Search Result
Results for "
ADAM Peptides Inhibitors
" in MCE Product Catalog:
4249
Inhibitors & Agonists
179
Biochemical Assay Reagents
25
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
-
- HY-115670
-
|
|
MMP
|
Cancer
Inflammation/Immunology
|
|
GW280264X is the mixed ADAM10/TACE (ADAM17) metalloproteinases inhibitor. GW280264X potently blocks TACE (ADAM17) and ADAM10 with IC50s of 8.0 nM and 11.5 nM, respectively. ADAM10 and 17 modulate the immunogenicity of glioblastoma-initiating cells.
|
-
- HY-120852
-
|
|
MMP
|
Cancer
|
|
JG26 is an ADAM17 inhibitor, with IC50 values of 12 nM, 1.9 nM, 150 nM and 9.4 nM for ADAM8, ADAM17, ADAM10 and MMP-12, respectively.
|
-
- HY-118694
-
-
- HY-132917
-
|
|
MMP
|
Cancer
|
|
ADAM8-IN-1 is a potent ADAM8 inhibitor with an IC50 value of 73 nM.
|
-
- HY-12636
-
|
|
MMP
Apoptosis
|
Cancer
|
|
INCB3619 is a selective and orally active ADAM inhibitor with IC50 of 22 nM and 14 nM for ADAM10 and ADAM17, respectively. INCB3619 has anti-tumor activity.
|
-
- HY-P4133
-
|
|
ERK
MEK
|
Cancer
|
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable.
|
-
- HY-P4138
-
|
|
Fluorescent Dye
|
Cancer
|
|
Antennapedia Peptide FAM-labeled is a fluorophore labeled peptide. Antennapedia Peptide FAM-labeled also can be used for the research of cancer as a molecular probe.
|
-
- HY-16027
-
|
|
GnRH Receptor
|
Endocrinology
|
|
Acyline, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels.
|
-
- HY-P3557
-
-
- HY-P0102
-
|
|
mAChR
|
Neurological Disease
|
|
Dipeptide diaminobutyroyl benzylamide diacetate, a Wagerlin-1-mimicking peptide, is a mAChR antagonist. Dipeptide diaminobutyroyl benzylamide diacetate can induce muscle relaxation.
|
-
- HY-P0281A
-
|
|
HIV
|
Infection
|
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins.
|
-
- HY-P0281
-
|
|
HIV
|
Infection
|
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins.
|
-
- HY-106204
-
|
|
EGFR
|
Cancer
|
|
Nelipepimut-S is a peptide vaccine which targets HER2. Nelipepimut-S has immune activity against HER2 positive breast cancer.
|
-
- HY-P0274
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
PGLa, a 21-residue peptide, is an antimicrobial peptide. PGLa is a member of the magainin family of antibiotic peptides found in frog skin and its secretions.
|
-
- HY-P0274A
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of antibiotic peptides found in frog skin and its secretions.
|
-
- HY-P1676
-
|
BK-1361
|
MMP
|
Cancer
|
|
cyclo(RLsKDK) (BK-1361) is a specific inhibitor of metalloproteinase ADAM8 with an IC50 value of 182 nM. cyclo(RLsKDK) has potential applications in inflammatory diseases and cancer.
|
-
- HY-P5147
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin GID is a paralytic peptide neurotoxin and a selective antagonist of nAChR, with IC50s of 5 nM (α7), 3 nM (α3β2)， 150 nM (α4β2), respectively. α-Conotoxin GID is small disulfide-rich peptide, with potential to inhibit chronic pain. α-Conotoxin GID contains a C-terminal carboxylate, thus substitution with a C-terminal carboxamide results in loss of α4β2 nAChR. α-Conotoxin GID can be isolated from the Conus species.
|
-
- HY-P4101
-
|
|
HIV
|
Infection
|
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1.
|
-
- HY-P3815
-
|
|
Casein Kinase
|
Others
|
|
Casein Kinase 2 Substrate Peptide is a common CK2 substrate peptide. Casein Kinase 2 Substrate Peptide is synthesized with its C-terminus conjugated to 5-[(2-aminoethyl)amino]naphthalene-1-sulfonic acid (EDANS). Casein Kinase 2 Substrate Peptide can be used for protein kinase CK2 activity determination.
|
-
- HY-P1344A
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide TFA is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM.
|
-
- HY-10293
-
|
INCB007839; INCB7839
|
MMP
|
Cancer
|
|
Aderbasib (INCB007839) is a potent, orally active and target specific low nanomolar hydroxamate-based inhibitor of ADAM10 and ADAM17. Aderbasib exhibits robust antineoplastic activity and can be used for cancer research, including diffuse large B-cell non-Hodgkin lymphoma, HER2 + breast cancer, gliomas, et al.
|
-
- HY-P3281
-
|
|
Biochemical Assay Reagents
|
Others
|
|
FGL peptide, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development.
|
-
- HY-P1929
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Bivalirudin, a peptide anticoagulant, is a direct thrombin inhibitor for anticoagulation in the setting of invasive cardiology, particularly percutaneous coronary intervention.
|
-
- HY-P2522
-
|
|
Bacterial
|
Infection
|
|
Competence-Stimulating Peptide-2 (CSP-2) is a quorum sensing signal peptide produced by Streptococcus pneumoniae. ComD2 is a compatible receptor of Competence-Stimulating Peptide-2 (CSP-2) with an EC50 value of 50.7 nM.
|
-
- HY-137788
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin GI has high affinity for nAChR.α-Conotoxin GI is a short peptide toxin that can be isolated from the venom of Conus geographus.α-Conotoxin GI has the similar activity with neuromuscular blocking agent.
|
-
- HY-P4031
-
-
- HY-P4033
-
-
- HY-P1676A
-
|
BK-1361 TFA
|
MMP
|
Cancer
|
|
cyclo(RLsKDK) (TFA) (BK-1361 (TFA)) is a specific inhibitor of metalloproteinase ADAM8 with an IC50 value of 182 nM. cyclo(RLsKDK) (TFA) has potential applications in inflammatory diseases and cancer.
|
-
- HY-P5149
-
|
αC-PrXA
|
nAChR
|
Neurological Disease
|
|
αC-Conotoxin PrXA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 1.8 nM (α1β1εδ, adult) and 3.0 nM (α1β1γδ, fetal), respectively. αC-Conotoxin PrXA competes with α-bungarotoxin at the α/δ and α/γ subunit interfaces of the nAChR, shows high specificity against neuromuscular nAChR.
|
-
- HY-P5282
-
|
|
Liposome
|
Others
|
|
ApoA-I mimetic peptide (PVLDLFRELLNELLEALKQKLK) has good lecithin:cholesterol acyl transferase (LCAT) activation potency. ApoA-I mimetic peptide can be used for synthesis of peptide/lipid complex.
|
-
- HY-P3876
-
-
- HY-P3623
-
|
|
Fluorescent Dye
|
Others
|
|
Biotin-Glucagon-Like Peptide 1 (7-36) amide, human is a biologically active peptide. Biotin-Glucagon-Like Peptide 1 (7-36) amide, human can be used for the research of various biochemical studies.
|
-
- HY-P5183
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model.
|
-
- HY-P3782
-
-
- HY-P3624
-
|
|
Guanylate Cyclase
|
Cardiovascular Disease
|
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research.
|
-
- HY-35028
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu-Ofm is a peptide. Boc-Glu-Ofm has been used for the synthesis of ester insulin and cyclic peptide mixtures.
|
-
- HY-P2217
-
|
DSC-127; NorLeu3-A(1-7)
|
Angiotensin Receptor
|
Inflammation/Immunology
|
|
Aclerastide (DSC-127) is an angiotensin receptor agonist. Aclerastide also is a peptide analog of angiotensin II. Aclerastide can be used for the research of tissue regeneration in diabetic ulcers.
|
-
- HY-P1513A
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P2365
-
|
|
Fungal
|
Infection
|
|
Histatin-8 is a part of the Histatin-3 central sequence and is known as hemagglutination-inhibiting peptide. Histatin-8 is a potent anti-fungal peptide. Histatin-8 shows antimicrobial activity against yeast strains. Histatin-8 can be used for oral thrush research.
|
-
- HY-105048
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Omiganan is a cationic antimicrobial peptide. Omiganan as an analogue of indolicidin shows activity against gram-positive and gram-negative bacteria but also Candida spp. isolates. Omiganan can be used for the research of alcohol nose and acne.
|
-
- HY-P2703
-
|
|
Neuropeptide Y Receptor
|
Endocrinology
Metabolic Disease
|
|
Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.
|
-
- HY-P3940
-
|
|
PKC
|
Others
|
|
Ac-MBP (4-14) Peptide is an acetylated MBP (4-14) peptide. MBP (4-14) Peptide is a very selective (protein kinase C) PKC substrate. Ac-MBP (4-14) Peptide can be used for PKC assay in extracts without prior purification to eliminate interfering protein kinases or phosphatases.
|
-
- HY-P1701
-
|
|
Opioid Receptor
|
Neurological Disease
Cardiovascular Disease
|
|
Morphiceptin is a potent and specific agonist for morphine (μ) receptors. Morphiceptin, as a synthetic peptide, is the amide of a fragment of the milk protein β-casein. Morphiceptin has morphinelike activities and is highly specific for morphine (μ) receptors but not for enkephalin (⸹) receptors.
|
-
- HY-P3877
-
-
- HY-19956
-
|
GI4023; SRI028594
|
MMP
|
Cancer
|
|
GI254023X is a potent MMP9 and ADAM10 inhibitor with IC50s of 2.5 and 5.3 nM, respectively.
|
-
- HY-106268
-
|
|
Gap Junction Protein
|
Infection
Inflammation/Immunology
|
|
Larazotideis a peptide which is an orally active zonulin antagonist. Larazotide shows antiviral activity to varicella-zoster virus (VZV) with EC50s of 44.14 and 59.06 μM for strain OKA and 07-1, respectively. Larazotide can be used for the research of celiac disease and infection.
|
-
- HY-P3919
-
|
Pro-ADM-153-185 (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.
|
-
- HY-P0082
-
|
Porcine glucagon
|
GCGR
|
Metabolic Disease
|
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation.
|
-
- HY-W000665
-
|
Dmt
|
Opioid Receptor
|
Neurological Disease
|
|
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides.
|
-
- HY-P1165
-
-
- HY-60265
-
-
- HY-P4391
-
-
- HY-P5206
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakB is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS, GakB with GakA, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA.
|
-
- HY-P4198
-
-
- HY-P3913
-
|
|
Bacterial
|
Infection
|
|
Acetyl-Adhesin (1025-1044) amide is a 20-peptide fragment of Streptococcus pyogenes cell surface adhesin that acts as an antimicrobial peptide to specifically inhibit the binding of adhesin to salivary receptors and prevent recolonization of Streptococcus pyogenes.
|
-
- HY-41121
-
|
Boc-Ala-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-L-Ala-OH (Boc-Ala-OH) shows excellent affinity with ATP. Boc-L-Ala-OH contains an amino acid moiety, and an acylamide bond like that of the peptide and protein.
|
-
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus).
|
-
- HY-P3142
-
-
- HY-P2355A
-
-
- HY-P3502
-
|
RA101495
|
Complement System
|
Inflammation/Immunology
|
|
Zilucoplan (RA101495), a 15-amino acid macrocyclic peptide, is a potent complement component 5 (C5) inhibitor. Zilucoplan can be used in research of immune-mediated necrotising myopathy (IMNM).
