad-spectrum antibacterial activity. S-Thanatin can inhibit the activity of Gram-negative bacteria, Gram-positive bacteria, and fungi, without cytotoxicity. The antibacterial activity of S-Thanatin is not affected by PH value, but monovalent cations (Na +/K +) can reduce its antibacterial activity against Gram-negative bacteria in a dose-dependent manner .
|
-
- HY-P5937
-
|
|
Apoptosis
|
Cancer
|
|
Caerin 1.1 TFA is a host defense peptide isolated from the glandular secretions of the Australian tree frog Litoria. Caerin 1.1 TFA inhibits HeLa cell proliferation and mediates apoptosis. Caerin 1.1 TFA may enhance adaptive T cell immune responses .
|
-
- HY-P1758
-
|
IRRP1
|
IFNAR
|
Infection
|
|
IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions .
|
-
- HY-P5889
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Thrombin receptor peptide ligand is a thrombin receptor antagonist peptide that can be used as an antithrombotic agent .
|
-
- HY-P5474
-
|
|
Bacterial
|
Others
|
|
PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.)
|
-
- HY-P1589
-
|
|
β-catenin
|
Cancer
|
|
β-catenin peptide is a 8-aa peptide, and can promote thymocyte positive selection.
|
-
- HY-P0301
-
|
|
TGF-β Receptor
|
Cancer
|
|
SLLK, Control Peptide for TSP1 Inhibitor is a control peptide for LSKL (leucine-serine-lysine-leucine).
|
-
- HY-P2259
-
|
|
iGluR
|
Neurological Disease
|
|
TAT-GluA2 3Y, an interference peptide, blocks long-term depression (LTD) at glutamatergic synapses by disrupting the endocytosis of AMPAR. TAT-GluA2 3Y can alleviate Pentobarbital-induced spatial memory deficits and synaptic depression .
|
-
- HY-P4095
-
|
|
CXCR
|
Cancer
|
|
NoxaBH3 is a cysteine-based cross-linked peptide with increased cell permeability and higher inhibitory activity against Mcl-1. NoxaBH3 binds to the endogenous CXCR4 ligand to produce ubiquitin-Noxabh3 conjugate. NoxaBH3 is then delivered to cancer cells .
|
-
- HY-P2200
-
|
BMY-29304
|
HIV
Antibiotic
|
Infection
Inflammation/Immunology
|
|
Siamycin I (BMY-29304), a 21-residue tricyclic peptide, is a secondary metabolite in actinomycetes. Siamycin I is a HIV fusion inhibitor with ED50s of 0.05 to 5.7 μM for acute HIV type 1 (HIV-1) and HIV-2 infections. Siamycin I inhibits the gelatinase and gelatinase biosynthesis-activating pheromone (GBAP) signaling via the FsrC-FsrA two-component regulatory system in a noncompetitive manner. Siamycin I suppresses the expression of both fsrBDC and gelE-sprE transcripts. Siamycin I, a lasso peptide, interacts with lipid II and inhibits cell wall biosynthesis. Siamycin I, an antibiotic, has the potential for enterococcal infections research .
|
-
- HY-P1565
-
|
TD 1 Disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P10844
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer .
|
-
- HY-P10242A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 TFA is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 TFA inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 TFA can be used for researches of muscle atrophic disorders .
|
-
- HY-P10617
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Salusin-β is an endogenous bioactive peptide with significant hemodynamic and mitogenic activity. Salusin-β can stimulate the proliferation of quiescent vascular smooth muscle cells (VSMCs) and fibroblasts, leading to a rapid and significant decrease in blood pressure and heart rate. In addition, Salusin-β can stimulate the release of arginine vasopressin from the pituitary gland in rats. This makes Salusin-β have important application potential in cardiovascular disease research .
|
-
- HY-P1075
-
CALP3
2 Publications Verification
|
Calcium Channel
|
Neurological Disease
Cancer
|
|
CALP3, a Ca 2+-like peptide, is a potent Ca 2+ channel blocker that activates EF hand motifs of Ca 2+-binding proteins. CALP3 can functionally mimic increased [Ca 2+]i by modulating the activity of Calmodulin (CaM), Ca 2+ channels and pumps. CALP3 has the potential in controlling apoptosis in diseases such as AIDS or neuronal loss due to ischemia .
|
-
- HY-P1573A
-
-
- HY-P5434
-
|
JAK3 Peptide substrate
|
JAK
|
Others
|
|
Jak3tide (JAK3 Peptide substrate) is a biological active peptide. (This peptide is a substrate for Jak3. It may be used used in kinase assays. Jak3tide contains the phosphorylation site at Tyr7.)
|
-
- HY-P3054
-
|
|
Ribosomal S6 Kinase (RSK)
|
Cardiovascular Disease
|
|
S6 peptide is a potentially important lamin kinase. S6 peptide is involved in the process of cardiac hypertrophy induced by mechanical loading. S6 peptide can be activated by many kinds of growth factors .
|
-
- HY-P1043A
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide Trifluoroacetatecontaining the Asn-Gly-Arg (NGR) motif. NGR peptide Trifluoroacetate binds to APN/CD13. NGR peptide Trifluoroacetate is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-P10106
-
|
|
PAK
|
Cancer
|
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
-
- HY-P10788
-
|
|
Complement System
|
Cancer
|
|
CK3 peptide is an NRP-1 targeting peptide with the amino acid sequence CLKADKAKC. The CK3 peptide specifically binds to NRP-1 to target breast cancer cells. Single-photon emission computed tomography (SPECT) and near-infrared fluorescence (NIRF) imaging show significant accumulation of CK3 peptide in xenograft tumors in nude mice. CK3 peptide can be used for molecular imaging studies of breast cancer.
|
-
- HY-P10789
-
|
|
Microtubule/Tubulin
|
Cancer
|
|
The P160 peptide is a breast cancer-targeting peptide that binds to the keratin 1 (KRT1) receptor on breast cancer cells, with a Kd of approximately 1.1 μM, demonstrating significant potential for targeted drug delivery to breast cancer cells. The P160 peptide enhances the cellular uptake and anticancer activity of the pro-apoptotic antimicrobial peptide MccJ25 (microcin J25). The P160 peptide can be used in cancer research .
|
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
- HY-P10372
-
|
|
Src
|
Cancer
|
|
pFYN peptide is a biotin-labled phosphorylated peptide substrate derived from FYN (a Src family kinase) .
|
-
- HY-P5384
-
|
|
NADPH Oxidase
|
Others
|
|
sgp91 ds-tat is a biological active peptide. (This is a scrambled control peptide for gp91 ds-tat.)
|
-
- HY-P1410
-
|
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P3084
-
|
hF-GRP
|
GnRH Receptor
|
Endocrinology
|
|
Human follicular gonadotropin releasing peptide (hF-GRP) is a hormone peptide. Human follicular gonadotropin releasing peptide can stimulate pituitary luteinizing hormone (LH) and follicle-stimulating hormone (FSH) secretion in vitro .
|
-
- HY-P0318
-
-
- HY-P10108
-
|
Hxk2VBD peptide, cell-permeable
|
Hexokinase
|
Neurological Disease
|
|
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth .
|
-
- HY-P1565A
-
|
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P5371
-
|
|
Thrombin
|
Others
|
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-P10509
-
|
|
CMV
|
Infection
|
|
IE1 peptide refers to an antigenic peptide encoded by the immediate early (IE) gene of mouse cytomegalovirus (mCMV). IE1 peptide is one of the key antigenic peptides expressed during mCMV infection, plays a role in transcriptional activation in the life cycle of mCMV, and is one of the earliest genes expressed in the viral replication cycle. IE1 peptide is an important target for CD8+ T cell response and can be used to study the host immune response to mCMV infection .
|
-
- HY-P2358A
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
PSMα3 TFA is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 TFA penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 TFA is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
|
-
- HY-P10416
-
|
Q14 peptide
|
Deubiquitinase
Mitophagy
|
Others
Neurological Disease
|
|
Q14 is a polypeptide derived from the USP30 (ubiquitin specific peptidase 30) transmembrane (TM) domain with the ability to inhibit the deubiquitination activity of USP30 (IC50=57.2 nM). Q14 reduces USP30 activity by inhibiting the interaction between the USP30 transmembrane domain and its catalytic domain. Q14 peptide contains the LC3 interaction region (LIR) motif, which enables it to bind to the LC3 and accelerate the formation of autophagosomes, thereby promoting mitophagy. Q14 can be used in the study of neurodegenerative diseases as well as mitochondrial quality control and cell metabolism .
|
-
- HY-P3874
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Peptide E is a potent kappa opiate receptor agonist. Peptide E has opiate receptor binding activity with IC50 value of 0.39 μM. Peptide E can be used for the research of central nervous system .
|
-
- HY-P5315
-
|
|
NO Synthase
|
Others
|
|
eNOS pT495 decoy peptide is a specific decoy peptide to prevent T495 phosphorylation reduced eNOS uncoupling and mitochondrial redistribution. eNOS pT495 decoy peptide is used in ventilator-induced lung injury research .
|
-
- HY-P10787
-
|
|
Complement System
|
Cancer
|
|
tLyP-1 peptide is an NRP-1 targeting peptide with an IC50 of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .
|
-
- HY-P2532
-
|
|
Integrin
|
Others
|
|
Integrin Binding Peptide is derived by fibronectin. Integrin Binding Peptide can be used for PEG hydrogel preparation .
|
-
- HY-P3770
-
|
|
PKC
|
Others
|
|
Phosphate acceptor peptide is a substrate for cAMP-dependent protein kinase (PKA). phosphate acceptor peptide is also a weak PKC inhibitor .
|
-
- HY-118593
-
|
Madumycin II; Antibiotic A 2315A
|
Antibiotic
|
Infection
|
|
A2315A (Madumycin II) is an alanine-containing streptogramin A antibiotic. A2315A is a potent peptidyl transferase center (PTC) inhibitor. A2315A inhibits the ribosome prior to the first cycle of peptide bond formation .
|
-
- HY-P3560
-
|
TV 4710
|
Apoptosis
|
Inflammation/Immunology
|
|
Edratide (TV 4710) is a synthetic peptide of 19 amino acid based on the complementarity-determining region 1 (CDR1) of a human anti-DNA antibody that expresses a major idiotype denoted 16/6 Id. Edratide reduces the rates of apoptosis (Apoptosis) and down-regulates of caspase-8 and caspase-3, up-regulates Bcl-xL. Edratide has the potential for the research of systemic lupus erythematosus (SLE) .
|
-
- HY-105066
-
|
|
Microtubule/Tubulin
Amyloid-β
|
Neurological Disease
|
|
Davunetide is an eight amino acid snippet derived from activity-dependent neuroprotective protein (ADNP), a neurotrophic factor that exists in the mammalian CNS. Davunetide possesses neuroprotective, neurotrophic and cognitive protective roperties. Davunetide, a microtubule-stabilizing peptide, interacts with and stabilises neuron-specific βIII-tubulin in vitro. Davunetide penetrates the blood-brain barrier and is non-toxic. Davunetide inhibits Aβ aggregation and Aβ-induced neurotoxicity .
|
-
- HY-P10515
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
AcrAP2 is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP2 is inhibitory against Gram-positive bacteria and yeast but is essentially inactive against Gram-negative bacteria. A cation-enhanced AcrAP2 analog (AcrAP2a) exhibits significant antiproliferative effects at low concentrations against certain human cancer cell lines. AcrAP2 can be used in antibacterial and anti-tumor research .
|
-
- HY-13545
-
|
|
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
ABT-510 is an anti-angiogenic TSP peptide (Thrombospondin-1 analogue) that induces apoptosis and inhibits ovarian tumour growth in an orthotopic, syngeneic model of epithelial ovarian cancer. ABT-510 also reduces angiogenesis and inflammatory responses in a murine model of inflammatory bowel disease. ABT-510 can be used in studies of cancer (particularly epithelial ovarian cancer) and inflammatory bowel disease (IBD) .
|
-
- HY-P1410A
-
|
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P6022
-
|
|
Integrin
|
Others
|
|
G4RGDSP, Integrin-binding peptide is a cell integrin-binding peptide that targets integrin receptors. G4RGDSP, integrin-binding peptide is coupled to alginate to increase the viability of cells in the scaffold. G4RGDSP, integrin-binding peptide can be used as an extrudable carrier for chondrocyte delivery for the study of 3D printing technology
|
-
- HY-142104
-
|
2-Chlorotrityl Chloride Resin (100-200 mesh,1% DVB,0.4-3.0mmol/g)
|
Biochemical Assay Reagents
|
Cancer
|
|
2-CTC Resin (100-200 mesh,1% DVB,0.4-3.0mmol/g) is an alkaline protein that has been used to study metabolic disorders in prostate cancer cells. It can be used as a reaction solution of terminal residues and adenine nucleotides to form cyclic peptides. 2-CTC Resin (100-200 mesh,1% DVB,0.4-3.0mmol/g) is one of the most commonly used and versatile resins available for large-scale production of peptides .
|
-
- HY-P0239A
-
|
|
Influenza Virus
|
Inflammation/Immunology
|
|
HA Peptide (TFA) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide (TFA) is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry .
|
-
- HY-P1075A
-
|
|
Calcium Channel
|
Neurological Disease
Cancer
|
|
CALP3 TFA, a Ca 2+-like peptide, is a potent Ca 2+ channel blocker that activates EF hand motifs of Ca 2+-binding proteins. CALP3 TFA can functionally mimic increased [Ca 2+]i by modulating the activity of Calmodulin (CaM), Ca 2+ channels and pumps. CALP3 TFA has the potential in controlling apoptosis in diseases such as AIDS or neuronal loss due to ischemia .
|
-
- HY-W009033
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Cbz-Lys(Boc)-OH is a protected amino acid, primarily utilized in peptide synthesis, protein engineering, and drug development, particularly in research involving lysine residues .
|
-
- HY-157414
-
|
|
Others
|
Others
|
|
Azide-A-DSBSO crosslinker is a mass spectrometry (MS)-cleavable, membrane-permeable, homobifunctional, azide-labeled, acid-cleavable cross-linked peptide. Azide-A-DSBSO crosslinker enables the study of protein-protein interactions via cross-linking mass spectrometry (XL-MS) .
|
-
- HY-P3318
-
-
- HY-P1021
-
-
- HY-P2495
-
-
- HY-P5884
-
|
|
PKC
|
Others
|
|
PKCθ pseudosubstrate peptide inhibitor, myristoylated is a synthetic peptide that can be used to study the mechanism of action of PKCθ .
|
-
- HY-P0301A
-
|
|
TGF-β Receptor
|
Cancer
|
|
SLLK, Control Peptide for TSP1 Inhibitor (TFA) is a control peptide for LSKL, which is a Thrombospondin (TSP-1) inhibitor.
|
-
- HY-P5431
-
|
|
Insulin Receptor
|
Others
|
|
Insulin receptor (1142-1153), pTyr1150 is a biological active peptide. (Peptide used as insulin receptor tyrosine kinase substrate.)
|
-
- HY-P1527
-
|
|
Bcl-2 Family
|
Others
|
|
Bim BH3 is a biological active peptide. (This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.)
|
-
- HY-P10088
-
-
- HY-15938
-
|
|
Fluorescent Dye
|
Others
|
|
5-FAM SE is a single isomer, is a fluorescent labeling reagent used for labeling peptides, proteins and nucleotides. 5-FAM SE can react with amines and can yield stable amine conjugates .
|
-
- HY-161079
-
|
|
Parasite
|
Infection
|
|
TDI-8304, a macrocyclic peptide, is a potent, species selective, and noncovalent Plasmodium falciparum (Pf20S) inhibitor. TDI-8304 shows highly selective for Pf20S over human proteasomes .
|
-
- HY-P0215
-
|
|
CaMK
Autophagy
|
Neurological Disease
|
|
Autocamtide-2-related inhibitory peptide, myristoylated is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM .
|
-
- HY-P3291
-
|
ZP7570
|
GCGR
|
Metabolic Disease
|
|
Dapiglutide (ZP7570) is a long-acting glucagon-like peptide-1 receptor 1R (GLP-1R)/Glucagon-like peptide-2 receptor (GLP-2R) dual agonist. Dapiglutide alleviates intestinal dysfunction in a mouse short bowel model and has anti-obesity effects .
|
-
- HY-P10384
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-2 (Compound CP2) is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 21 nM. SPSB2-iNOS inhibitory cyclic peptide-2 is reduction-resistant and oxidatively stable .
|
-
- HY-105174
-
|
|
JAK
FAK
|
Inflammation/Immunology
|
|
BPC 157 is the 15-amino acide fragment of gastric peptide BPC. BPC 157 exhibits wound healing promoting and neuroprotective activity. BPC 157 maintains the integrity of the gastrointestinal mucosa without significant toxicity. BPC 157 acetate counteracts NSAIDs/insulin overdose/copper-induced toxicity. BPC 157 ameliorates specific (over)stimulated/damaged neurotransmitter systems-induced behavioral disorders through serotonergic and dopaminergic systems .
|
-
- HY-P0215A
-
|
|
CaMK
Autophagy
|
Neurological Disease
|
|
Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM .
|
-
- HY-P1741
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Fibrinogen-Binding Peptide (designed by anticomplementarity hypothesis) is a presumptive peptide mimic of the vitronectin binding site on the fibrinogen receptor. Fibrinogen-Binding Peptide binds fibrinogen and inhibits both the adhesion of platelets to fibrinogen and platelet aggregation, and also inhibits the adhesion of platelets to vitronectin .
|
-
- HY-P5792
-
|
ANP (3-28) (human)
|
Endothelin Receptor
|
Cardiovascular Disease
Metabolic Disease
|
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
-
- HY-P1805
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
-
- HY-P2275B
-
-
- HY-P2491
-
|
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
-
- HY-P10543
-
|
|
BCL6
|
Cancer
|
|
SMRT peptide is one of the co-repressors of BCL6 BTB domain interaction. SMRT peptide binds to the BTB domain of BCL6 and enhances the transcriptional repression function of BCL6. SMRT peptide can be used to study protein-protein interactions .
|
-
- HY-P2495A
-
-
- HY-P5449
-
-
- HY-P10646
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
Muscle homing peptide M12 can preferentially bind to surface protein of muscle cells. Muscle homing peptide M12 mediates enhanced cellular uptake of nanoparticles (NPs) in myoblasts in vitro. Muscle homing peptide M12 is covalently conjugated to PLGA-PEG NPs via the N-terminal α-amino groups of peptides using the N-hydroxysuccinimide ester reaction .
|
-
- HY-P0097
-
|
Melanostatine-5
|
Melanocortin Receptor
|
Metabolic Disease
Endocrinology
Cancer
|
|
Nonapeptide-1 (Melanostatine-5), a peptide hormone, is a selective antagonist of MC1R (Ki: 40 nM). Nonapeptide-1 is a competitive α-MSH antagonist that potently inhibits intracellular cAMP and melanosome dispersion induced by α-MSH in melanocytes (IC50: 2.5 nM and 11 nM, respectively). Nonapeptide-1 inhibits melanin synthesis, and can be used in the research of skin pigmentation and regulation of steroid production in the adrenal gland, skin cancer .
|
-
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P1841
-
|
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
-
- HY-P5827
-
-
- HY-P1376
-
|
|
mAChR
Adrenergic Receptor
|
Endocrinology
|
|
G-Protein antagonist peptide is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide competitively and reversibly inhibits M2 muscarinic receptor activation of Gi or Go and inhibits Gs activation by β-adrenoceptors.
|
-
- HY-P3199
-
|
|
PKC
|
Inflammation/Immunology
|
|
PKCβII Peptide Inhibitor I is a PKCβII inhibitor. PKCβII Peptide Inhibitor I shows cardioprotective effects in rat cardiac Ischemia/reperfusion injury model. PKCβII Peptide Inhibitor I also prevents vascular endothelial dysfunction .
|
-
- HY-P10610
-
|
|
MDM-2/p53
|
Cancer
|
|
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
|
-
- HY-P3719
-
|
|
CCR
|
Inflammation/Immunology
|
|
MOG peptide (35-55) is a fragment 35-55 of myelin oligodendrocyte glycoprotein (MOG) immunogenic peptide. MOG peptide (35-55) is specific to expanded CD4 + T?cells, and induces experimental autoimmune encephalomyelitis (EAE) in animal model .
|
-
- HY-P10551
-
|
|
Transmembrane Glycoprotein
NF-κB
TNF Receptor
|
Cardiovascular Disease
|
|
Apo A-I mimetic 5A peptide is a synthetic peptide molecule designed based on the structure and function of naturally occurring apolipoprotein A-I (Apo A-I). Apo A-I mimetic 5A peptide can promote the efflux of cholesterol from cells and help reduce the accumulation of cholesterol in cells. Apo A-I mimetic 5A peptide also shows anti-inflammatory activity and can reduce inflammatory markers in blood and tissues. Apo A-I mimetic 5A peptide can be used in the study of cardiovascular diseases .