|
-
- HY-P4156
-
|
|
mAChR
|
Neurological Disease
|
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA.
|
-
- HY-P1118
-
-
- HY-P2355
-
-
- HY-P3586
-
|
Hunter-killer peptide ao
|
Apoptosis
|
Cancer
|
|
HKPao (Hunter-killer peptide ao) is a biologically active peptide. HKPao (Hunter-killer peptide ao) has anti-obesity and anti-tumor pro-apoptotic activity to cause release of cytochrome c from vesicles.
|
-
- HY-P1118A
-
-
- HY-107024
-
|
OGP(10-14); Historphin
|
Src
|
Others
|
|
Osteogenic Growth Peptide (10-14) (OGP(10-14)), the C-terminal truncated pentapeptide of osteogenic growth peptide (OGP), retains the full OGP-like activity. Osteogenic Growth Peptide (10-14) is responsible for the binding to the OGP receptor and activates an intracellular Gi-protein-MAP kinase signaling pathway. Osteogenic Growth Peptide (10-14) is a potent mitogen and stimulator of osteogenesis and hematopoiesis. Osteogenic Growth Peptide (10-14) acts as a Src inhibitor.
|
-
- HY-P1723
-
|
Neuropeptide Q
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Spexin is a conserved peptide plays roles of neurotransmitter/neuromodulator and endocrine factor. Spexin peptide contains numerous aromatic amino acids and is probably amidated.
|
-
- HY-P1486
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides.
|
-
- HY-P2244A
-
|
|
YAP
|
Cancer
|
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM).
|
-
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia.
|
-
- HY-P1486A
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human TFA is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides.
|
-
- HY-P3914
-
|
Oct-CA(1-7)M(2-9)
|
Bacterial
|
Infection
|
|
Cecropin A (1-7)-Melittin A (2-9) is an antimicrobial peptide with antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative aerobic bacteria, as well as antimalarial activity, without the adverse hemolytic properties of bee venom peptides.
|
-
- HY-151496
-
|
|
Others
|
Others
|
|
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences.
|
-
- HY-P3615
-
-
- HY-P3920
-
|
|
PKA
|
Cancer
|
|
Cys-Kemptide is a cysteine-terminated substrate peptide that can used to measure protein kinase A (PKA) activity.
|
-
- HY-P35433
-
|
T-1249
|
HIV
|
Inflammation/Immunology
|
|
Tifuvirtide (T-1249) is a peptide human immunodeficiency virus type-1 (HIV-1) fusion inhibitor. Tifuvirtide is a synthetically designed hybrid retroviral envelope polypeptide. Tifuvirtide has antiretroviral activity. Tifuvirtide can be used for the research of HIV infection.
|
-
- HY-P2162
-
|
|
Myosin
|
Cancer
|
|
Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK).
|
-
- HY-16657
-
TAPI-1
4 Publications Verification
|
MMP
|
Cancer
Inflammation/Immunology
|
|
TAPI-1 is a TACE (ADAM17) inhibitor and blocks the shedding of several cell surface proteins. TAPI-1 is also a metalloproteinase (MMP) inhibitor.
|
-
- HY-P2292A
-
|
|
Bacterial
Fungal
|
Infection
|
|
Omiganan-FITC TFA is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections.
|
-
- HY-P2457
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS.
|
-
- HY-P5148
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. α-Conotoxin BuIA can be used to distinguish nAChRs containing β2- and β4-subunit, respectively. α-Conotoxin BuIA distinguishes among αxβ2 nAChRs with a rank order potency of α6>α3>α2>α4.
|
-
- HY-P3814
-
|
|
Ribosomal S6 Kinase (RSK)
|
Cancer
|
|
S6 Kinase Substrate Peptide 32 is a substrate of Ribosomal S6 Kinase (RSK). S6 Kinase Substrate Peptide 32 can be used to measure the activity of RSKs which phosphorylate ribosomal protein S6.
|
-
- HY-P3550
-
-
- HY-P4086
-
|
|
RABV
|
Infection
|
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction.
|
-
- HY-123931
-
ZLDI-8
1 Publications Verification
|
Notch
Phosphatase
Apoptosis
|
Cancer
|
|
ZLDI-8 is a Notch activating/cleaving enzyme ADAM-17 inhibitor and inhibits the cleavage of Notch protein. ZLDI-8 decreases the expression of pro-survival/anti-apoptosis and epithelial-mesenchymal transition (EMT) related proteins. ZLDI-8 is also a competitive and irreversible tyrosine phosphatase (Lyp) inhibitor with an IC50 of 31.6 μM and a Ki of 26.22 μM. ZLDI-8 inhibits the growth of MHCC97-H cells with an IC50 of 5.32 μM.
|
-
- HY-P3921
-
|
|
Casein Kinase
|
Cancer
|
|
Casein Kinase II Substrate is a casein kinase II (CK2) peptide substrate that can be selectively phosphorylated by CK2.
|
-
- HY-P5156
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death.
|
-
- HY-P2292
-
|
|
Bacterial
Fungal
|
Infection
|
|
Omiganan-FITC is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines.
|
-
- HY-W048209
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Lys(Palmitoyl)-OH is a Fmoc-amino acid with long alkyl chains. Fmoc-Lys(Palmitoyl)-OH can be used for peptide synthesis.
|
-
- HY-P3429
-
|
|
PKC
|
Cardiovascular Disease
|
|
RNAENFDRF (βIIPKC624-632) is conjugated to the cell permeable peptide TAT47-57, which can be used to form an inhibitory peptide SAMβA. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats.
|
-
- HY-16027A
-
|
|
GnRH Receptor
|
Endocrinology
|
|
Acyline TFA, a GnRH peptide analogue, is a GnRH antagonist that inhibits gonadotropin and testosterone (T) levels.
|
-
- HY-P3429A
-
|
|
PKC
|
Cardiovascular Disease
|
|
RNAENFDRF (βIIPKC624-632) TFA is conjugated to the cell permeable peptide TAT47-57, which can be used to form an inhibitory peptide SAMβA. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats.
|
-
- HY-P1333
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A can induce neuronal death, and can be used in the research of neurological disease.
|
-
- HY-P2170
-
|
XOMA-629
|
Antibiotic
Bacterial
|
Infection
Inflammation/Immunology
|
|
XMP-629 (XOMA-629), a cationic α-helical peptide, is a potent endotoxin inhibitor. XMP-629 exhibits broad-spectrum antimicrobial activity via an immunomodulatory mechanism. XOMA 629 has antimicrobial activity against Propionibacterium acnes, Staphylococcus aureus and Streptococcus pyogenesand.
|
-
- HY-P3431
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
|
-
- HY-P3431A
-
|
|
iGluR
|
Neurological Disease
|
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
|
-
- HY-P0261A
-
|
|
Bacterial
|
Infection
|
|
Indolicidin acetate is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
|
-
- HY-131092
-
|
|
Others
|
Others
|
|
H-Asn-Arg-OH is used for the solid-phase peptide synthesis.
|
-
- HY-P3147
-
|
|
Drug Metabolite
|
Others
|
|
IYPTNGYTR, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR can be used to monitor in vivo Trastuzumab metabolism.
|
-
- HY-P3147A
-
|
|
Drug Metabolite
|
Others
|
|
IYPTNGYTR acetate, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR acetate can be used to monitor in vivo Trastuzumab metabolism.
|
-
- HY-P3141
-
-
- HY-P0261B
-
|
|
Bacterial
|
Infection
|
|
Indolicidin TFA is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
|
-
- HY-13443
-
|
Exenatide
|
GCGR
|
Metabolic Disease
|
|
Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
-
- HY-P3149B
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK acetate, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK acetate can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
|
-
- HY-P3149
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
|
-
- HY-131094
-
|
|
Others
|
Others
|
|
H-Gly-D-Tyr-OH is used for the the solid-phase peptide synthesis.
|
-
- HY-P1860A
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
TNF-α (31-45), human (TFA) is a peptide of tumor necrosis factor-α. Tumour necrosis factor alpha (TNF alpha) is an inflammatory cytokine that induces necrosis or apoptosis.
|
-
- HY-P3146
-
|
|
Drug Metabolite
|
Cancer
|
|
FTISADTSK is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
|
-
- HY-P3146A
-
|
|
Drug Metabolite
|
Cancer
|
|
FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
|
-
- HY-P3149A
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
LEESGGGLVQPGGSMK TFA, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK TFA can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
|
-
- HY-P3440
-
|
|
PD-1/PD-L1
|
Cancer
|
|
WL12 is a specifically targeting programmed death ligand 1 (PD-L1) binding peptide. WL12 can be radiolabeled by different radionuclides, generating radiotracers, which can assess the tumor PD-L1 expression.
|
-
- HY-D1592
-
|
|
Fluorescent Dye
|
Others
|
|
BODIPY TMR C5-maleimide is a fluorescent dye. BODIPY TMR C5-maleimide is a high quantum yield fluorophore which can be coupled with peptides.
|
-
- HY-P3915
-
|
|
Bacterial
|
Infection
|
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity.
|
-
- HY-W013123
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-D-Phe(4-CF3)-OH is Phenylalanine derivative. Fmoc-D-Phe(4-CF3)-OH can be used for the research of peptide inhibitors of protein-protein interactions.
|
-
- HY-P1674
-
|
POL7080
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance.
|
-
- HY-P4055
-
-
- HY-19667
-
|
DPC 333
|
TNF Receptor
|
Inflammation/Immunology
|
|
BMS-561392 is a TNF alpha-converting enzyme (TACE) inhibitor. BMS-561392 is also an ADAM17 blocker. BMS-561392 can be used for research of inflammatory bowel disease.
|
-
- HY-P0328
-
|
|
VSV
|
Infection
|
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
-
- HY-P3580
-
|
Human N-acetyl GIP
|
Insulin Receptor
|
Endocrinology
Metabolic Disease
|
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity.
|
-
- HY-P4111
-
|
|
CXCR
|
Cancer
|
|
Peptide R, a cyclic peptide, is a specific CXCR4 antagonist. Peptide R shows outstanding capacities to profoundly remodel the tumor stroma. Peptide R has the potential for tumor research.
|
-
- HY-N7122
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
Cancer
|
|
Thymopentin is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs).
|
-
- HY-N7122A
-
|
|
Endogenous Metabolite
|
Cancer
Inflammation/Immunology
|
|
Thymopentin acetate is a biologically active peptide secreted mainly by the epithelial cells of thymic cortex and medulla. Thymopentin acetate is an effective immunomodulatory agent with a short plasma half-life of 30 seconds. Thymopentin acetate enhances the generation of T-cell lineage derived from human embryonic stem cells (hESCs).
|
-
- HY-P0239
-
|
|
Influenza Virus
|
Inflammation/Immunology
|
|
HA Peptide (HA tag) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry.
|
-
- HY-P3580A
-
|
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Endocrinology
Metabolic Disease
|
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity.
|
-
- HY-P2316
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Epinecidin-1 TFA is a multi-functional antimicrobial peptide (AMP) from Orange-spotted grouper (Epinephelus coioides). Epinecidin-1 TFA has antibacterial, antifungal, antiviral, anti-tumor, and immunomodulatory effects. Epinecidin-1 TFA has the potential to be an alternative for current antibiotics.
|
-
- HY-P5164
-
|
|
Sodium Channel
|
Neurological Disease
|
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel， with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively.GrTx1 can be used for neurological disease research.