|
-
- HY-149872
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DCA-RMR1 is a cross-linker. DCA-RMR1 elicits facile bicyclization of native peptides via N-terminus Cys-Cys cross-linking. DCA-RMR1 derivatizes RMR1 with 1,3-dichloroacetone (DCA) .
|
-
- HY-P1021A
-
-
- HY-P1186
-
|
Eledoisin-Related Peptide; Eledoisin RP
|
Neurokinin Receptor
|
Neurological Disease
|
|
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
|
-
- HY-P1497
-
-
- HY-129067
-
-
- HY-P3326
-
|
|
Bacterial
|
Infection
|
|
Targeting the bacterial sliding clamp peptide 46 is a short peptide targeting the bacterial sliding clamp(SC), inhibiting SC-dependent DNA synthesis.
|
-
- HY-P2275
-
-
- HY-P1144
-
|
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
-
- HY-P1908
-
-
- HY-P1741A
-
|
|
Integrin
|
Cardiovascular Disease
|
|
Fibrinogen-Binding Peptide TFA (designed by anticomplementarity hypothesis) is a presumptive peptide mimic of the vitronectin binding site on the fibrinogen receptor. Fibrinogen-Binding Peptide TFA binds fibrinogen and inhibits both the adhesion of platelets to fibrinogen and platelet aggregation, and also inhibits the adhesion of platelets to vitronectin .
|
-
- HY-P10739
-
|
|
MMP
|
Inflammation/Immunology
|
|
WYRGRL, a collagen II-targeting peptide, can bind to collagen II α1. WYRGRL is a short cartilage-targeting peptide sequence. WYRGRL leads to about 72-fold increase of cartilage-targeting efficiency for the peptide-functionalized nanoplatform in vivo .
|
-
- HY-164166
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Fmoc-Sar-Sar-Sar-OH is a small molecule polypeptide composed of four sarcosine residues, in which the N-terminus of the peptide chain is protected by Fmoc. Fmoc-Sar-Sar-Sar-OH can be used for peptide synthesis or synthesis of drug-peptide ligand conjugates .
|
-
- HY-P1740
-
|
|
Integrin
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
RGD peptide (GRGDNP) is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) plays an important role in cell adhesion, migration, growth, and differentiation .
|
-
- HY-P2317A
-
|
|
Bacterial
Endogenous Metabolite
|
Infection
|
|
Cecropin P1, porcine acetate is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine acetate shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine acetate shows antiviral activity and inhibits PRRSV infection .
|
-
- HY-N15154
-
|
|
Cathepsin
HSP
|
Cancer
|
|
Tasiamide B is a Cathepsin D inhibitor, which is a linear peptide found in the marine cyanobacteria Symploca sp.. Tasiamide B is proved as a good template for the development of aspartic proteases inhibitors. Tasiamide B is effective against skin cancer by strongly interacting with the target protein HSP90 .
|
-
- HY-P1280A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P10614
-
|
|
Apoptosis
Bcl-2 Family
|
Others
|
|
Bid BH3 peptide is a small peptide derived from Bid protein that can bind and activate the pro-apoptotic proteins Bax and Bak, leading to mitochondrial outer membrane permeabilization (MOMP) and apoptosis. Bid BH3 peptide can be used to study mitochondrial bioenergetics .
|
-
- HY-P5363
-
|
Prostatic acid phosphatase (248-286)
|
HIV
|
Infection
|
|
PAP 248-286 (Prostatic acid phosphatase (248-286)) is a biological active peptide. PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells .
|
-
- HY-P0248F
-
|
|
PKA
Fluorescent Dye
|
Others
|
|
Kemptide, 5-FAM labeled is a biological active peptide. (Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 μM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA. 5-FAM labeled HY-P0248)
|
-
- HY-P3229
-
SN52
2 Publications Verification
|
NF-κB
|
Cancer
|
|
SN52 is a potent, competitive, and cell-permeable inhibitor of NF-κB2. SN52 is a variant of the SN50 peptide and inhibits the nuclear translocation of p52-RelB heterodimers. SN52 has a strong radiosensitization effect on prostate cancer cells. SN52 can be used for cancer research .
|
-
- HY-P5465
-
|
|
Bacterial
|
Others
|
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P3710
-
|
|
Calcium Channel
|
Others
|
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization .
|
-
- HY-P1144A
-
|
Glucagon-37 (bovine, porcine) (TFA)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin (bovine, porcine) TFA, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
-
- HY-P5424
-
|
|
Calmodulin
|
Others
|
|
RyR1(3614-3643) is a biological active peptide. (the absolutely conserved peptide corresponding to the CaM-binding domain of RyR1 in all vertebrates)
|
-
- HY-P10165
-
|
|
Calmodulin
|
Metabolic Disease
|
|
MLCK Peptide is a fully reversible, high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase .
|
-
- HY-P10790
-
|
|
Microtubule/Tubulin
|
Cancer
|
|
Breast cancer targeting peptide 18–4 is a KRT1 receptor-targeting peptide, with a Kd of 0.98 μM. The amino acid sequence of Breast cancer targeting peptide 18–4 is WxEAAYQrFL, and it is an analogue of P160 peptide (HY-P10789). When covalently conjugated with the anticancer peptide MccJ25, Breast cancer targeting peptide 18–4 significantly increases the cellular uptake of MccJ25 in breast cancer cells and enhances its anticancer activity. The covalent conjugate exhibits IC50 values of 14.2, 20, and 25 μM against MCF-7, MDA-MB-435, and MDA-MB-435-MDR cells, respectively .
|
-
- HY-P5205
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakA is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakB, and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS, GakA with GakB, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P5307
-
|
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
|
-
- HY-P2251
-
|
|
HIV
Microtubule/Tubulin
|
Infection
Inflammation/Immunology
Cancer
|
|
T-peptide, a Tuftsin analog, can be used for the research of human immunodeficiency virus (HIV) infection. T-peptide prevents cellular immunosuppression and improves survival rate in septic mice. T-peptide also can inhibit the growth of residual tumor cells after surgical resection .
|
-
- HY-P10218A
-
|
|
MARCKS
PKC
|
Inflammation/Immunology
Cancer
|
|
MANS peptide TFA is the TFA salt form of MANS peptide (HY-P10218). MANS peptide TFA is an inhibitor for myristoylated alanine-rich C kinase substrate (MARCKS), which competes with MARCKS in cells for membrane binding, and thus inhibits the stimulation of mucin secretion and tumor metastasis .
|
-
- HY-P5878
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
RG33 Peptide is a diabetes inhibitor that significantly improves glucose clearance in insulin-resistant mice. RG33 Peptide effectively solubilizes lipid vesicles and promotes cholesterol efflux in cultured macrophages. RG33 Peptide is used in research into type 2 diabetes (T2D) .
|
-
- HY-W283556
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
DO2A-tert-butyl ester is a bifunctional chelator (BFC) that can be used for the coupling of peptides and radionuclides. DO2A-tert-butyl ester can be used in the development of radionuclide imaging tracers .
|
-
- HY-P3150
-
|
|
Ser/Thr Protease
|
Others
|
|
Recombinant Proteinase K is a serine protease that cleaves the carboxy-terminated peptide bonds of aliphatic and aromatic amino acids. Recombinant Proteinase K can be used to digest proteins and remove contamination from nucleic acid preparations .
|
-
- HY-P3491
-
|
PEX 168
|
GLP Receptor
|
Metabolic Disease
|
|
Pegloxenatide is a glucagon-like peptide-1 receptor (GLP-1 RA) agonist. Pegloxenatide can be used for type 2 diabetes research .
|
-
- HY-P0141
-
|
|
Akt
|
Others
|
|
Akt/SKG Substrate Peptide is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or
MAPK1 .
|
-
- HY-P1899
-
|
|
MHC
|
Inflammation/Immunology
|
|
Smcy HY Peptide (738-746) is a H2-D b-restricted peptide corresponding to amino acids 738-746 of Smcy protein .
|
-
- HY-P1595
-
|
|
PKA
PKC
|
Metabolic Disease
|
|
CREBtide is a CREB (cAMP response element binding protein)-like peptide. CREBtide, a synthetic 13 amino acid peptide, has been reported as a PKA and PKC substrate.
|
-
- HY-P5428
-
|
|
CDK
|
Others
|
|
Cdc2 kinase substrate is a biological active peptide. (The native peptide HATPPKKKRK is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1).)
|
-
- HY-P4583
-
|
|
Cathepsin
|
Others
|
|
Suc-Val-Pro-Phe-SBzl (succinyl-valine-proline-phenylalanine thiobenzyl ester) is an inhibitor of CatG enzymes with IC50 values of 111-225 mM.
|
-
- HY-P5098
-
|
|
Integrin
|
Cancer
|
|
E(c(RGDfK)) is an αvβ3 integrin-specific binding moiety with tumor targeting properties. Increased uptake of E(c(RGDfK)) in human ovarian cancer OVCAR-3 xenograft tumors may be useful in cancer research .
|
-
- HY-P4552
-
-
- HY-P5918
-
-
- HY-P5329
-
|
|
NADPH Oxidase
|
Others
|
|
r8-Gly-Noxa A BH3 is a biological active peptide. (This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.)
|
-
- HY-P5207
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P1740A
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
RGD peptide (GRGDNP) TFA is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) TFA competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) TFA promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) TFA plays an important role in cell adhesion, migration, growth, and differentiation .
|
-
- HY-P2264
-
|
|
Ephrin Receptor
|
Inflammation/Immunology
|
|
KYL peptide, an antagonistic peptide, selectively targets EphA4 receptor (IC50:4.22 μM, Kd:1.3 μM). KYL peptide binds to the ligand-binding domain of EphA4, effectively alleviates Aβ-induced synaptic dysfunction and synaptic plasticity defects in AD mice. KYL peptide can promote nerve regeneration after injury and modulating immune responses .
|
-
- HY-P5446
-
|
|
Bacterial
|
Others
|
|
BMAP-18 is a biological active peptide. (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the Cathelicidin family of peptides which displays rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at higher than microbicidal concentrations. BMAP-18 displays much higher cell selectivity as compared to parental BMAP-27 because of its decreased hemolytic activity and retained antimicrobial activity.)
|
-
- HY-P1822
-
|
|
Transmembrane Glycoprotein
|
Metabolic Disease
|
|
BDC2.5 mimotope 1040-31, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg + T cells .