|
-
- HY-P3555
-
-
- HY-P1439
-
-
- HY-P10000
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion.
|
-
- HY-P3555A
-
|
|
Opioid Receptor
|
Others
|
|
D-Ala-Gly-Phe-Met-NH2 monoacetate, an opioid peptide, is a potent opiate δ-receptor agonist.
|
-
- HY-P1866A
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties.
|
-
- HY-138982
-
|
|
Others
|
Others
|
|
D-2-Thiolhistidine can be used for modification of proteins and peptides.
|
-
- HY-P3722
-
|
|
Fluorescent Dye
|
Others
|
|
Mca-(endo-1a-Dap(Dnp))-TNF-Alpha (-5 to +6) amide (human) is a peptide. Mca-(endo-1a-Dap(Dnp))-TNF-Alpha (-5 to +6) amide (human) is a fluorescence resonance energy transfer based substrate, the activity is measured by fluorescence intensity change upon cleavage.
|
-
- HY-P1453
-
|
|
STAT
|
Cancer
|
|
CMD178 is a lead peptide that consistently reduced the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling and inhibits Treg cell development.
|
-
- HY-138126A
-
|
|
Others
|
Neurological Disease
|
|
Dansyl-Tyr-Val-Gly TFA is a substrate of peptidylglycine monooxygenase (PHM). Peptidylglycine monooxygenase is an essential enzyme for the posttranslational amidation of neuroendocrine peptides.
|
-
- HY-W090942
-
-
- HY-147279
-
|
|
LDLR
|
Others
|
|
Milpocitide is a low-density lipoprotein receptor (human LDL receptor, LDLR), (293-333)-peptide fragment (EGF-like domain 1).
|
-
- HY-P4042
-
|
hepatitis B peptide 4980
|
HBV
|
Infection
Inflammation/Immunology
|
|
Hepatitis B Virus Receptor Binding Fragment (hepatitis B peptide 4980) is a synthetic peptide analog which specifically binds to Hep G2 cells. Hepatitis B Virus Receptor Binding Fragment is a promising immunogen expected to elicit protective antibodies based on the concept of the attachment blockade pathway of virus neutralization.
|
-
- HY-P3414A
-
|
|
Proteasome
|
Neurological Disease
|
|
Proteasome-activating peptide 1 TFA is a peptide and a potent proteasome activator. Proteasome-activating peptide 1 TFA increases the chymotrypsin-like proteasomal catalytic activity and, consequently, proteolytic rates both in vitro and in culture. Proteasome-activating peptide 1 TFA prevents protein aggregation in a cellular model of amyotrophic lateral sclerosis.
|
-
- HY-P0014
-
|
|
GCGR
|
Metabolic Disease
|
|
Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus.
|
-
- HY-P4931
-
|
|
MMP
|
Cancer
|
|
Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 (FS-6) is a fluorescent peptide that is a quenched MMP peptide substrate. Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 can be used for real-time quantification of MMP enzymatic activity. Mca-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is an elongated peptide of MMP substrate (FS-1) and is active against collagenases (MMP-1, MMP-8, MMP-13 ) and MT1-MMP with higher specificity constants than FS-1. (Ex/Em=325 nm/400 nm)
|
-
- HY-P3278
-
|
|
Proton Pump
|
Metabolic Disease
|
|
Caloxin 2A1 is an extracellular plasma membrane Ca 2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 does not affect basal Mg 2+-ATPase or Na +-K +-ATPase.
|
-
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB.
|
-
- HY-P3621
-
|
|
GCGR
|
Metabolic Disease
|
|
Biotinyl-Glucagon (1-29), human, bovine, porcine is a biotinylated glucagon. Glucagon is a peptide hormone, produced by α-cells of the pancreas, can increase concentration of glucose and fatty acids in the bloodstream.
|
-
- HY-P1453A
-
|
|
STAT
|
Cancer
|
|
CMD178 TFA is a lead peptide that consistently reduced the expression of Foxp3 and STAT5 induced by IL-2/s IL-2Rα signaling and inhibits Treg cell development.
|
-
- HY-P3722A
-
|
|
Fluorescent Dye
|
Others
|
|
Mca-(endo-1a-Dap(Dnp))-TNF-Alpha (-5 to +6) amide (human) TFA is a peptide. Mca-(endo-1a-Dap(Dnp))-TNF-Alpha (-5 to +6) amide (human) TFA is a fluorescence resonance energy transfer based substrate, the activity is measured by fluorescence intensity change upon cleavage.
|
-
- HY-P3632
-
|
DADAD
|
Opioid Receptor
|
Metabolic Disease
Neurological Disease
|
|
[DAla2, DArg6] Dynorphin A, (1-13) (porcine) (DADAD) is an opioid peptide (dynorphinl-13, DYN) derivative found in porcine pituitary extracts. DYN is highly potent at the peripheral opioid receptors GPI and MVD, but is readily and rapidly degraded in vivo. [DAla2, DArg6] Dynorphin A, (1-13) (porcine) has some resistance to enzymatic cleavage and prevents peptide cleavage by enzymes.
|
-
- HY-P3695
-
|
|
FGFR
|
Cancer
|
|
VSPPLTLGQLLS is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation.
|
-
- HY-16657A
-
|
|
MMP
|
Cancer
Inflammation/Immunology
|
|
(S,S)-TAPI-1 is an isomer of TAPI-1. TAPI-1 is a TACE (ADAM17) inhibitor and blocks the shedding of several cell surface proteins. TAPI-1 is also a metalloproteinase (MMP) inhibitor.
|
-
- HY-P2196
-
-
- HY-W039519
-
|
|
Fluorescent Dye
|
Cancer
|
|
7-Methoxycoumarin-3-carboxylic acid is a fluorescent dye with an excitation peak at 355 nm and an emission peak at 405 nm. 7-Methoxycoumarin-3-carboxylic acid can be used to label peptide.
|
-
- HY-P3278A
-
|
|
Proton Pump
|
Metabolic Disease
|
|
Caloxin 2A1 TFA is an extracellular plasma membrane Ca 2+-ATPase (PMCA) peptide inhibitor. Caloxin 2A1 TFA does not affect basal Mg 2+-ATPase or Na +-K +-ATPase.
|
-
- HY-P3695A
-
|
|
FGFR
|
Cancer
|
|
VSPPLTLGQLLS TFA is a small peptide FGFR3 inhibitor, peptide P3, inhibits FGFR3 phosphorylation. VSPPLTLGQLLS TFA inhibits 9-cisRA-induced tracheal lymphangiogenesis and blocks lymphatic endothelial cell (LEC) proliferation, migration, and tubule formation.
|
-
- HY-P4108
-
|
|
Influenza Virus
|
Others
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.
|
-
- HY-P4051
-
-
- HY-P3417
-
|
|
Bacterial
|
Infection
|
|
Amp1EP9 is an antimicrobial peptide. Amp1EP9 is a powerful tool for developing potent and nontoxic antimicrobial agents. Amp1EP9 has the potential for the research of multidrug-resistant bacterial infections.
|
-
- HY-P1043
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide containing the Asn-Gly-Arg (NGR) motif. NGR peptide binds to APN/CD13. NGR peptide is directly conjugated to imaging agents that can be used for tumor imaging.
|
-
- HY-P3784
-
-
- HY-W036160
-
|
|
Amino Acid Derivatives
|
Others
|
|
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent.
|
-
- HY-P1363
-
|
Amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
|
-
- HY-P3707
-
|
|
Apoptosis
|
Cancer
|
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice.
|
-
- HY-P2244
-
|
|
YAP
|
Cancer
|
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM).
|
-
- HY-P0120
-
|
LY2189265
|
GCGR
|
Metabolic Disease
|
|
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Dulaglutide can be uesd for the research of type 2 diabetes (T2D) .
|
-
- HY-P1271
-
|
|
nAChR
|
Cardiovascular Disease
|
|
Catestatin is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin is an endogenous peptide that regulates cardiac function and blood pressure. Catestatin is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release.
|
-
- HY-P4045
-
|
|
HBV
|
Infection
|
|
HBV Seq2 aa:208-216, a HBsAg derived CD8 epitope peptide, is studied as part of Large envelope protein from Hepatitis B virus.
|
-
- HY-P3928
-
|
hIAPP (1-37)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (1-37) (human) (hIAPP (1-37)) is a peptide hormone, present in pancreatic betacell secretory granules. The C-terminus of Amylin (1-37) (human) is amidated and there is a disulfide bond between cysteine residues 2 and 7.
|
-
- HY-128113
-
-
- HY-P1731
-
|
LY3298176
|
GLP Receptor
|
Metabolic Disease
|
|
Tirzepatide (LY3298176) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes.
|
-
- HY-16498
-
|
PCK-3145
|
Apoptosis
|
Cancer
|
|
Tigapotide (PCK-3145) is an anti-tumour peptide that reduces the development of skeletal metastases associated with prostate cancer. Tigapotide induces apoptosis and reduces tumour parathyroid hormone-related peptide (PTHrP) levels.
|
-
- HY-P3506
-
|
LY3437943
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide inhibits human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide can be used for the research of obesity.
|
-
- HY-P3506B
-
|
LY3437943 acetate
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Retatrutide (LY3437943) acetate is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide acetate inhibits for human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide acetate can be used for the research of obesity.
|
-
- HY-P0282
-
|
|
HIV
|
Infection
|
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1.
|
-
- HY-P4136
-
|
|
ERK
|
Cancer
|
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM.
|
-
- HY-P3539
-
|
|
GCGR
|
Endocrinology
Neurological Disease
|
|
Exendin-4 (3-39) is a peptide. Exendin-4 (3-39) is a truncated form of Exendin-4 (HY-13443) that lacks the first two amino acids. Exendin-4 is a potent Glucagon-like peptide-1 receptor (GLP-1r) agonist. Exendin-4 (3-39) and Exendin-4 can be used for the research of diabetic and hypothalamic-pituitary-adrenal (HPA) axis.
|
-
- HY-149205
-
|
|
PI3K
ERK
|
Inflammation/Immunology
|
|
CXJ-2 is a cyclic peptide, and exhibits moderate affinity toward elastin derived peptides (EDPs). CXJ-2 exhibits potent activities to inhibit the PI3K/ERK pathway and decrease hepatic stellate cell proliferation and migration. CXJ-2 possesses potent antifibrotic efficacy.
|
-
- HY-P5520
-
|
|
Bombesin Receptor
|
Cancer
|
|
GB-6 is a short linear peptide that targets the gastrin releasing peptide receptor (GRPR). GRPR is overexpressed in pancreatic cancer. Based on the tumor selectivity and tumor-specific accumulation properties of GB-6, GB-6 labeled with near infrared (NIR) fluorescent dyes or radionuclide netium-99m (99mTc) can be used as a high-contrast imaging probe. GB-6 has excellent in vivo stability, with tumor to pancreatic and intestinal fluorescence signal ratios of 5.2 and 6.3, respectively, in SW199 0 subcutaneous xenograft models. GB-6 can rapidly target tumors and accurately delineate tumor boundaries, which has broad application prospects.
|
-
- HY-109538
-
|
|
Secretin Receptor
|
Metabolic Disease
Neurological Disease
|
|
Secretin (swine), a neuroendocrine hormone, is the first hormone to be identifie and is secreted by S cells that are localized primarily in the mucosa of the duodenum. Secretin also is a 27-amino acid peptide, which acts on secretin receptors. Secretin is expressed by cells in all mature enteroendocrine cell subsets and can be prompted by fatty acids. Secretin stimulates the secretion of pancreatic water and bicarbonate. Secretin exerts various effects in organs, can be used for the research of digestive system, central nervous system and energy metabolism.
|
-
- HY-P3791
-
|
|
Fluorescent Dye
|
Others
|
|
N-Succinyl-Ile-Ile-Trp-AMC is a peptide-based fluorescent substrate or probe for carboxypeptidase Y (CPY).
|
-
- HY-P0282A
-
|
|
HIV
|
Infection
|
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1.
|
-
- HY-148197
-
-
- HY-103281
-
|
|
Bombesin Receptor
|
Metabolic Disease
|
|
Litorin, an amphibian bombesin peptide derivative, is an bombesin receptor agonist. Litorin stimulates the contraction of smooth muscle, stimulates gastrin, gastric acid, and pancreatic secretion, and suppresses the nutriment in vivo.
|
-
- HY-P3933
-
-
- HY-P1271A
-
|
|
nAChR
|
Cardiovascular Disease
|
|
Catestatin TFA is a 21-amino acid residue, cationic and hydrophobic peptide. Catestatin TFA is an endogenous peptide that regulates cardiac function and blood pressure. Catestatin TFA is a non-competitive nicotinic antagonist acting through nicotinic acetylcholine receptors (nAChRs) to inhibit catecholamine release.
|
-
- HY-P3828
-
|
|
Fluorescent Dye
|
Neurological Disease
|
|
Biotin-myelin basic protein (94-102) is a peptide fragemt. Myelin basic protein is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin, it plays an important role in the process of myelination of nerves in the nervous system. Myelin basic protein also acts as a membrane actin-binding protein, which might allow it to participate in transmission of extracellular signals to the cytoskeleton in oligodendrocytes and tight junctions in myelin.
|
-
- HY-P2565
-
-
- HY-P3506A
-
|
LY3437943 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
|
Retatrutide (LY3437943) TFA is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide TFA inhibits for human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide TFA can be used for the research of obesity.
|
-
- HY-P3108
-
-
- HY-P1026
-
-
- HY-P5288
-
|
|
Antibiotic
|
Cancer
Infection
|
|
BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer.
|
-
- HY-P1179
-
|
|
Guanylate Cyclase
Endogenous Metabolite
|
Cancer
Endocrinology
|
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism.
|
-
- HY-P3930
-
|
IP20-amide
|
PKA
|
Neurological Disease
|
|
PKI (5-24),amide (IP20-amide) is a 20-residue peptide that corresponds to the active portion of the heat-stable inhibitor protein of cAMP-dependent protein kinase. PKI (5-24),amide is a potent cAMP-dependent protein kinase (PKA) (PKA) inhibitor with a Ki of 2.3 nM.
|
-
- HY-P3606
-
|
GAP (1-24), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (1-24), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 1-24 fragment (hGAP-1-24). GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site.
|
-
- HY-P0269
-
|
Magainin I
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria.
|
-
- HY-P3813
-
|
|
Tyrosinase
|
Cancer
Inflammation/Immunology
|
|
Tyrosinase (206-214), human (AFLPWHRLF), a 9-amino acid peptide, is a tyrosinase epitope. Tyrosinase (206-214), human can be recognized by HLA-A24 restricted, tumor-infiltrating lymphocytes (TIL).
|
-
- HY-153549
-
|
|
CXCR
|
Others
|
|
Pentixafor is a peptide that targets CXCR4. Pentixafor is capable of being labelled with 68Gallium ( 68Ga) for positron emission tomography (PET) imaging.
|
-
- HY-P4125
-
|
|
HIV
|
Others
|
|
FITC-LC-TAT (47-57) is a FITC labeled TAT peptide. TAT is a cell-penetrating peptide (CPP). TAT can increase the yields and the solubility of heterologous proteins.
|
-
- HY-P4805
-
-
- HY-P3859
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) is a peptide fragment of amyloid β-protein (Aβ). Cys-Gly-Lys-Arg-Amyloid β-Protein (1-42) can be used in research of Alzheimer's disease.
|
-
- HY-114174
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing and mediates APP proteolytic processing.
|
-
- HY-P4370
-
|
|
Bacterial
Fungal
|
Infection
|
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains.
|
-
- HY-P1179A
-
|
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism.
|
-
- HY-106268A
-
|
|
Gap Junction Protein
|
Inflammation/Immunology
|
|
Larazotide acetate is a peptide which is an orally active zonulin antagonist. Larazotide acetate shows antiviral activity to varicella-zoster virus (VZV) with EC50s of 44.14 and 59.06 μM for strain OKA and 07-1, respectively. Larazotide acetate can be used for the research of celiac disease and infection.
|
-
- HY-P3625
-
|
|
Endogenous Metabolite
Opioid Receptor
|
Neurological Disease
|
|
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation.
|
-
- HY-P2980
-
|
EC 3.4.2.1
|
Endogenous Metabolite
|
Others
|
|
Carboxypeptidase A (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems.
|
-
- HY-P0006
-
-
- HY-131326
-
-
- HY-P1116A
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
PBP10 is a cell permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1. PBP10 is a 10-AA peptide with rhodamine conjugated at its N terminus, exerts bactericidal activity against gram-positive and gram-negative bacteria and limits microbial-induced inflammatory effects.
|
-
- HY-P0269A
-
|
Magainin I TFA
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria.
|
-
- HY-P2272
-
|
|
Wnt
β-catenin
|
Cancer
|
|
NLS-StAx-h is a selective, cell permeable, stapled peptide Wnt signaling inhibitor with an IC50 of 1.4 μM. NLS-StAx-h efficiently inhibits β-catenin-transcription factor interactions. NLS-StAx-h shows anti-proliferation of cancer cells.
|
-
- HY-150241
-
|
|
Liposome
|
Others
|
|
DOPE-NHS is a linker. DOPE-NHS can be used for peptides to be conjugated to exosomes and possibly other membrane-based nanoparticles. DOPE-NHS can be used for drug delivery.
|
-
- HY-P1051
-
|
Amyloid β-Protein (12-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (Amyloid β-Protein (12-28)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) shows aggregation properties. β-Amyloid (12-28) has the potential for Alzheimer’s disease research.
|
-
- HY-P3653
-
|
|
mAChR
nAChR
|
Neurological Disease
|
|
α-Conotoxin M I is a potent and selective inhibitor of mAChR and α1β1γδ nAChR, but has no effect on nicotine-stimulated dopamine release. α-Conotoxins are small, disulfide-rich peptides that competitively inhibit muscle and neuronal nicotinic AChRs.
|
-
- HY-146133
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
LA-Bac8c is a Lipoic acid modified antimicrobial peptide with enhanced antimicrobial properties. LA-Bac8c inhibits S. aureus, MRSA, S. epidermidis, E. coli, and P. aeruginosa with MICs of 1, 4, 8, 8, and 8 μg/mL.
|
-
- HY-P2981
-
|
Carboxypeptidase Y; EC 3.4.16.1
|
Carboxypeptidase
|
Others
|
|
Carboxypeptidase C is a carboxypeptidase, is often used in biochemical studies. Carboxypeptidase C removes COOH-terminal lysine, arginine, and proline, as well as all other neutral, aliphatic, aromatic, and the acidic protein amino acids of a peptide chain.
|
-
- HY-P3579
-
|
GIP (1-42), porcine
|
Insulin Receptor
|
Endocrinology
|
|
Gastric Inhibitory Peptide, porcine is a glucose-dependent insulinotropic polypeptide, is a 42 amino acid intestinal hormone with effects on fat and glucose metabolism.
|
-
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models.
|
-
- HY-P3533
-
|
|
Integrin
|
Cardiovascular Disease
|
|
EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis.
|
-
- HY-P3503
-
|
BMN 111
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research.
|
-
- HY-D1405
-
-
- HY-147050
-
-
- HY-100211
-
TAPI-2
4 Publications Verification
TNF Protease Inhibitor 2
|
MMP
SARS-CoV
|
Cancer
|
|
TAPI-2 (TNF Protease Inhibitor 2) is a broad-spectrum inhibitor of matrix metalloprotease (MMP), tumour necrosis factorα-converting enzyme (TACE) and a disintegrin and metalloproteinase (ADAM), with an IC50 of 20 μM for MMP. TAPI-2 blocks the entry of infectious SARS-CoV.
|
-
- HY-P4874
-
|
|
Melanocortin Receptor
|
Metabolic Disease
|
|
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity.
|
-
- HY-P1051A
-
|
Amyloid β-Protein (12-28) (TFA); Amyloid Beta-Peptide (12-28) (human) TFA; β-Amyloid protein fragment(12-28) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (TFA) (Amyloid β-Protein (12-28) (TFA)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) (TFA) shows aggregation properties. β-Amyloid (12-28) (TFA) has the potential for Alzheimer’s disease research.
|
-
- HY-P1235
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-Y1636
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis).
|
-
- HY-147050A
-
-
- HY-P1535
-
|
Porcine secretin acetate
|
Secretin Receptor
|
Inflammation/Immunology
|
|
Secretin, porcine (Porcine secretin acetate) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
|
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria.
|
-
- HY-P0122
-
|
c(CRGDKGPDC)
|
Integrin
|
Cancer
|
|
iRGD peptide is a 9-amino acid cyclic peptide, triggers tissue penetration of agents by first binding to av integrins, then proteolytically cleaved in the tumor to produce CRGDK/R to interact with neuropilin-1, and has tumor-targeting and tumor-penetrating properties.
|
-
- HY-P3432
-
|
|
Fluorescent Dye
|
Others
|
|
DfTat is a fluorescently labeled dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection.
|
-
- HY-P0154
-
|
ε-V1-2; EAVSLKPT
|
PKC
|
Inflammation/Immunology
|
|
Epsilon-V1-2 (ε-V1-2), a PKCε-derived peptide, is a selective PKCε inhibitor. Epsilon-V1-2 inhibits the translocationof PKCε, but not α-, β-, and δPKC.
|
-
- HY-P1121A
-
|
|
Formyl Peptide Receptor (FPR)
|
Inflammation/Immunology
|
|
WKYMVM-NH2 TFA is a potent N-formyl peptide receptor (FPR1) and FPRL1/2 agonist, also activates several leukocyte effector functions such as chemotaxis, mobilization of complement receptor-3, and activation of the NADPH oxidase.
|
-
- HY-P0082A
-
|
Porcine glucagon hydrochloride
|
GCGR
|
Metabolic Disease
|
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis. Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation.
|
-
- HY-P4029
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (484-499) is a peptide consisting of 16 amino acids. HCV-1 e2 Protein (484-499) is derived from the envelope 2 protein of hepatitis C virus in the sera from individuals with antibodies to HCV.
|
-
- HY-P3452
-
|
|
Tyrosinase
|
Inflammation/Immunology
|
|
Tetrapeptide-30 is a skin-brightening peptide consisting of four amino acids. Tetrapeptide-30 can act as a tyrosinase inhibitor, lightening hyperpigmentation and evening out skin tone by reducing the amount of tyrosinase and inhibiting melanocyte activation.
|
-
- HY-P3622
-
|
|
GCGR
|
Metabolic Disease
|
|
(Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.
|
-
- HY-P4373
-
|
|
Cathepsin
MMP
|
Metabolic Disease
|
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation.