|
-
- HY-P5489
-
|
|
Phosphatase
|
Others
|
|
IGRP(206-214) is a biological active peptide. (This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.)
|
-
- HY-P0119A
-
|
|
GCGR
|
Metabolic Disease
|
|
Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
|
-
- HY-P10723
-
-
- HY-P5065
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P5385
-
|
|
Angiotensin Receptor
|
Others
|
|
Renin substrate, angiotensinogen (1-14), rat is a biological active peptide. (This peptide is derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate.)
|
-
- HY-P0141A
-
|
|
Akt
|
Others
|
|
Akt/SKG Substrate Peptide TFA is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or MAPK1 .
|
-
- HY-103271
-
|
|
Bcl-2 Family
|
Cancer
|
|
Bax inhibitor peptide, negative control is a inhibitor of Bax. Bax inhibitor peptide, negative control inhibits Bax translocation to mitochondria and Bax-mediated apoptosis in vitro .
|
-
- HY-P1085
-
|
|
EGFR
|
Cancer
|
|
Epidermal Growth Factor Receptor Peptide (985-996) is an amino acid peptide fragment derived from positions 985-996 in epidermal growth factor receptor (EGFR) .
|
-
- HY-P3762
-
-
- HY-P5063
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P1514
-
-
- HY-P10493
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
NY-ESO-1 (157-165) peptide is a peptide fragment from NY-ESO-1 protein. NY-ESO-1 (157-165) peptide can activate the immune system, especially for HLA-A2 positive individuals, it can be recognized by CD8+ T cells, thus triggering an immune response. NY-ESO-1 (157-165) peptide is expressed in a variety of tumors and can be used as a target for tumor immunotherapy .
|
-
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
-
- HY-117961
-
|
UK 73967
|
Neprilysin
|
Cardiovascular Disease
Endocrinology
|
|
Candoxatrilat (UK 73967) is an orally active inhibitor of neutral endopeptidase. By elevating the levels of atrial natriuretic peptides, Candoxatrilat exerts its diuretic and natriuretic effects. Candoxatrilat is utilized in the research of heart failure .
|
-
- HY-W027544
-
|
|
Fluorescent Dye
|
Others
|
|
MCA is a coumarin derivative. MCA quantitates platelet-activating factor by high-performance liquid chromatography with fluorescent detection. MCA can modify FRET peptide substrates for analyzing protease activities .
|
-
- HY-P5492
-
|
Delta-lysin
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin is a model in the study of peptides interacting with membranes. Delta-hemolysin is poorly active against bacteria .
|
-
- HY-P1822A
-
|
|
Transmembrane Glycoprotein
|
Metabolic Disease
|
|
BDC2.5 mimotope 1040-31 TFA, a BDC2.5 TCR reactive peptide, is a strong agonistic peptide for diabetogenic T cell clone BDC2.5, and the 1040-31 peptide is specific for BDC 2.5 TCR Tg + T cells .
|
-
- HY-P3130
-
|
|
CRFR
|
Neurological Disease
Inflammation/Immunology
|
|
Stresscopin-related peptide (human) is a specific ligand for the type 2 CRH receptor. Stresscopin-related peptide (human) suppresses food intake, delayed gastric emptying and decreases heat-induced edema. Stresscopin-related peptide (human) maintains homeostasis after stress, and can be used in the research of stress-related diseases .
|
-
- HY-P5601
-
|
|
Bacterial
Fungal
|
Infection
|
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P0064
-
|
Palmitoyl Tetrapeptide-7
|
Interleukin Related
|
Inflammation/Immunology
|
|
Palmitoyl Tetrapeptide-3 (Palmitoyl Tetrapeptide-7) is a synthetic peptide corresponding to amino acids 341-344 of the human immunoglobulin heavy chain, with the ability to stimulate phagocytosis. Palmitoyl tetrapeptide-3 reduces interleukin-6 (IL-6) secretion in keratinocytes and inhibits the UVB radiation-exposure inflammatory response of skin. Palmitoyl tetrapeptide-3 It also has anti-inflammatory and anti-aging effects, reducing skin wrinkles by promoting the production of elastic fibers in the papillary dermis .
|
-
- HY-P5272
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Histatin-3 TFA, a 32 amino acid peptide, possesses powerful antimicrobial properties. Histatin-3 TFA behaves as a substrate for proprotein convertase 1 (PC1), being cleaved by this endoprotease primarily at a site carboxy terminal to the single Arg25 residue (HRGYR decrease SN). Histatin-3 TFA is a moderately potent, reversible and competitive inhibitor of the furin-mediated cleavage of the pentapeptide pGlu-Arg-Thr-Lys-Arg-MCA fluorogenic substrate, with an estimated inhibition constant Ki of 1.98 μM .
|
-
- HY-P1863
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
α-Neoendorphin (1-8) is a 8-amino acid peptide derived from the N-terminal of α-Neoendorphin. α-Neoendorphin is an endogenous opioid peptide.
|
-
- HY-103303
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
-
- HY-P1046
-
|
Amyloid β-Protein (1-15)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-15) is a fragment of β-Amyloid peptide. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P1083
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide blocks the dopamine D3 effect on GABAA receptors .
|
-
- HY-P0014A
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
Liraglutide acetate is the acetate form of Liraglutide (HY-P0014), a glucagon-like peptide-1 (GLP-1) receptor agonist studied in type 2 diabetes .
|
-
- HY-P5325F
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99), FAM labeled is a biological active peptide. (This is a 5-FAM-labeled Bid BH3 HY-P5325 peptide.)
|
-
- HY-P5422
-
|
|
Calcium Channel
|
Others
|
|
Caloxin 3A1 is a biological active peptide. (This peptide belongs to caloxins, the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP.)
|
-
- HY-P10801
-
|
C46 peptide
|
HIV
|
Infection
|
|
mC46 (C46) peptide is a membrane-associated fusion peptide inhibitor. mC46 peptide potently inhibits HIV-1 replication and entry. mC46 also inhibits CCR5-tropic, CXCR4-tropic, and dual-tropic HIVs, SIV, and SHIV .
|
-
- HY-P3709
-
|
|
p62
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide is a specific TRAF6-p62 inhibitor. TRAF6 peptide potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke .
|
-
- HY-P2048
-
|
|
Apoptosis
|
Others
|
|
MOTS-c (human) is a biological active peptide. (Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome.1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria and associate with increased longevity and cell viability, reduced apoptosis, and other beneficial functions. 1-3 MOTS-c was found to reduce insulin resistance, decrease obesity, and promote homeostasis.)
|
-
- HY-P1684
-
|
FOXP3 inhibitor P60
|
NF-κB
Nuclear Factor of activated T Cells (NFAT)
|
Infection
Inflammation/Immunology
Cancer
|
|
Peptide P60 is a FOXP3 inhibitor. Peptide P60 can enter cells, inhibit the nuclear translocation of FOXP3, and diminish its ability to suppress the transcription factors NF-κB and NFAT. Peptide P60 can inhibit the immunosuppressive activity of regulatory T cells (Treg) derived from mice and humans, and enhance the stimulation of effector T cells in vitro. Peptide P60 can induce a lymphoproliferative autoimmune syndrome with pathological manifestations resembling those reported in scurfy mice lacking functional Foxp3. Peptide P60 can enhance the immunogenicity of cancer and viral vaccines.
|
-
- HY-P3395
-
|
Human chromogranin A 352–372
|
nAChR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Catestatin human, a catecholamine release-inhibitory peptide, is a pleiotropic peptide involved in cardiovascular protection with its antihypertensive and angiogenic effects. Catestatin human can be used in the study of inflammatory diseases .
|
-
- HY-P5287
-
|
|
Integrin
|
Cancer
|
|
cRGDfK-thioacetyl ester is a bioactive polypeptide molecule. cRGDfK peptide has a selective affinity for integrins. cRGDfK peptide can modify NIR fluorescent probes for cancer targeting imaging .
|
-
- HY-P10476A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) TFA is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 TFA can be used for researches of muscle atrophic disorders .
|
-
- HY-P1399
-
|
Myr-Pep2m
|
PKC
|
Neurological Disease
|
|
Pep2m, myristoylated (Myr-Pep2m) is a cell-permeable peptide. Pep2m, myristoylated can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC) .
|
-
- HY-161401
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
|
|
PAR4 antagonist 2 (Compound 31) is a protease activated receptor 4 (PAR4) antagonist, with IC50 values of 95 nM and 367 nM for human PAR4 and mouse PAR4. PAR4 antagonist 2 is active against PAR4 activation by the native protease thrombin cleavage but not the synthetic PAR4 agonist peptide AYPGKF .
|
-
- HY-P2294
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction .
|
-
- HY-P2294A
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 TFA peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide TFA shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide TFA displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction .
|
-
- HY-P5169
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
LVGRQLEEFL (mouse) can be named as G * peptide, corresponding to amino acids 113 to 122 in apolipoprotein J ([113,122] apoJ)}. LVGRQLEEFL (mouse) exhibits anti-inflammatory and anti-atherogenic properties. LVGRQLEEFL (mouse) can be added to an apoJ mimetic, to form HM-10/10 peptide, which is a mimetic peptide and a novel chimeric high density lipoprotein. HM-10/10 peptide protects retinal pigment epithelium (RPE) and photoreceptors from oxidant induced cell death .
|
-
- HY-P4832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Acetyl-Tau Peptide (273-284) amide is an acetylated Tau peptide fragment. Acetyl-Tau Peptide (273-284) amide limits the substantial aggregation of Ac-Aβ(25–35)-NH2 and can be used as an inhibitor of Ac-Aβ(25–35)-NH2. Acetyl-Tau Peptide (273-284) amide can be used as an experimental model to investigate the Aβ/Tau cross-interaction .
|
-
- HY-P10493A
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
NY-ESO-1 (157-165) peptide (TFA) is a peptide fragment from NY-ESO-1 protein. NY-ESO-1 (157-165) peptide (TFA) can activate the immune system, especially for HLA-A2 positive individuals, it can be recognized by CD8+ T cells, thus triggering an immune response. NY-ESO-1 (157-165) peptide (TFA) is expressed in a variety of tumors and can be used as a target for tumor immunotherapy .
|
-
- HY-P10905
-
-
- HY-P1576
-
-
- HY-P1516
-
-
- HY-P5492A
-
|
Delta-lysin TFA
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin) TFA, a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin TFA may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin TFA is a model in the study of peptides interacting with membranes. Delta-hemolysin TFA is poorly active against bacteria .
|
-
- HY-P3709A
-
|
|
p62
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide TFA is a specific TRAF6-p62 inhibitor. TRAF6 peptide TFA potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide TFA has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke .
|
-
- HY-P10608
-
|
|
HCV
|
Infection
|
|
KK4A peptide is a small peptide derived from nonstructural protein 4A (NS4A) of hepatitis C virus (HCV) that significantly increases the catalytic efficiency of NS3 protease. The KK4A peptide may be used to gain insights into the function and mechanism of the HCV NS3 protease, thereby advancing research into HCV infection .
|
-
- HY-P2268
-
|
|
Amyloid-β
|
Inflammation/Immunology
Cancer
|
|
RAGE antagonist peptide is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide (RAP) possesses anti-tumor and anti-inflammatory activities .
|
-
- HY-P5984A
-
|
|
mTOR
|
Others
|
|
Thioether-cyclized helix B peptide, CHBP (TFA) is the TFA form of Thioether-cyclized helix B peptide, CHBP (HY-P5984). Thioether-cyclized helix B peptide, CHBP (TFA) can improve metabolic stability and renoprotective effect through inducing autophagy via inhibition of mTORC1 and activation of mTORC2 .
|
-
- HY-P5444
-
|
|
Bacterial
|
Others
|
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
-
- HY-P1119
-
|
|
Formyl Peptide Receptor (FPR)
|
Neurological Disease
|
|
WRW4, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 specifically inhibits the increase in intracellular calcium by the FPRL1 agonists MMK-1, amyloid beta42 (Abeta42) peptide, and F peptide .
|
-
- HY-113786
-
|
|
Histone Methyltransferase
|
Cancer
|
|
EZH2-IN-21 is a potent inhibitor of the histone lysine methyltransferase enhancer of zeste homologue 2 (EZH2) with anticancer activity. EZH2-IN-21 is competitive with the cofactor SAM and noncompetitive with peptide or nucleosome substrates .
|
-
- HY-P5155
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
-
- HY-P10786
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
LinTT1 peptide is a tumor-penetrating peptide with the amino acid sequence AKRGARST. LinTT1 peptide targets peritoneal carcinoma (PC) by binding to the p32 (gC1qR) receptor. It can conjugate with iron oxide nanoworms (NWs) to form a nanocarrier. This nanocarrier is taken up by peritoneal carcinoma cells in vitro and enters the mitochondria; it also exhibits significant tumor targeting and penetration effects in mice. Moreover, LinTT1-functionalized nanocarriers, combined with the pro-apoptotic peptide [D(KLAKLAK)2], show significant tumor suppression in a mouse peritoneal tumor model. LinTT1 peptide holds promise as a delivery carrier for peritoneal cancer research .
|
-
- HY-P10837
-
|
|
LAG-3
|
Inflammation/Immunology
Cancer
|
|
LAG-3 cyclic peptide inhibitor 12 (Cyclic peptide 12) is an inhibitor of LAG-3 with an IC50 value of 4.45 μM and a Ki value of 2.66 µM .
|
-
- HY-P0272
-
|
|
HIV
|
Infection
|
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-114118
-
|
|
GCGR
|
Metabolic Disease
Cancer
|
|
Semaglutide, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide has the potential for type 2 diabetes treatment.
|
-
- HY-P10433
-
|
|
Apoptosis
|
Cancer
|
|
EGFRvIII peptide is an EGFRvIII-derived epitope for binding to MHC I molecules. EGFRvIII peptide induces apoptosis, and causes specific immune responses against glioblastoma, especially in combination with Flagellin B .
|
-
- HY-P0238
-
|
|
Bombesin Receptor
|
Cancer
|
|
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
|
-
- HY-114118B
-
|
|
GCGR
|
Metabolic Disease
|
|
Semaglutide acetate, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide acetate has the potential for type 2 diabetes treatment.
|
-
- HY-P5888
-
|
Myr‐PKCɛ-
|
PKC
|
Inflammation/Immunology
|
|
PKCε inhibitor peptide,myristoylated (Myr‐PKC -) is a cell permeable myristic acid conjugated PKC peptide inhibitor that attenuates NO release in cultured human umbilical vein endothelial cells (HUVECs) .
|
-
- HY-P5287A
-
|
|
Integrin
|
Cancer
|
|
cRGDfK-thioacetyl ester TFA is a bioactive polypeptide molecule. cRGDfK peptide has a selective affinity for integrins. cRGDfK peptide can modify NIR fluorescent probes for cancer targeting imaging .
|
-
- HY-P1083A
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors .
|
-
- HY-P5440
-
|
|
ERK
|
Others
|
|
ERKtide is a biological active peptide. (ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.)
|
-
- HY-P3383
-
|
PL-5
|
Bacterial
|
Infection
|
|
Peceleganan (PL-5) is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan inhibits wound infection .
|
-
- HY-P3383A
-
|
PL-5 acetate
|
Bacterial
|
Infection
|
|
Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection .
|
-
- HY-P3245
-
|
|
Apoptosis
|
Cancer
|
|
HXR9 is a cell-permeable peptide and a competitive antagonist of HOX/PBX interaction. HXR9 antagonizes the interaction between HOX and a second transcrip-tion factor (PBX), which binds to HOX proteins in paralogue groups1 to 8. HXR9 selectively decreases cell proliferation and promotes apoptosis in cells with a high level of expression of the HOXA/PBX3 genes, such as MLL-rearranged leukemic cells .
|
-
- HY-P1399A
-
|
Myr-Pep2m TFA
|
PKC
|
Neurological Disease
|
|
Pep2m, myristoylated TFA (Myr-Pep2m TFA) is a cell-permeable peptide. Pep2m, myristoylated TFA can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC) .
|
-
- HY-P3245A
-
|
|
Apoptosis
|
Cancer
|
|
HXR9 hydrochloride is a cell-permeable peptide and a competitive antagonist of HOX/PBX interaction. HXR9 hydrochloride antagonizes the interaction between HOX and a second transcrip-tion factor (PBX), which binds to HOX proteins in paralogue groups1 to 8. HXR9 hydrochloride selectively decreases cell proliferation and promotes apoptosis in cells with a high level of expression of the HOXA/PBX3 genes, such as MLL-rearranged leukemic cells .
|
-
- HY-D2194
-
|
|
Fluorescent Dye
|
Others
|
|
AgAuSe-COOH (1000 nm) is a fluorescent quantum dot that emits fluorescence in the near-infrared II region, with an emission peak reaching 1000 nm. AgAuSe-COOH (1000 nm) has the advantages of narrow band gap, large Stokes shift, and good photostability. AgAuSe-COOH (1000 nm) can bind proteins, antibodies, peptides, PEG, etc., and can be widely used in the field of biological imaging.
|
-
- HY-P1116
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
PBP10 is a cell permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1 . PBP10 is a 10-AA peptide with rhodamine conjugated at its N terminus, exerts bactericidal activity against gram-positive and gram-negative bacteria and limits microbial-induced inflammatory effects .
|
-
- HY-P2268A
-
|
|
Amyloid-β
|
Inflammation/Immunology
Cancer
|
|
RAGE antagonist peptide TFA is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide TFA prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide TFA possesses anti-tumor and anti-inflammatory activities .
|
-
- HY-P1663
-
|
|
VEGFR
|
Others
|
|
ATWLPPR Peptide is a biological active peptide. (This peptide is a specific VEGFR2/KDR heptapeptide antagonist, it binds VEGFR2 (KDR/flk), completely inhibiting VEGF binding to KDR and preventing VEGF-induced angiogenesis in-vivo. It specifically inhibits human endothelial cell proliferation in-vitro and totally abolishes VEGF-induced angiogenesis in-vivo.)
|
-
- HY-P10247
-
|
|
Mitochondrial Metabolism
|
Neurological Disease
|
|
Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .
|
-
- HY-P1119A
-
|
|
Formyl Peptide Receptor (FPR)
|
Neurological Disease
|
|
WRW4 TFA, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 TFA specifically inhibits the increase in intracellular calcium by the FPRL1 agonists MMK-1, amyloid beta42 (Abeta42) peptide, and F peptide .
|
-
- HY-P3508A
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-27 acetate, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 acetate is an anticancer peptide. PNC-27 acetate can be used in acute myeloid leukemia research .
|
-
- HY-129271
-
|
Deltorphin A; Dermenkephalin
|
Opioid Receptor
|
Others
|
|
Deltorphin (Deltorphin A; Dermenkephalin) is a biological active peptide. (Deltorphin A peptide was isolated from skin extracts of the South American frog, Phyllomedusa sauvagei. Deltorphin A is a potent and selective agonist for the delta-opioid receptor.)
|
-
- HY-P0272A
-
|
|
HIV
|
Infection
|
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-114437
-
|
Z-D-Phe-Phe-Gly-OH; FIP; Virus Replication Inhibitory Peptide
|
Influenza Virus
|
Infection
|
|
Fusion Inhibitory Peptide (Z-D-Phe-Phe-Gly-OH, FIP, Virus Replication Inhibitory Peptide) is a potent inhibitor of the virus replication, by inhibiting the membrane fusing activity of a viral glycoprotein .
|
-
- HY-P4978
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
CBP501 Affinity Peptide is a Chk kinase inhibitor that can abrogate G2 arrest induced by DNA-damaging agents. CBP501 Affinity Peptide can be used in cancer research .
|
-
- HY-P10055A
-
|
PSMA-1 TFA
|
PSMA
|
Cancer
|
|
PSMA targeting peptide TFA (PSMA-1 TFA) is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells .
|
-
- HY-P2466
-
|
|
Apoptosis
|
Cancer
|
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models .
|
-
- HY-P1595A
-
|
|
PKA
PKC
|
Metabolic Disease
|
|
CREBtide TFA is a CREB (cAMP response element binding protein)-like peptide. CREBtide TFA a synthetic 13 amino acid peptide, has been reported as a PKA and PKC substrate .
|
-
- HY-P1806
-
-
- HY-P0175A
-
|
740YPDGFR TFA; PDGFR 740Y-P TFA
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone .
|
-
- HY-P5169A
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
LVGRQLEEFL (mouse) TFA can be named as G * peptide, corresponding to amino acids 113 to 122 in apolipoprotein J ([113,122] apoJ)}. LVGRQLEEFL (mouse) TFA exhibits anti-inflammatory and anti-atherogenic properties. LVGRQLEEFL (mouse) TFA can be added to an apoJ mimetic, to form HM-10/10 peptide, which is a mimetic peptide and a novel chimeric high density lipoprotein. HM-10/10 peptide protects retinal pigment epithelium (RPE) and photoreceptors from oxidant induced cell death .