|
-
- HY-P1145
-
|
HuGLP-1
|
GCGR
|
Metabolic Disease
|
|
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
|
-
- HY-P1334
-
-
- HY-P1847
-
|
|
NF-κB
|
Cancer
|
|
IKKγ NBD Inhibitory Peptide is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits.
|
-
- HY-Y1169
-
|
4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis.
|
-
- HY-P3711
-
|
|
Na+/K+ ATPase
|
Others
|
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase.
|
-
- HY-113003
-
|
γ-Glutamylglutamine; γ-Glu-Gln
|
Others
|
Others
|
|
H-γ-Glu-Gln-OH is a hydrophilic peptide and can be conjugated to drugs. The carrier composed of H-γ-Glu-Gln-OH has the characteristics of high water solubility and drug-loading capacity, good biocompatibility, low toxicity, improved tumor targeting ability, and anti-tumor efficacy.
|
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression.
|
-
- HY-147021
-
|
|
ADC Linker
|
Cancer
|
|
MC-Val-D-Cit-PAB-PNP is a cleavable peptide linker molecule used in the synthesis of antibody-drug conjugates (ADCs). MC-Val-D-Cit-PAB-PNP contains a maleimidocaproyl (Mc) group that can be conjugated to an antibody and a p-nitrophenol (PNP) group that allows the peptide to be linked to antitumor compounds.
|
-
- HY-W048682
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-1-methyl-L-histidine is a Fmoc protected amino acid and can be used as an intermediate for peptide synthesis.
|
-
- HY-P0052
-
|
T20; DP178
|
HIV
|
Infection
|
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P3605
-
|
GAP (25-53), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (25-53), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 25-53 fragment (hGAP-25-53), can be used as immunogen to generate antiseras including MC-1, MC-2, and MC-3. GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site.
|
-
- HY-P3328
-
|
|
Bacterial
|
Infection
|
|
MDP1, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
|
-
- HY-P3328A
-
|
|
Bacterial
|
Infection
|
|
MDP1 acetate, a Melittin-derived peptide, alters the integrity of both Gram-positive and Gram-negative bacterial membranes and kills the bacteria via membrane damages. MDP1 acetate has a high-antibacterial activity against multidrug resistant (MDR) and reference strains of S. aureus, E. coli, and P. aeruginosa.
|
-
- HY-P0069A
-
-
- HY-P4093
-
-
- HY-P4146A
-
|
BI 456906 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Survodutide (BI 456906) (TFA) is an glucagon and glucagon-like peptide 1 (GLP-1) receptor agonist Survodutide (TFA) is equivalent to Survodutide HY-P4146.
|
-
- HY-P1111A
-
|
|
Src
Interleukin Related
|
Inflammation/Immunology
|
|
Lyn peptide inhibitor TFA is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor TFA blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor TFA can be used for study of asthma, allergic, and other eosinophilic disorders.
|
-
- HY-P1847A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
IKKγ NBD Inhibitory Peptide TFA is a highly specific inhibitor NF-κB inhibitor. IKKγ NBD Inhibitory Peptide TFA acts by disrupting the interaction between IKKγ/NEMO-binding domain (NBD) with IKKα and IKKβ, thus blocking TNF-α-induced NF-kB activation. IKKγ NBD Inhibitory Peptide TFA could significantly suppresses inflammation and ameliorate the cerebral ischemia-induced neurological deficits.
|
-
- HY-P2136
-
|
|
Apoptosis
|
Inflammation/Immunology
Neurological Disease
|
|
COG1410 is an apolipoprotein E-derived peptide and an apoptosis inhibitor. COG1410 exerts neuroprotective and antiinflammatory effects in a murine model of traumatic brain injury (TBI). COG1410 can be used for the research of neurological disease.
|
-
- HY-W010712
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-His(Trt)-OH has trityl (Trt) group to protect the side-chain of His. Fmoc-His(Trt)-OH has Fmoc group to protect -αNH2. Fmoc-His(Trt)-OH can be used for solid phase synthesis of peptides, providing protection against racemization and by-product formation.
|
-
- HY-P1115A
-
|
|
Akt
|
Others
|
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position.
|
-
- HY-P3908
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-Amyloid β-Protein (1-42) ammonium is a FITC tagged Aβ1-42 monomer peptide. Aβ1-42 plays a key role in the pathogenesis of Alzheimer’s disease.
|
-
- HY-P1566
-
|
|
HIV
|
Infection
|
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
-
- HY-125411
-
-
- HY-W087027
-
|
|
Others
|
Cancer
|
|
Maleimide-NOTA is a chelator for the labeling of peptides and antibodies. Maleimide-NOTA can react with cysteine.
|
-
- HY-P1535A
-
|
Porcine secretin TFA
|
Secretin Receptor
|
Inflammation/Immunology
|
|
Secretin, porcine TFA (Porcine secretin TFA) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
|
-
- HY-P4105
-
-
- HY-P1601
-
-
- HY-106275
-
|
Fibrin-derived peptide Bβ15-42
|
Flavivirus
|
Cardiovascular Disease
|
|
FX-06 (Fibrin-derived peptide Bβ15-42) is a fibrin Bbeta chain-derived peptide. FX-06 binds to VE-cadherin and inhibits leukocyte transmigration and initiates VE-cadherin-mediated signaling. FX-06 can be used in the research of ischemia/reperfusion injury, Dengue shock syndrome (DSS).
|
-
- HY-P1178
-
|
|
Trk Receptor
|
Neurological Disease
|
|
Cyclotraxin B, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects.
|
-
- HY-P3350
-
|
|
Bacterial
|
Infection
|
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
-
- HY-P0206
-
-
- HY-131091
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-Glu(OBzl)-OSu can be used for the solid-phase peptide synthesis containing glutamate benzyl ester residues.
|
-
- HY-P3548
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
[D-Ala2]-Met-Enkephalinamide, an opioid peptide, is a potent opioid agonist. [D-Ala2]-Met-Enkephalinamide decreases bile flow by a central mechanism. [D-Ala2]-Met-Enkephalinamide has analgesic properties.
|
-
- HY-P1508
-
|
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei.
|
-
- HY-17377
-
|
SCH-417690 maleate; SCH-D maleate
|
CCR
HIV
|
Infection
Endocrinology
|
|
Vicriviroc maleate (SCH-417690 maleate; SCH-D maleate) is a potent, selective, oral bioavailable and CNS penetrated antagonist of CCR5, with a Ki of 2.5 nM, and also inhibits HIV-1 in PBMC cells, with IC90s of 3.3 nM (JrFL), 2.8 nM (ADA-M), 1.8 nM (301657), 4.9 nM (JV1083) and 10 nM (RU 570).
|
-
- HY-P3585
-
|
|
TNF Receptor
|
Inflammation/Immunology
Neurological Disease
|
|
Epobis, a dendrimeric peptide, is a recombinant form of erythropoietin. Epobis is a potent erythropoietin receptor agonist. Epobis promotes neuritogenesis in primary motoneurons. Epobis decrease TNF release and crosses the blood-brain barrier. Epobis has anti-inflammatory and memory enhancing properties.
|
-
- HY-N10583
-
|
|
Others
|
Others
|
|
Motuporin is a cyclic peptide. Motuporin was initially isolated from T. swinhoei.
|
-
- HY-D1618
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine3 maleimide tetrafluoroborate is a specific labeling reagent for sulfhydryl groups with the λex of 550 nm and λem of 580 nm. Cyanine3 maleimide tetrafluoroborate can be used for protein and peptide labeling.
|
-
- HY-P1178A
-
|
|
Trk Receptor
|
Neurological Disease
|
|
Cyclotraxin B TFA, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B TFA non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B TFA can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects.
|
-
- HY-135414
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine5 NHS ester chloride is a red emitting fluorescent dye for labeling of amino-groups in peptides, proteins, and oligonucleotides.
|
-
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD).
|
-
- HY-P2231
-
|
MEDI0382
|
GCGR
|
Metabolic Disease
|
|
Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D).
|
-
- HY-16215
-
|
G-202
|
Drug-Linker Conjugates for ADC
|
Cancer
|
|
Mipsagargin (G-202) is a novel thapsigargin-based targeted proagent consisting of a prostate-specific membrane antigen (PSMA)-specific peptide coupled to an analog of the potent sarcoplasmic/endoplasmic reticulum calcium adenosine triphosphatase (SERCA) pump inhibitor Thapsigargin (HY-13433). Mipsagargin is activated by PSMA-mediated cleavage of an inert masking peptide. Mipsagargin has the potential for refractory, advanced or metastatic solid tumours research.
|
-
- HY-P1465
-
-
- HY-P3448
-
|
CEND-1; iRGD
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors.
|
-
- HY-P1222
-
|
|
Bacterial
|
Infection
|
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.
|
-
- HY-P2295
-
|
|
SARS-CoV
|
Others
|
|
Dabcyl-KTSAVLQSGFRKME-Edans TFA is a fluorogenic peptide. Dabcyl-KTSAVLQSGFRKME-Edans TFA is used as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKME-Edans TFA has the potential for study 2019-nCoV (COVID-19) infection.
|
-
- HY-P1508A
-
|
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei.
|
-
- HY-P0311
-
|
|
Bacterial
|
Infection
|
|
LAH4, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 possesses high plasmid DNA delivery capacities. LAH4 has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes.
|
-
- HY-17571A
-
|
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma.
|
-
- HY-P0069
-
|
AM-111; XG-102
|
JNK
|
Others
|
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
-
- HY-P3512
-
|
|
Parasite
Bacterial
|
Infection
|
|
Iseganan is an antimicrobial peptide, shows broad-spectrum anti-bacteria and fungi activity. Iseganan can be used in oral mucositis research.
|
-
- HY-P4373A
-
|
|
Cathepsin
MMP
|
Inflammation/Immunology
|
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation.
|
-
- HY-P2458
-
|
|
Bacterial
|
Infection
|
|
CAP18 (rabbit) is a 37 amino acids antimicrobial peptide originally isolated from rabbit granulocytes. CAP18 (rabbit) has broad antimicrobial activity against both Gram-positive (IC50, 130-200 nM) and Gram-negative (IC50, 20-100 nM) bacteria. CAP18 (rabbit) has the potential for bacterial sepsis research.
|
-
- HY-126810A
-
|
|
Fungal
|
Infection
|
|
NP213 TFA is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide (AMP), has anti-fungal activities. NP213 TFA targets the fungal cytoplasmic membrane and plays it role via membrane perturbation and disruption. NP213 TFA is effective and well-tolerated in resolving nail fungal infections.
|
-
- HY-P1222A
-
|
|
Bacterial
|
Infection
|
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing.
|
-
- HY-105077A
-
|
INN 00835 diTFA
|
5-HT Receptor
|
Neurological Disease
|
|
Nemifitide diTFA (INN 00835 diTFA) is a synthetic pentapeptide antidepressant with a potential for rapid onset of action. Nemifitide diTFA is a peptide analog of melanocyte-inhibiting factor (MIF). Nemifitide diTFA can cross the blood-brain barrier.
|
-
- HY-P4060
-
-
- HY-W345510
-
|
|
Neprilysin
|
Neurological Disease
|
|
Opiorphin, an opioid peptide, is a potent enkephalin-inactivating zinc ectopeptidases in human inhibitor. Opiorphin inhibits two enkephalin-catabolizing ectoenzymes, human neutral ecto-endopeptidase, hNEP (EC 3.4.24.11) with an IC50 value of 11 μM, and human ecto-aminopeptidase, hAP-N (EC 3.4.11.2). Opiorphin displays potent analgesic activity by activating endogenous opioid-dependent transmission.