|
-
- HY-P5484
-
|
|
Bacterial
|
Others
|
|
SMAP-18 is a biological active peptide. (SMAP-18 is a 18-amino acid residue peptide amide which is a truncated form of SMAP-29. Sheep myeloid antimicrobial peptide-29 (SMAP-29) displays extremely high antimicrobial activity against Pseudomonas strains, other Gram-negative bacteria, and multidrug-resistant pathogens. SMAP-18 displays much higher cell selectivity as compared to parental SMAP-29 because of its decreased hemolytic activity and retained antimicrobial activity.)
|
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P1231
-
-
- HY-P4943
-
-
- HY-P1157
-
-
- HY-P1246
-
-
- HY-P10182
-
-
- HY-P4969
-
-
- HY-P1229
-
-
- HY-P1063
-
-
- HY-P5447
-
|
|
Phosphatase
|
Others
|
|
RRLIEDAEpYAARG is a biological active peptide. (Phosphatase substrate.)
|
-
- HY-P10428
-
|
|
HPV
|
Infection
|
|
E6AP-mimicking peptide (compound 13) is a high-affinity, selective, irreversible and potent peptide-based covalent HPV16 E6 inhibitor targeting the 16E6 oncoprotein using a cysteine-reactive acrylamide warhead. E6AP-mimicking peptide has a Ki of 17 nM. E6AP-mimicking peptide targets all residues appearing in the binding pocket of E6 to disrupt the binding interface of 16E6 and E6AP. E6AP-mimicking peptide selectively binds and crosslinks to MBP-16E6 in PBS or a protein mixture .
|
-
- HY-103277
-
|
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
|
BIM 23042, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
-
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P2847
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow .
|
-
- HY-N6181
-
|
|
Others
|
Endocrinology
|
|
Terrelumamide A is a lumazine-containing peptide. Terrelumamide A is isolated from the culture broth of the marine-derived fungus Aspergillus terreus. Terrelumamide A exhibits pharmacological activity by improving insulin sensitivity. Terrelumamide A has the potential in the application of DNA sequence recognition .
|
-
- HY-N3997
-
|
|
Ser/Thr Protease
|
Infection
Metabolic Disease
Cancer
|
|
Nostosin G is a unique example of a linear peptide containing three subunits, 4-hydroxyphenyllactic acid (Hpla), homotyrosine (Hty), and argininal. Nostosin G has potent trypsin inhibitory property with an IC50 value of 0.1 μM .
|
-
- HY-P3944
-
|
|
CaMK
|
Neurological Disease
|
|
Calmodulin Dependent Protein Kinase Substrate is a Ca 2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for protein kinases .
|
-
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-114118A
-
|
|
GCGR
|
Metabolic Disease
Cancer
|
|
Semaglutide TFA, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide TFA has the potential for type 2 diabetes treatment.
|
-
- HY-P10036
-
|
|
PKG
|
Others
|
|
G-Subtide is a G-substrate peptide localized in Purkinje cells of the cerebellum. G-Subtide has little activity distinct from background and is a preferentially phosphorylated peptide substrate of recombinant PfPKG2 protein .
|
-
- HY-P1806A
-
-
- HY-P4349
-
|
|
Thrombin
|
Others
|
|
Pyr-Arg-Thr-Lys-Arg-AMC is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .
|
-
- HY-P1086
-
|
|
Transmembrane Glycoprotein
|
Others
|
|
Cadherin Peptide, avian is a calcium-dependent glycoprotein. Cadherin Peptide, avian takes part in homophilic cell-cell adhesion and dose-dependently inhibits bovine brain microvessel endothelial cells (BBMECs) adhesion .
|
-
- HY-P3248
-
|
Myelin basic protein (85-99) antagonist
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
J5 peptide is an MBP inhibitor that competitively inhibits the binding of MBP85-99 to HLA-DR2. J5 peptide alleviates PLP139-151/MBP85-99-induced experimental autoimmune encephalomyelitis (EAE) in mice. J5 peptide can be used in research on inflammatory and immune diseases .
|
-
- HY-P1376A
-
|
|
mAChR
Adrenergic Receptor
|
Endocrinology
|
|
G-Protein antagonist peptide TFA is a truncated substance P-related peptide, competes with receptor for G protein binding. G-Protein antagonist peptide TFA inhibits the activation of Gi or Go by M2 muscarinic cholinergic receptor (M2 mAChR) or of Gs by beta-adrenergic receptor in the reconstituted phospholipid vesicles, assayed by receptor-promoted GTP hydrolysis .
|
-
- HY-162965
-
|
|
Proteasome
|
Cancer
|
|
Immunoproteasome activator 1 (compound A) is a selective immunoproteasome activator that increases the presentation of individual MHC-I–bound peptides by over 100-fold. Immunoproteasome activator 1 binds to the proteasome structural subunit PSMA1 and promotes the association of the proteasome activator PA28α/β (PSME1/PSME2) with immunoproteasomes .
|
-
- HY-P4157
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-P4349A
-
|
|
Thrombin
|
Others
|
|
Pyr-Arg-Thr-Lys-Arg-AMC TFA is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .
|
-
- HY-P4157A
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-135108
-
|
|
Neurokinin Receptor
|
Neurological Disease
|
|
QWF Peptide (Compound 4a) is a substance P antagonist with an IC50 of 0.09 μM. QWF Peptide antagonizes the SP-induced contraction of isolated guinea pig trachea strips with an IC50 of 4.7 μM .
|
-
- HY-P4779
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (2-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor .
|
-
- HY-P3211B
-
|
LR12-scr
|
TREM receptor
|
Inflammation/Immunology
|
|
Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .
|
-
- HY-P2319
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
-
- HY-P1828
-
|
|
EGFR
|
Cancer
|
|
EGFRvIII peptide (PEPvIII) is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide represents a truly tumor-specific target for antitumor immunotherapy .
|
-
- HY-P4782
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (3-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor .
|
-
- HY-P1495
-
-
- HY-P1363A
-
|
Amyloid β-peptide (1-42) (human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human (Amyloid β-peptide (1-42), human) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-P4784
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (4-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor .
|
-
- HY-P10792
-
|
|
EGFR
|
Cancer
|
|
HER2-targeted peptide H6F is a HER2 targeting peptide that binds to HER2 to target breast cancer cells, with the amino acid sequence YLFFVFER. The HER2-targeted peptide H6F can be conjugated with the bifunctional chelating agent hydrazinonicotinamide (HYNIC) for radiolabeling with 99mTc. Single-photon emission computed tomography (SPECT) imaging shows that the labeled HER2-targeted peptide H6F specifically accumulates in HER2-positive MDA-MBA-453 tumor-bearing mice models. The HER2-targeted peptide H6F can be used for tumor molecular imaging studies .
|
-
- HY-P10835
-
|
|
LAG-3
|
Cancer
|
|
LAG-3 cyclic peptide inhibitor C25 is a LAG-3 inhibitor. LAG-3 cyclic peptide inhibitor C25 has a high affinity with human LAG-3 protein with a Kd value of 0.66 μM. LAG-3 cyclic peptide inhibitor C25 can block the interaction of LAG-3 with HLA-DR (MHC-II) and activate CD8 + T cells. LAG-3 cyclic peptide inhibitor C25 can be used in the study of cancer .
|
-
- HY-P1240
-
|
MOG (35-55)
|
Endogenous Metabolite
|
Neurological Disease
Inflammation/Immunology
|
|
Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (MOG (35-55)) is a minor component of CNS myelin. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat has encephalitogenic activity and induces T?cell proliferative. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat induces Th1 cytokine response as well as relatively high levels of IgG antibodies. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat produces a relapsing-remitting neurological disease with extensive plaque-like demyelination .
|
-
- HY-P4960
-
-
- HY-P1063A
-
-
- HY-P5310
-
-
- HY-P0290
-
GRGDSP
5 Publications Verification
|
Integrin
|
Cancer
|
|
GRGDSP, a synthetic linear RGD peptide, is an integrin inhibitor.
|
-
- HY-P4923
-
-
- HY-P0030
-
-
- HY-P5469
-
|
|
Formyl Peptide Receptor (FPR)
|
Others
|
|
WRW4-OH is a biological active peptide. (This peptide inhibits binding of one of formyl peptide receptor-like 1 (FPRL1) agonists WKYMVm to its specific receptor. FPRL1 is an important classical chemoattractant receptor that is expressed in phagocytic cells in the peripheral blood and brain. Activation of FPRL1 is closely related to inflammatory responses in the host defense mechanism and neurodegenerative disorders.)
|
-
- HY-P1826
-
|
|
CD74
|
Inflammation/Immunology
Cancer
|
|
CLIP (86-100) is amino acids 86 to 100 fragment of class II-associated invariant chain peptide (CLIP). CLIP is a small self-peptide and cleavage product of the invariant chain that resides in the HLA-II antigen binding groove and is believed to play a critical role in the assembly and transport of MHC class II alphabetaIi complexes through its interaction with the class II peptide-binding site .
|
-
- HY-P1237
-
|
|
Histamine Receptor
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
|
|
C-Type Natriuretic Peptide (CNP) (1-22), human, a 1-22 fragment of CNP, is a natriuretic peptide receptor B (NPR-B) agonist. C-Type Natriuretic Peptide (CNP) (1-22), human inhibits cAMP synthesis stimulated by the physiological agonists histamine and 5-HT or directly by Forskolin. CNP is a potent, endothelial-derived relaxant and growthinhibitory factor .
|
-
- HY-P99019
-
|
TEV-48125
|
CGRP Receptor
|
Neurological Disease
|
|
Fremanezumab (TEV-48125) is a humanized IgG2a monoclonal antibody that selectively and potently binds to calcitonin gene-related peptide (CGRP). CGRP is a 37-amino acid neuropeptide involved in central and peripheral pathophysiological events of migraine. Fremanezumab has the potential for chronic migraine research .
|
-
- HY-P5158
-
|
|
Adrenergic Receptor
|
Others
|
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
-
- HY-P0224
-
|
fMLP; N-Formyl-MLF
|
TNF Receptor
|
Inflammation/Immunology
|
|
N-Formyl-Met-Leu-Phe (fMLP; N-Formyl-MLF) is a chemotactic peptide and a specific ligand of N-formyl peptide receptor (FPR). N-Formyl-Met-Leu-Ph is reported to inhibit TNF-alpha secretion.