|
-
- HY-P0311A
-
|
|
Bacterial
|
Infection
|
|
LAH4 TFA, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 TFA possesses high plasmid DNA delivery capacities. LAH4 TFA has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes.
|
-
- HY-P0089
-
|
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.
|
-
- HY-17446
-
|
HOE 140
|
Bradykinin Receptor
|
Endocrinology
|
|
Icatibant (HOE-140) is a potent and specific peptide antagonist of bradykinin B2 receptor with IC50 and Ki of 1.07 nM and 0.798 nM respectively.
|
-
- HY-P0262
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
Inflammation/Immunology
Neurological Disease
Endocrinology
|
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM).
|
-
- HY-P1821
-
|
MHP4-14
|
PKC
|
Neurological Disease
|
|
Myelin Basic Protein (MHP4-14), a synthetic peptide comprising residues 4-14 of myelin basic protein, is a very selective PKC substrate (Km=7 μM). Myelin Basic Protein is not phosphorylated by cyclic AMP-dependent protein kinase, casein kinases I and II, Ca 2+/calmodulin-dependent protein kinase II, or phosphorylase kinase, and can be routinely used for the assay of protein kinase C with low background in the crude tissue extracts.
|
-
- HY-P1471
-
|
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
|
-
- HY-P3916
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
GVLSNVIGYLKKLGTGALNAVLKQ is an antimicrobial peptide with 24-amino acid. GVLSNVIGYLKKLGTGALNAVLKQ can potentially form α-helix. GVLSNVIGYLKKLGTGALNAVLKQ (PGQ) has activity against Gram-negative, Gram-positive bacteria and the yeast Candida albicans.
|
-
- HY-P5285
-
|
|
Parasite
|
Cancer
Infection
Inflammation/Immunology
|
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells.
|
-
- HY-D0819A
-
|
Cy5 NHS Ester triethylamine salt; Sulfo-Cyanine5 Succinimidyl Ester triethylamine salt
|
Fluorescent Dye
|
Others
|
|
Cy5-SE (Cy5 NHS Ester) triethylamine salt is a reactive dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. Cy5-SE triethylamine salt is ideal for very cost-efficient labeling of soluble proteins, as well as all kinds of peptides and oligonucleotides Ex=649 nm; Em=670 nm).
|
-
- HY-155667
-
|
|
Others
|
Others
|
|
Z-Nle-Lys-Arg-AMC is a fluorogenic peptide substrate that specifically monitors cathepsin B activity over a broad pH range.
|
-
- HY-A0162
-
|
|
Bacterial
|
Infection
|
|
Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits .
|
-
- HY-P3270
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Capreomycin is a macrocyclic peptide antibiotic. Capreomycin can be used for anti-multidrug-resistant-tuberculosis research. Capreomycin can inhibit phenylalanine synthesis in in mycobacterial ribosomes translation
|
-
- HY-108312A
-
|
|
Caspase
|
Neurological Disease
|
|
AC-VEID-CHO (TFA) is a peptide-derived caspase inhibitor and has potency of inhibition for Caspase-6, Caspase-3 and Caspase-7 with IC50 values of 16.2 nM, 13.6 nM and 162.1 nM, respectively. AC-VEID-CHO (TFA) can be used for the research of neurodegenerative conditions including Alzheimer’s and Huntington’s disease.
|
-
- HY-W142073
-
|
7-Methyltryptophan
|
Amino Acid Derivatives
|
Infection
|
|
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof.
|
-
- HY-P1261
-
-
- HY-P1262
-
-
- HY-P4103
-
-
- HY-P0062
-
-
- HY-P1262A
-
-
- HY-P1261A
-
-
- HY-P1575
-
|
|
HIV
|
Infection
|
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
- HY-P1416
-
|
|
Wnt
|
Cancer
|
|
Foxy-5, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model.
|
-
- HY-P1752
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II (human) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior.
|
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel.
|
-
- HY-P0316
-
|
|
Thrombin
NO Synthase
|
Cardiovascular Disease
|
|
TP508 is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 activates endothelial cells and stem cells to revascularize and regenerate tissues.
|
-
- HY-150242A
-
|
|
Others
|
Others
|
|
Cbz-Ala-Ala-Asn TFA is a peptide that designed based on the sequence of the substrate of legumain. Legumain is a cysteine protease. Cbz-Ala-Ala-Asn TFA can be applied as a scaffold for drug delivery.
|
-
- HY-P1210
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis.
|
-
- HY-P0202
-
-
- HY-P3616
-
|
|
GCGR
|
Metabolic Disease
|
|
Human glucagon-like peptide-1-(7-36)-Lys(Biotin) amide is a biotin labeled glucagon-like peptide-1-(7-36). Glucagon-like peptide-1-(7-36) is a gastrointestinal peptide with antidiabetogenic activity, and can increase the release of insulin.
|
-
- HY-108675
-
|
|
MMP
P2X Receptor
|
Cancer
Infection
|
|
PPNDS tetrasodium is a selective and competitive meprin β inhibitor (IC50: 80 nM, Ki: 8 nM), and also inhibits ADAM10 (IC50: 1.2 μM). PPNDS tetrasodium is also a P2X1 receptor antagonist. PPNDS is an agonist for the ATP receptor of Paramecium. PPNDS tetrasodium potently inhibits polymerases from viruses. PPNDS tetrasodium can be used in the research of infection and cancers.
|
-
- HY-101448
-
|
WAY-171318
|
MMP
Apoptosis
|
Cancer
Inflammation/Immunology
|
|
TMI-1 is a potent inhibitor of disintegrin metalloenzyme 17 (ADAM17) and other MMPs. TMI-1 inhibits LPS-induced TNF-α secretion in human primary monocytes, and human whole blood. TMI-1 selectively induces caspase-dependent apoptosis in triple negative (TN) and ERBB2-overexpressing breast tumor cell lines.
|
-
- HY-100211A
-
|
(R)-TNF Protease Inhibitor 2
|
Others
|
Cancer
|
|
(R)-TAPI-2 is the isomer of TAPI-2 (HY-100211A). TAPI-2 (TNF Protease Inhibitor 2) is a broad-spectrum inhibitor of matrix metalloprotease (MMP), tumour necrosis factorα-converting enzyme (TACE) and a disintegrin and metalloproteinase (ADAM), with an IC50 of 20 μM for MMP. TAPI-2 blocks the entry of infectious SARS-CoV.
|
-
- HY-132988
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Tyr(3-F,tBu)-OH is a cyclic peptide compound with high membrane permeability and can specifically binds to a target molecule (extracted from patent WO2018225864A1).
|
-
- HY-P1575A
-
|
|
HIV
|
Infection
|
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
- HY-P1045
-
|
|
Arp2/3 Complex
|
Others
|
|
187-1, N-WASP inhibitor, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein.
|
-
- HY-P1045A
-
|
|
Arp2/3 Complex
|
Others
|
|
187-1, N-WASP inhibitor TFA, a 14-aa cyclic peptide, is an allosteric neural Wiskott-Aldrich syndrome protein (N-WASP) inhibitor. 187-1, N-WASP inhibitor TFA potently inhibits actin assembly induced by phosphatidylinositol 4,5-bisphosphate (PIP2) with an IC50 of 2 μM. 187-1, N-WASP inhibitor TFA prevents the activation of Arp2/3 complex by N-WASP by stabilizing the autoinhibited state of the protein.
|
-
- HY-14743
-
|
SCV 07; Gamma-D-glutamyl-L-tryptophan
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod (SCV-07), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod (SCV-07) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod (SCV-07) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2).
|
-
- HY-P1416A
-
|
|
Wnt
|
Cancer
|
|
Foxy-5 TFA, a WNT5A agonist, is a mimicking peptide of WNT5A which is a non-canonical member of the Wnt family. Foxy-5 TFA triggers cytosolic free calcium signaling without affecting β-catenin activation and it impairs the migration and invasion of epithelial cancer cells. Foxy-5 TFA effectively reduces the metastatic spread of WNT5A-low prostate cancer cells in an orthotopic mouse model.
|
-
- HY-P0027
-
|
|
Arp2/3 Complex
Fungal
|
Cancer
Infection
|
|
Jasplakinolide is a potent actin polymerization inducer and stabilizes pre-existing actin filaments. Jasplakinolide binds to F-actin competitively with phalloidin with a Kd of 15 nM. Jasplakinolide, a naturally occurring cyclic peptide from the marine sponge, has both fungicidal and anti-cancer activity.
|
-
- HY-148140
-
|
|
Others
|
Others
|
|
Sephadex G 25 is a dextran chromatography medium. Sephadex G-25 separates from 1 to 5 kD (spherical proteins) and can be used for the separation of peptides as well as for the desalting and buffer replacement of large molecule proteins.
|
-
- HY-153686
-
-
- HY-P0316A
-
|
|
Thrombin
NO Synthase
|
Cardiovascular Disease
|
|
TP508 TFA is a 23-amino acid nonproteolytic thrombin peptide that represents a portion of the receptor-binding domain of thrombin molecule. TP508 TFA activates endothelial NO synthase (eNOS) and stimulates production of NO in human endothelial cells. TP508 TFA activates endothelial cells and stem cells to revascularize and regenerate tissues.
|
-
- HY-P1210A
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis.
|
-
- HY-105088
-
|
MSI 78 free base
|
Bacterial
|
Infection
|
|
Pexiganan (MSI 78 free base) is a synthetic analog of magainin 2. Pexiganan is a potent and orally active broad-spectrum antimicrobial peptide. Pexiganan can be used in the research of infections, such as diabetic foot ulcer infections.
|
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) contains the N-terminal eosin-labeled cysteine plus the protein transduction domain of HIV TAT protein (amino acids 49 to 57) fused to the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis.
|
-
- HY-P5162
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities.
|
-
- HY-P3513
-
|
|
ERK
MMP
|
Neurological Disease
|
|
β-Neo-Endorphin is an endogenous opioid peptide. β-Neo-Endorphin is a hypothalamic “big” Leu-enkephalin of porcine origin. β-Neo-Endorphin shows activation of the Erk1/2, MMP-2 and MMP-9.
|
-
- HY-P1222B
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing.
|
-
- HY-131083
-
-
- HY-P0256
-
Apamin
1 Publications Verification
Apamine
|
Potassium Channel
|
Inflammation/Immunology
Neurological Disease
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity.
|
-
- HY-P4122
-
|
|
HIV
|
Others
|
|
TAT (47-57), FAM-labeled is a cell-penetrating peptide (CPP). TAT (47-57), FAM-labeled has the potential for intracellular drug delivery research.
|
-
- HY-P1801
-
|
Cys-[HIV-Tat (47-57)]
|
HIV
|
Infection
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P1801A
-
|
Cys-[HIV-Tat (47-57)] TFA
|
HIV
|
Infection
|
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) TFA contains the N-terminal eosin-labeled cysteine plus the protein transduction domain of HIV TAT protein (amino acids 49 to 57) fused to the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis.
|
-
- HY-D0819
-
|
Cy5 NHS Ester; Sulfo-Cyanine5 Succinimidyl Ester
|
Fluorescent Dye
|
Others
|
|
Cy5-SE (Cy5 NHS Ester) is a reactive dye for the labeling of amino-groups in peptides, proteins, and oligonucleotides. This dye requires small amount of organic co-solvent (such as DMF or DMSO) to be used in labeling reaction. This reagent is ideal for very cost-efficient labeling of soluble proteins, as well as all kinds of peptides and oligonucleotides. This reagent also works well in organic solvents for small molecule labeling.
Excitation (nm):649, Emission (nm): 670.
|
-
- HY-P1815
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
|
-
- HY-P1426
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM).
|
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-D0878
-
|
|
Biochemical Assay Reagents
|
Others
|
|
TAPSO is a common biological buffer, a pH stabilization reagent, with effective pH ranging from 7-8, and pKa values ranging from 7.5–9.0. TAPSO contains Tris groups and exhibits quite reactive activity with zwitterionic glycine peptides.
|
-
- HY-114350
-
|
|
Fluorescent Dye
|
Others
|
|
BDP FL maleimide is a thiol-reactive dye (Ex: 503 nm; Em: 509 nm). BDP FL maleimide can be used for protein labeling, peptide modification, and can replace fluorescein (FAM) for microscopy.
|
-
- HY-P1471A
-
|
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
|
-
- HY-P1815A
-
|
|
Angiotensin Receptor
|
Endocrinology
Cardiovascular Disease
|
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone.
|
-
- HY-P4123
-
|
|
HIV
|
Others
|
|
TAT (47-57) GGG-Cys(Npys) is a cell-penetrating peptide (CPP). TAT (47-57) GGG-Cys(Npys) has the potential for intracellular drug delivery research.
|
-
- HY-13589
-
|
LU103793 free base
|
Microtubule/Tubulin
|
Cancer
|
|
Cemadotin (LU103793) is an analogue of Dolastatin 15 (HY-P1126) which is naturally occurring cytotoxic peptides. Cemadotin blocks cells at mitosis, and exhibits Ki value of 1 μM for inhibiting tubulin. Cemadotin can be used to research anticancer.
|
-
- HY-P3356
-
|
|
Elastase
Proteasome
|
Inflammation/Immunology
|
|
Cyclotheonellazole A is a natural macrocyclic peptide and a potent elastase inhibitor (IC50=0.034 nM). Cyclotheonellazole A inhibits chymotrypsin with an IC50 value of 0.62 nM.
|
-
- HY-151778
-
|
|
ADC Linker
|
Others
|
|
Fmoc-Abg(N3)-OH is a click chemistry reagent containing an azide group. Fmoc-Abg(N3)-OH has the potential to synthesize peptide nucleic acids (PNA) and peptoids.
|
-
- HY-W324458
-
|
|
Fluorescent Dye
|
Others
|
|
MCA succinimidyl ester is a derivative of MCA (HY-W027544). MCA succinimidyl ester has succinimidyl ester can react selectively with amines. MCA succinimidyl ester can be used as peptide substrate for fluorescence resonance energy transfer.
|
-
- HY-P3528
-
|
|
Caspase
Apoptosis
|
Neurological Disease
|
|
GPR is a three amino acid peptide. GPR can rescue cultured rat hippocampal neurons from Aβ-induced neuronal death by inhibiting caspase-3/p53 dependent apoptosis. GPR can be used for the research of Alzheimer's disease (AD).
|
-
- HY-P1630
-
|
|
Bacterial
|
Infection
|
|
Buforin II, derived from buforin I, a protein isolated from the stomach of the Asian toad Bufo bufo gargarizans, is a potent antimicrobial peptide. Buforin II has antimicrobial activity against a broad spectrum of Gram-positive and Gram-negative bacteria.
|
-
- HY-P4082
-
|
HER2-binding peptide
|
EGFR
|
Cancer
|
|
ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research.
|
-
- HY-P0270
-
|
Magainin II
|
Bacterial
Antibiotic
Fungal
|
Infection
|
|
Magainin 2 (Magainin II) is an antimicrobial peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa. Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes.
|
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P3418A
-
|
|
CCR
ERK
|
Inflammation/Immunology
|
|
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research.
|
-
- HY-P3418
-
|
|
CCR
ERK
|
Inflammation/Immunology
|
|
CKLF1-C27, a C-terminal peptide of CKLF1, binds to CCR4 receptor and activates ERK1/2 pathway. CKLF1-C27 can abrogate the effect of CKLF1 on cells by competing for CCR4 receptor. CKLF1-C27 shows great effect on promoting proliferation on HUVECs. CKLF1-C27 has the potential for psoriasis research.
|
-
- HY-P1513
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P0276
-
|
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion.
|
-
- HY-135414A
-
|
|
Fluorescent Dye
|
Others
|
|
Cyanine5 NHS ester bromide is a active compound, can be used to label amino groups in peptides, proteins, and oligonucleotides. Cyanine5 NHS ester bromide is a cyanine dye, fluorescence-labeling neurotensin (8-13) via arginine residues.
|
-
- HY-13443A
-
|
Exenatide acetate
|
GCGR
|
Metabolic Disease
|
|
Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
-
- HY-P2505
-
|
|
Syk
|
Others
|
|
Syk Kinase Peptide Substrate is a Syk kinase peptide substrate.
|
-
- HY-P1136B
-
-
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel.
|
-
- HY-P3507
-
|
ShK-186
|
Potassium Channel
|
Metabolic Disease
Inflammation/Immunology
|
|
Dalazatide (ShK-186) is a specific Kv1.3 potassium channel peptide inhibitor. Dalazatide can be used in the study of autoimmune diseases such as multiple sclerosis (MS), lupus erythematosus, psoriasis, rheumatoid arthritis, type 1 diabetes and inflammatory bowel disease.
|
-
- HY-P3777
-
|
|
Potassium Channel
|
Neurological Disease
|
|
β-Bag cell peptide is a neuroactive peptide. β-Bag cell peptide elevates cyclic AMP levels in the bag cell neurons. β-Bag cell peptide decreases the amplitudes of the voltage-dependent potassium currents.
|
-
- HY-P1333A
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A TFA is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A TFA is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A TFA can induce neuronal death, and can be used in the research of neurological disease.
|
-
- HY-P5189A
-
|
|
Endogenous Metabolite
Cholinesterase (ChE)
|
Others
|
|
His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA, is a growth hormone releasing peptide, as well as a metabolite of GHRP-1. GHRP-1, or Ala-His-D-beta Nal-Ala-Trp-D-Phe-Lys-NH2, has the effect of promoting the release of growth hormone (GH). GHRP-1 increases GH release and increases [Ca2+]i levels in static monolayer cells of rat pituitary gland, but does not affect cAMP levels.
|
-
- HY-P1459
-
|
|
Bacterial
|
Infection
|
|
Sphistin Synthetic Peptide (12-38, Fitc in N-Terminal-Fluorescently Labeled Peptide) is a truncated fragments of Sphistin Synthetic Peptide that shows potent antimicrobial activity.
|
-
- HY-P5391
-
|
|
Bacterial
|
Others
|
|
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
|
-
- HY-P5127
-
-
- HY-P4809
-
-
- HY-125777A
-
|
|
nAChR
|
Neurological Disease
|
|
α-Conotoxin Vc1.1 TFA is a disulfide-bonded peptide isolated from Conus victoriae and is a selective nAChR antagonist. α-Conotoxin Vc1.1 TFA inhibits α3α5β2, α3β2 and α3β4 with IC50s of 7.2 μM, 7.3 μM and 4.2 μM, respectively, and has less inhibitory effect on other nAChR subtypes. α-Conotoxin Vc1.1 TFA has the potential for neuropathic pain reserach.
|
-
- HY-P3576
-
|
|
Fluorescent Dye
|
Cancer
Neurological Disease
|
|
Biotin-Gastrin Releasing Peptide, human is a biotinylated gastrin releasing peptide (GRP). Gastrin-releasing peptide (GRP) is a neuropeptide with growth-stimulatory and tumorigenic properties.
|
-
- HY-P3964
-
|
|
Endogenous Metabolite
|
Endocrinology
|
|
TRH Precursor Peptide is a precursor peptide of thyrotropin-releasing hormone (TRH). TRH Precursor Peptide formation of TRH in rat brain and pituitary is zinc-dependent.
|
-
- HY-P1404
-
|
|
Pim
|
Cancer
|
|
R8-T198wt is a cell-permeable carboxyl-terminal p27 Kip1 peptide exhibits anti-tumor activity by inhibiting Pim-1 kinase.
|
-
- HY-P2302
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
|
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors.
|
-
- HY-P2358
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA).
|
-
- HY-P1651
-
|
|
TRP Channel
|
Cancer
|
|
SOR-C13, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 has anticancer activity.
|
-
- HY-P1369
-
|
|
Dynamin
|
Neurological Disease
|
|
DynaMin inhibitory peptide, myristoylated is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated is a membrane-permeant form of the peptide that prevents endocytosis.
|
-
- HY-P2200
-
|
BMY-29304
|
HIV
Antibiotic
|
Infection
Inflammation/Immunology
|
|
Siamycin I (BMY-29304), a 21-residue tricyclic peptide, is a secondary metabolite in actinomycetes. Siamycin I is a HIV fusion inhibitor with ED50s of 0.05 to 5.7 μM for acute HIV type 1 (HIV-1) and HIV-2 infections. Siamycin I inhibits the gelatinase and gelatinase biosynthesis-activating pheromone (GBAP) signaling via the FsrC-FsrA two-component regulatory system in a noncompetitive manner. Siamycin I suppresses the expression of both fsrBDC and gelE-sprE transcripts. Siamycin I, a lasso peptide, interacts with lipid II and inhibits cell wall biosynthesis. Siamycin I, an antibiotic, has the potential for enterococcal infections research.
|
-
- HY-P5439
-
|
|
PKC
|
Others
|
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-118593
-
|
Madumycin II; Antibiotic A 2315A
|
Antibiotic
|
Infection
|
|
A2315A (Madumycin II) is an alanine-containing streptogramin A antibiotic. A2315A is a potent peptidyl transferase center (PTC) inhibitor. A2315A inhibits the ribosome prior to the first cycle of peptide bond formation.
|
-
- HY-106228
-
|
|
Fungal
Bacterial
Glutathione Peroxidase
|
Infection
|
|
HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses.
|
-
- HY-P1136C
-
-
- HY-P3146S
-
|
|
Isotope-Labeled Compounds
|
Cancer
|
|
FTISADTSK- 13C6, 15N2 TFA is 13C- and 15N-labeled FTISADTSK (HY-P3146). FTISADTSK is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
|
-
- HY-P1546
-
|
|
Bacterial
|
Infection
|
|
Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.
|
-
- HY-P5359
-
-
- HY-P5388
-
|
|
Renin
|
Others
|
|
Renin inhibitor peptide,rat is a biological active peptide. (A specific rat renin inhibitor.)
|
-
- HY-105172
-
|
CAP-232; TLN-232
|
Somatostatin Receptor
|
Cancer
Inflammation/Immunology
|
|
TT-232 (CAP-232), a somatostatin derivative, is a peptide SSTR1/SSTR4 agonist. TT-232 inhibits cancer cell proliferation and induces apoptosis. TT-232 is also a broad-spectrum anti-inflammatory and analgesic agent.
|
-
- HY-P1651A
-
|
|
TRP Channel
|
Cancer
|
|
SOR-C13 TFA, a carboxy-terminal truncated peptide, is a high-affinity TRPV6 antagonist with an IC50 value of 14 nM. TRPV6 is a non-voltage gated calcium channel that is associated with malignancy and poor prognosis in breast cancer. SOR-C13 TFA has anticancer activity.