|
-
- HY-P2319A
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide TFA, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
-
- HY-P1915
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
26Rfa, Hypothalamic Peptide, human is a hypothalamic neuropeptide of the RFamide peptide family with orexigenic activity . 26RFa is an orexigenic neuropeptide identified as the endogenous ligand of the orphan G protein-coupled receptor GPR103 .
|
-
- HY-P5437
-
|
|
PKC
|
Others
|
|
PKCε (85-92) is a biological active peptide. (This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.)
|
-
- HY-P10397
-
|
rALP-2, Rubisco anxiolytic-like peptide 2
|
iGluR
|
Neurological Disease
Metabolic Disease
|
|
YHIEPV (rALP-2, Rubisco anxiolytic-like peptide 2) is a potent and orally active peptide. YHIEPV shows anxiolytic effects. YHIEPV increases leptin sensitivity to exert its anti-obesity effects .
|
-
- HY-P5881
-
|
|
PKC
|
Cardiovascular Disease
|
|
PKCα (C2-4) inhibitor peptide is a PKCα specific inhibitor peptide that blocks the inhibition of IKr by the α1A adrenoreceptor agonist A-61603 (HY-101366) .
|
-
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1247
-
|
|
Phosphatase
|
Neurological Disease
|
|
Calcineurin autoinhibitory peptide is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide could protect neurons from excitatory neuronal death .
|
-
- HY-P2299
-
|
|
HPV
|
Cancer
|
|
Protein E7(43-62) is an E7-derived peptide with anti-tumor effects (short peptide spanning the 43th to 62th amino acid residues in the E7 protein) .
|
-
- HY-P1807
-
|
|
Histamine Receptor
|
Inflammation/Immunology
|
|
Mast Cell Degranulating Peptide HR-2, a 14-membered linear peptide isolated from the venom of the giant hornet Vespa orientalis, is capable of degranulating mast cells and thus initiating histamine release .
|
-
- HY-P3943
-
|
|
CaMK
|
Neurological Disease
|
|
Calmodulin Dependent Protein Kinase Substrate Analog is a Ca 2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate Analog is a synthetic peptide substrate for protein kinases .
|
-
- HY-P1345
-
|
|
Complement System
|
Neurological Disease
Endocrinology
|
|
TLQP-21, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor 1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8 μM). TLQP-21 activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 is used for the research in regulation of nociception and other relevant physiologic functions .
|
-
- HY-P1626
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .
|
-
- HY-157171
-
|
|
MHC
|
Inflammation/Immunology
|
|
Ac-YR-NH2 is a small molecule modulator of MHC class II antigen presentation. Ac-YR-NH2 can influence peptide binding by MHC II to influence immune response .
|
-
- HY-P5344
-
|
Fluorigenic PEXEL peptide
|
Parasite
|
Others
|
|
Dabcyl-LNKRLLHETQ-Edans (Fluorigenic PEXEL peptide) is a biological active peptide. (This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.)
|
-
- HY-P1237A
-
-
- HY-P10605
-
|
|
Akt
GSK-3
|
Cancer
|
|
GSK3β-peptide is a substrate mimetic peptide of glycogen synthase kinase 3-β (GSK3-β) that can bind to the active site of GSK3-β and mimic the behavior of a real substrate. GSK3β-peptide can be used to develop substrate mimetic inhibitors of Akt as potential anticancer drugs .
|
-
- HY-P5389
-
|
|
Gap Junction Protein
|
Others
|
|
Connexin mimetic peptide 40GAP27 is a biological active peptide. (This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40), designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered, 40Gap27attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.)
|
-
- HY-P5487
-
|
|
iGluR
|
Others
|
|
GluR23Y is a biological active peptide. (This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.)
|
-
- HY-P10280
-
|
|
ATM/ATR
|
Cancer
|
|
ATR kinase substrate peptide (compound 45) is a potent and selective inhibitor of ATR (Ataxia Telangiectasia and Rad3 related) protein kinase (Ki=6 nM). ATR kinase substrate peptide inhibits ATR activity by competing with ATR kinase ATP-binding sites to block ATR mediated signaling. ATR kinase substrate peptide can be used to study the role of ATR kinase in DNA damage response .
|
-
- HY-P10457
-
|
15-PGDH (92-105)
|
15-PGDH
|
Others
|
|
5-Hydroxy prostaglandin dehydrogenase blocking peptide (15-PGDH (92-105)) is a blocking peptide that corresponds to the amino acids (AGVNNEKNWEKTLQ) located at positions 92-105 of the 15-hydroxy prostaglandin dehydrogenase (15-PGDH) sequence. 5-Hydroxy prostaglandin dehydrogenase blocking peptide can block the formation of protein-antibody complexes during immunohistochemical analysis of 15-PGDH .
|
-
- HY-D0178
-
|
|
Biochemical Assay Reagents
|
Others
|
|
1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride is a carbodiimide reagent that can form nucleic acid and compounds with amide bonds. 1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride accelerates the formation reaction of esters, amides, and peptides, as a condensing and dehydrating agent, which are often used for polynucleotide synthesis, anhydroxydation, lactonization and esterification .
|
-
- HY-P10085
-
|
|
PKC
|
Inflammation/Immunology
|
|
PKC-ε translocation inhibitor peptide is a PKC-ε translocation inhibitor. PKC-ε translocation inhibitor peptide can regulate the rate of FcγR-mediated internalization of opsonized beads, has no effect of FcαR trafficking .
|
-
- HY-P1889
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins .
|
-
- HY-P1828A
-
|
|
EGFR
|
Cancer
|
|
EGFRvIII peptide (PEPvIII) TFA is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide TFA represents a truly tumor-specific target for antitumor immunotherapy .
|
-
- HY-P1872
-
|
|
Bacterial
|
Infection
|
|
OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa .
|
-
- HY-P3838
-
|
|
PKC
|
Others
|
|
Protein Kinase C γ Peptide is a peptide fragment of Protein Kinase Cγ. Protein Kinase Cγ is a protein causative for dominant ataxia, that can negatively regulate nuclear import of recessive-ataxia-related aprataxin .
|
-
- HY-P2299A
-
|
|
HPV
|
Cancer
|
|
Protein E7(43-62) TFA is an E7-derived peptide with anti-tumor effects (short peptide spanning the 43th to 62th amino acid residues in the E7 protein) .
|
-
- HY-P6437
-
|
|
Dynamin
|
Cardiovascular Disease
Neurological Disease
|
|
Drp1 peptide inhibitor P110 (Compound P110) is a selective Drp1 peptide inhibitor with neuroprotective properties. Drp1 peptide inhibitor P110 can inhibit the activation of Drp1, prevent MPTP-induced Drp1 mitochondrial translocation, and alleviate MPTP-induced dopaminergic neuron loss, dopaminergic nerve terminal damage, and behavioral deficits, and can be used in the study of Alzheimer's disease. Additionally, Drp1 peptide inhibitor P110 can reduce mitochondrial damage and organ injury in animal models of Huntington's disease, cerebral ischemic injury, and myocardial infarction .
|
-
- HY-P1240A
-
|
MOG (35-55) TFA
|
Endogenous Metabolite
|
Neurological Disease
Inflammation/Immunology
|
|
Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (MOG (35-55)) TFA is a minor component of CNS myelin. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA has encephalitogenic activity and induces T cell proliferative. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA induces Th1 cytokine response as well as relatively high levels of IgG antibodies. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA produces a relapsing-remitting neurological disease with extensive plaque-like demyelination .
|
-
- HY-P1875
-
-
- HY-P5523
-
-
- HY-P0080
-
-
- HY-P10902
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
Lorutengitide is a transcriptional regulatory peptide, and exhibits antiproliferative efficacy .
|
-
- HY-P5441A
-
|
|
Phosphatase
|
Others
|
|
KRpTIRR acetate is a phosphothreonine-containing peptide that serves as a substrate for phosphatases .
|
-
- HY-P5127
-
-
- HY-P5420
-
-
- HY-P1633
-
-
- HY-P1013
-
-
- HY-P4345
-
-
- HY-P4342
-
-
- HY-P4809
-
-
- HY-P5321
-
|
|
FGFR
|
Others
|
|
bFGF (119-126) is a biological active peptide. (This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.)
|
-
- HY-P1247A
-
|
|
Phosphatase
|
Neurological Disease
|
|
Calcineurin autoinhibitory peptide TFA is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide TFA could protect neurons from excitatory neuronal death .
|
-
- HY-P0128
-
|
Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells .
|
-
- HY-P1771
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
OVA G4 peptide is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-P1889A
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV TFA is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins .
|
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P0322
-
|
EMD 56574
|
Integrin
|
Cardiovascular Disease
Metabolic Disease
|
|
GRGDSPK (EMD 56574) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK (EMD 56574) is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK is used to study the role of integrins in bone formation and resorption .
|
-
- HY-P3904
-
|
|
Biochemical Assay Reagents
|
Others
|
|
P34cdc2 Kinase Substrate Peptide is a synthetic peptide substrates for P34 cdc2 kinase, with a Km of 74 μM for the purified human enzyme. P34cdc2 Kinase Substrate Peptide can be used in a rapid assay of P34 cdc2 phosphorylation in vitro. P34 cdc2, a protein serinehhreonine kinase, is a cell division cycle-regulated protein kinase .
|
-
- HY-P1195
-
|
|
iGluR
|
Neurological Disease
|
|
PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). PDZ1 Domain inhibitor peptide disrupts the GluR6/PSD-95 interaction and is very efficient in competing against the C terminus of GluR6 for the PDZ1 domain .
|
-
- HY-P1345A
-
|
|
Complement System
|
Neurological Disease
Endocrinology
|
|
TLQP-21 TFA, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8μM). TLQP-21 TFA activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 TFA is used for the research in regulation of nociception and other relevant physiologic functions .
|
-
- HY-P1418
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 in ex vivo and in vivo assays of bone resorption .
|
-
- HY-P10648
-
|
HER2-targeting peptide
|
EGFR
|
Cancer
|
|
Herceptide (HER2-targeting peptide) is a HER2-targeting peptide, and can be further conjugated to the near-infrared fluorescent dye indocyanine green (HY-D0711) (ICG) for developing theranostic agents .
|
-
- HY-P5426
-
|
|
Bcr-Abl
|
Others
|
|
Abl protein tyrosine kinase substrate is a biological active peptide. (Abltide is a peptide substrate for Abl Kinase (Abl protein tyrosine kinase), a partner in the gag-Abl fusion protein of the Abelson murine leukemia virus. Used in Western blot and kinase assay.)
|
-
- HY-P3892
-
|
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-35) Peptide is the PKC pseudosubstrate inhibitor/region. Protein Kinase C (19-35) Peptide possibly blocks the substrate-binding site in its kinase domain, makes the cytoplasmic form of PKC inactive .
|
-
- HY-P1771A
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
OVA G4 peptide TFA is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-P10388
-
|
|
CD47
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P4924
-
-
- HY-P5441
-
|
|
Phosphatase
|
Others
|
|
KRpTIRR is a phosphothreonine-containing peptide and can serve as a substrate for phosphatases .
|
-
- HY-P2157
-
|
|
Ras
|
Cancer
|
|
Ras Inhibitory Peptide (VPPPVPPRRR) is a Ras inhibitor with antitumor activity .
|
-
- HY-P0080A
-
-
- HY-P4927
-
-
- HY-P5404
-
|
|
SARS-CoV
|
Others
|
|
SAP6 is a biological active peptide. (inhibited virus entry into the cells)
|
-
- HY-P1755F
-
-
- HY-P4363
-
-
- HY-P4966
-
-
- HY-P0041
-
-
- HY-P5379
-
|
|
Proteasome
|
Others
|
|
Calpastatin subdomain B is a biological active peptide. (inhibit calpain activity)
|
-
- HY-P10198
-
-
- HY-P1000
-
-
- HY-P0136
-
SAMS
2 Publications Verification
|
AMPK
|
Metabolic Disease
|
|
SAMS peptide is a specific substrate for the AMP-activated protein kinase (AMPK).
|
-
- HY-P1227
-
-
- HY-P4341
-
|
|
PAI-1
|
Others
|
|
D-Val-Leu-Lys-AMC is a peptide substrate of plasmin .
|
-
- HY-P1522
-
-
- HY-P0149
-
-
- HY-P1501
-
|
Delta-Sleep Inducing Peptide
|
SOD
|
Neurological Disease
|
|
δ-Sleep Inducing Peptide is a neuropeptide, with antioxidant and anxiolytic properties.
|
-
- HY-P4348
-
|
|
Proteasome
|
Others
|
|
MeOSuc-Gly-Leu-Phe-AMC is a peptide substrate of proteasomal .
|
-
- HY-W008922
-
-
- HY-125586
-
|
|
DNA/RNA Synthesis
ADC Cytotoxin
|
Cancer
|
|
β-Amanitin is a cyclic peptide toxin in the poisonous Amanita phalloides mushroom. β-Amanitin inhibits inhibits eukaryotic RNA polymerase II and III. β-Amanitin inhibits protein synthesis. β-Amanitin can be used as a cytotoxic component of antibody-drug conjugates (ADCs) .
|
-
- HY-N2466
-
|
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Neurological Disease
Cancer
|
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for the research of sun-induced skin cancer, melanoma, inflammation and male erectile dysfunction .
|
-
- HY-P1230
-
|
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity .
|
-
- HY-P1195A
-
|
|
iGluR
|
Neurological Disease
|
|
PDZ1 Domain inhibitor peptide TFA, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). PDZ1 Domain inhibitor peptide TFA disrupts the GluR6/PSD-95 interaction and is very efficient in competing against the C terminus of GluR6 for the PDZ1 domain .
|
-
- HY-P0128A
-
|
Amyloid beta-peptide (25-35), HFIP-treated; Aβ25-35, HFIP-treated; β-Amyloid peptide (25-35), HFIP-treated
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)), HFIP-treated is a β-Amyloid (25-35) (HY-P0128) treated with HFIP. β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells .
|
-
- HY-103539
-
|
|
γ-secretase
|
Metabolic Disease
|
|
3,5-Bis(4-nitrophenoxy)benzoic acid is an inhibitor of γ-secretase. 3,5-Bis(4-nitrophenoxy)benzoic acid causes a decrease in the released levels of Aβ42 and notch-1 Aβ-like peptide 25 (Nβ25). 3,5-Bis(4-nitrophenoxy)benzoic acid, as a marker for fetal hypothyroidism, is a 3,3’-diiodothyronine sulfate (T2S) cross-reactive material in maternal serum .
|
-
- HY-E70005I
-
|
Type VI collagenase
|
MMP
|
Cancer
|
|
Collagenase, Type VI (EC 3.4.24.3) is a collagenase that can degrade type VI collagen. Type VI collagen is a component of cell membranes in various tissues (such as skin, heart, blood vessels, cartilage, and synovial fluid). Excessive collagenase can cause extracellular matrix lesions. Collagenase is also a biomarker for tumor invasion and metastasis. Collagenase, Type VI can specifically act on the peptide bond between proline and glycine. This feature can be used to quickly and sensitively detect its concentration level in experiments using corresponding modified electrodes .
|
-
- HY-P10577
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
|
|
RAG8 peptide is an antagonist for protease-activated receptor 4 (PAR 4), which inhibits late-stage platelet activation, and reduces thrombosis without altering hemostasis or increasing bleeding risk. RAG8 peptide can be used for atherosclerosis research .
|
-
- HY-P0322A
-
|
EMD 56574 TFA
|
Integrin
|
Cardiovascular Disease
Metabolic Disease
|
|
GRGDSPK TFA (EMD 56574 TFA) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK TFA is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK TFA is used to study the role of integrins in bone formation and resorption .
|
-
- HY-P3766
-
|
|
PKC
|
Others
|
|
Protein kinase C α peptide (TFA) is a peptide of PKC-α. PKC-α acts as a lipid-dependent ser/thr protein kinase, can modulate various cellular processes, including cell survival, proliferation, differentiation, migration, adhesion and so on .
|
-
- HY-P10385
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-3 (Compound CP3) is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 7 nM .
|
-
- HY-P10705
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
KGFRWR is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. KGFRWR can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
-
- HY-P2075
-
|
|
Renin
|
Endocrinology
|
|
EMD 55068 is a renin antagonist. EMD 55068 inhibits the uptake of taurocholate .
|
-
- HY-15407B
-
|
AHU-377 sodium
|
Neprilysin
|
Infection
Cardiovascular Disease
|
|
Sacubitril sodium is a potent and orally active NEP (neprilysin) inhibitor, with an IC50 of 5 nM. Sacubitril sodium enhances the tone of the natriuretic peptide (NP) system and exerts significant antihypertensive effects. Sacubitril sodium is a component of the heart failure medicine LCZ696. Sacubitril sodium can be used for the research of heart failure, hypertension and COVID-19 .
|
-
- HY-15940
-
|
5(6)-FAM; 5-(and-6)-Carboxyfluorescein mixed isomers
|
Fluorescent Dye
|
Cancer
|
|
5(6)-Carboxyfluorescein (5(6)-FAM) is an amine-reactive pH-sensitive green fluorescent probe. 5(6)-Carboxyfluorescein (5(6)-FAM) can be used to label proteins, peptides and nucleotides. 5(6)-Carboxyfluorescein can be used for the detection of tumour areas in vivo .
|
-
- HY-P2714
-
-
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
- HY-P2603
-
-
- HY-P10816
-
|
Ac-(DLeu)LLLRVK-Amba
|
Bacterial
|
Infection
Cancer
|
|
PACE4 Inhibitory peptide C23 (Compound C23; Ac-(DLeu)LLLRVK-Amba)), a potent peptidomimetic inhibitor, is a PACE4 inhibitor. PACE4 Inhibitory peptide C23e shows antiproliferative effects against PCa cell lines (Ki = 5 nM; IC50 = 25 and 40 μM for DU145 and LNCaP, respectively). PACE4 Inhibitory peptide C23 also blocks tumor growth in vivo in LNCaP xenograft-bearing mice .
|
-
- HY-P1418A
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 TFA in ex vivo and in vivo assays of bone resorption .
|
-
- HY-P1362A
-
|
Amyloid β Peptide (42-1)(human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-P0303
-
-
- HY-116598
-
|
GSK 1322322 mesylate
|
Bacterial
|
Infection
|
|
Lanopepden mesylate (GSK 1322322 mesylate) is a peptide deformase (PDF) inhibitor. Lanopepden mesylate has antibacterial activity by inhibiting the activity of PDF, preventing the correct synthesis of bacterial proteins. Lanopepden mesylate mainly targets Gram-positive bacteria. Lanopepden mesylate can be used in the study of acute bacterial skin and skin structural infections .
|
-
- HY-P5341
-
-
- HY-P2461
-
-
- HY-P0041A
-
-
- HY-79171
-
-
- HY-P3438A
-
-
- HY-P4337
-
-
- HY-P1880
-
-
- HY-P0241
-
-
- HY-P4347
-
-
- HY-P4344
-
|
|
MetAP
|
Others
|
|
Met-Gly-Pro-AMC is a fluorescent peptide substrate of MetAP2 .
|
![[Asn18] Endothelin-1, human](http://file.medchemexpress.com/product_pic/hy-p3615.gif)
![[Tyr8]-Atrial Natriuretic Peptide (5-27), rat](http://file.medchemexpress.com/product_pic/hy-p3774.gif)
![[Nle20] H4 peptide (16−23)](http://file.medchemexpress.com/product_pic/hy-p10570.gif)
![[Glu27]-PKC (19-36)](http://file.medchemexpress.com/product_pic/hy-p1402.gif)
![[Tyr8]-Substance P](http://file.medchemexpress.com/product_pic/hy-p2784.gif)
![[Dehydro-Pro4] Substance P (4-11)](http://file.medchemexpress.com/product_pic/hy-p3820.gif)
![[Ala18] Endothelin-1, human](http://file.medchemexpress.com/product_pic/hy-p3610.gif)
![[Ala2] Met-Enkephalinamide](http://file.medchemexpress.com/product_pic/hy-p3551.gif)
![[Tyr11]-Somatostatin](http://file.medchemexpress.com/product_pic/hy-p3062.gif)
![[Tyr6]-Angiotensin II](http://file.medchemexpress.com/product_pic/hy-p5913.gif)
![[DAla2, DArg6] Dynorphin A, (1-13) (porcine)](http://file.medchemexpress.com/product_pic/hy-p3632.gif)
![[Tyr8,Nle11] Substance P](http://file.medchemexpress.com/product_pic/hy-p3933.gif)
![[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human)](http://file.medchemexpress.com/product_pic/hy-p0211.gif)
![[D-p-Cl-Phe6,Leu17]-VIP](http://file.medchemexpress.com/product_pic/hy-p1159.gif)
![[D-p-Cl-Phe6,Leu17]-VIP TFA](http://file.medchemexpress.com/product_pic/hy-p1159a.gif)
![[D-Ala2]-Met-Enkephalinamide](http://file.medchemexpress.com/product_pic/hy-p3548.gif)