|
-
- HY-15938
-
|
|
Fluorescent Dye
|
Others
|
|
5-FAM SE is a single isomer, is a fluorescent labeling reagent used for labeling peptides, proteins and nucleotides. 5-FAM SE can react with amines and can yield stable amine conjugates.
|
-
- HY-P2641
-
|
|
MMP
|
Cancer
|
|
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro.
|
-
- HY-P1369A
-
|
|
Dynamin
|
Neurological Disease
|
|
DynaMin inhibitory peptide, myristoylated TFA is a DynaMin inhibitor to interfere with the binding of amphiphysin with dynamin. DynaMin inhibitory peptide, myristoylated TFA is a membrane-permeant form of the peptide that prevents endocytosis.
|
-
- HY-P3159
-
|
|
Biochemical Assay Reagents
|
Others
|
|
VPM peptide is a dithiol protease-cleavable peptide cross-linker. VPM peptide can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.
|
-
- HY-P5497
-
|
|
HIV
|
Others
|
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
-
- HY-P1075
-
CALP3
1 Publications Verification
|
Calcium Channel
|
Cancer
Neurological Disease
|
|
CALP3, a Ca 2+-like peptide, is a potent Ca 2+ channel blocker that activates EF hand motifs of Ca 2+-binding proteins. CALP3 can functionally mimic increased [Ca 2+]i by modulating the activity of Calmodulin (CaM), Ca 2+ channels and pumps. CALP3 has the potential in controlling apoptosis in diseases such as AIDS or neuronal loss due to ischemia.
|
-
- HY-107989
-
|
|
Antibiotic
|
Endocrinology
|
|
Urofollitropin is a protein extract of human menopausal urine. Urofollitropin has the function of promoting follicle development and maturation, but contains very small amounts of urinary proteins.
|
-
- HY-106882
-
|
MDL 62879
|
Bacterial
Antibiotic
|
Infection
|
|
GE 2270A (MDL 62879) is an antibiotic. GE 2270A inhibits gram-positive bacteria and anaerobes by inhibiting protein synthesis. GE 2270A can be used for the research of infection.
|
-
- HY-P5324
-
|
|
Bcl-2 Family
|
Others
|
|
Bad BH3 (mouse) is a biological active peptide. (This is a bcl-2 binding peptide. This peptide is derived from the BH3 domain (a death domain) of Bad, amino acid residues 140 to 165.)
|
-
- HY-P1491
-
|
|
HIV
|
Infection
|
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
-
- HY-P1674A
-
|
POL7080 TFA
|
Bacterial
Antibiotic
|
Infection
|
|
Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance.
|
-
- HY-P5450
-
|
|
PDK-1
|
Others
|
|
PDKtide is a biological active peptide. (This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).)
|
-
- HY-P2504
-
|
|
Syk
|
Others
|
|
Syk Kinase Peptide Substrate, Biotin labeled is a biotin-labled Syk kinase peptide substrate.
|
-
- HY-P5381
-
|
|
NADPH Oxidase
|
Others
|
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
-
- HY-P2547
-
|
|
Src
|
Others
|
|
Tyrosine Kinase Peptide 1 is a control substrate peptide for c-Src assay.
|
-
- HY-P5483
-
|
|
Bacterial
|
Others
|
|
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)
|
-
- HY-149872
-
|
|
Biochemical Assay Reagents
|
Others
|
|
DCA-RMR1 is a cross-linker. DCA-RMR1 elicits facile bicyclization of native peptides via N-terminus Cys-Cys cross-linking. DCA-RMR1 derivatizes RMR1 with 1,3-dichloroacetone (DCA).
|
-
- HY-P1113
-
|
|
GSK-3
|
Others
|
|
Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases.
|
-
- HY-P1113A
-
|
|
GSK-3
|
Others
|
|
Phospho-Glycogen Synthase Peptide-2 (substrate) is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used for affinity purification of protein-serine kinases.
|
-
- HY-P3159A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
VPM peptide TFA is a dithiol protease-cleavable peptide cross-linker. VPM peptide TFA can be incorporated into the backbone of the PEG-diacrylate (PEG-DA) macromer to form PEG hydrogel.
|
-
- HY-P5463
-
|
|
Bacterial
|
Others
|
|
C18G is a biological active peptide. (C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.)
|
-
- HY-P2168
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Demoxytocin, a heterodetic cyclic peptide, is an analog of oxytocin. Demoxytocin affects the permeability of the cell membrane, increasing the content of calcium ions in smooth muscle cells, increasing its contraction. Demoxytocin also stimulates the contraction of smooth muscles of the uterus. Demoxytocin has the function of oxytocin. Demoxytocin can be used to research stimulation of labor in cases of premature rupture.
|
-
- HY-P1075A
-
|
|
Calcium Channel
|
Cancer
Neurological Disease
|
|
CALP3 TFA, a Ca 2+-like peptide, is a potent Ca 2+ channel blocker that activates EF hand motifs of Ca 2+-binding proteins. CALP3 TFA can functionally mimic increased [Ca 2+]i by modulating the activity of Calmodulin (CaM), Ca 2+ channels and pumps. CALP3 TFA has the potential in controlling apoptosis in diseases such as AIDS or neuronal loss due to ischemia.
|
-
- HY-P3291
-
|
ZP7570
|
GCGR
|
Metabolic Disease
|
|
Dapiglutide (ZP7570) is a long-acting glucagon-like peptide-1 receptor 1R (GLP-1R)/Glucagon-like peptide-2 receptor (GLP-2R) dual agonist. Dapiglutide can be used for short bowel syndrome (SBS) research.
|
-
- HY-P1565
-
|
TD 1 Disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules.
|
-
- HY-P5124
-
|
KLVFF
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility).
|
-
- HY-P5474
-
|
|
Bacterial
|
Others
|
|
PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.)
|
-
- HY-P2321
-
-
- HY-148204
-
|
|
Bacterial
|
Infection
|
|
Gallichrome is an active peptide. Gallichrome can interact directly with the hydroxamate moieties of the siderophore. Gallichrome can be used for the research of the uptake of iron in many gram-positive and gramnegative bacteria.
|
-
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis.
|
-
- HY-P5371
-
|
|
Thrombin
|
Others
|
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-P0318
-
-
- HY-P1043A
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide Trifluoroacetatecontaining the Asn-Gly-Arg (NGR) motif. NGR peptide Trifluoroacetate binds to APN/CD13. NGR peptide Trifluoroacetate is directly conjugated to imaging agents that can be used for tumor imaging.
|
-
- HY-P3612
-
|
|
CXCR
|
Inflammation/Immunology
|
|
CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.
|
-
- HY-P1758
-
|
IRRP1
|
IFNAR
|
Infection
|
|
IFN-α Receptor Recognition Peptide 1 is a peptide of IFN-α associated with receptor interactions.
|
-
- HY-P2311
-
-
- HY-P2321A
-
-
- HY-P4109
-
|
NT21MP; V1 peptide
|
CXCR
|
Cancer
Inflammation/Immunology
|
|
vMIP-II (1-21) is a CXCR4 antagonist. vMIP-II has broad-spectrum interaction with CC and CXC chemokine receptors. vMIP-II (1-21) binds with CXCR4 with an IC50 value of 190 nM for competing with CXCR4 binding of 125I-SDF-1R.
|
-
- HY-P3150
-
|
|
Ser/Thr Protease
|
Others
|
|
Recombinant Proteinase K is a serine protease that cleaves the carboxy-terminated peptide bonds of aliphatic and aromatic amino acids. Recombinant Proteinase K can be used to digest proteins and remove contamination from nucleic acid preparations.
|
-
- HY-P1565A
-
|
TD 1 Disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules.
|
-
- HY-P1119
-
WRW4
3 Publications Verification
|
Formyl Peptide Receptor (FPR)
|
Neurological Disease
|
|
WRW4, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 specifically inhibits the increase in intracellular calcium by the FPRL1 agonists MMK-1, amyloid beta42 (Abeta42) peptide, and F peptide.
|
-
- HY-P3874
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Peptide E is a potent kappa opiate receptor agonist. Peptide E has opiate receptor binding activity with IC50 value of 0.39 μM. Peptide E can be used for the research of central nervous system.
|
-
- HY-148101
-
|
|
Ephrin Receptor
|
Cancer
|
|
BT5528 is a bicyclic peptide toxin conjugate, an EphA2 activator. BT5528, made up of a bicyclic peptide and Auristatin E (HY-15582), is derivated from BCY6099. BT5528 shows potent anti-tumor activity without bleeding or coagulation toxicity in rats model.
|
-
- HY-151783
-
|
|
ADC Linker
|
Others
|
|
DAPOA is a click chemistry reagent containing an azide group. DAPOA can be used in peptide synthesis as a linker that can be further modified at the azido-groups using Staudinger ligation or click-chemistry.
|
-
- HY-P1280A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
|
-
- HY-P1280
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research.
|
-
- HY-P1119A
-
|
|
Formyl Peptide Receptor (FPR)
|
Neurological Disease
|
|
WRW4 TFA, a specific formyl peptide receptor-like 1 (FPRL1) antagonist, inhibits WKYMVm binding to FPRL1 with an IC50 of 0.23 μM. WRW4 TFA specifically inhibits the increase in intracellular calcium by the FPRL1 agonists MMK-1, amyloid beta42 (Abeta42) peptide, and F peptide.
|
-
- HY-P0239A
-
|
|
Influenza Virus
|
Inflammation/Immunology
|
|
HA Peptide (TFA) is a nine amino acids peptide derived from the human influenza hemagglutinin (HA). HA Peptide (TFA) is extensively used to isolate, purify, detect, and track the protein of interest in cell biology and biochemistry.
|
-
- HY-P1021
-
-
- HY-P1527
-
|
|
Bcl-2 Family
|
Others
|
|
Bim BH3 is a biological active peptide. (This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.)
|
-
- HY-P2532
-
|
|
Integrin
|
Others
|
|
Integrin Binding Peptide is derived by fibronectin. Integrin Binding Peptide can be used for PEG hydrogel preparation.
|
-
- HY-P3770
-
|
|
PKC
|
Others
|
|
Phosphate acceptor peptide is a substrate for cAMP-dependent protein kinase (PKA). phosphate acceptor peptide is also a weak PKC inhibitor.
|
-
- HY-P5165
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM.
|
-
- HY-P2259
-
|
|
iGluR
|
Neurological Disease
|
|
TAT-GluA2 3Y, an interference peptide, blocks long-term depression (LTD) at glutamatergic synapses by disrupting the endocytosis of AMPAR. TAT-GluA2 3Y can alleviate Pentobarbital-induced spatial memory deficits and synaptic depression.
|
-
- HY-P4095
-
|
|
CXCR
|
Cancer
|
|
NoxaBH3 is a cysteine-based cross-linked peptide with increased cell permeability and higher inhibitory activity against Mcl-1. NoxaBH3 binds to the endogenous CXCR4 ligand to produce ubiquitin-Noxabh3 conjugate. NoxaBH3 is then delivered to cancer cells.
|
-
- HY-P2317A
-
|
|
Bacterial
Endogenous Metabolite
|
Infection
|
|
Cecropin P1, porcine acetate is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine acetate shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine acetate shows antiviral activity and inhibits PRRSV infection.
|
-
- HY-W027544
-
|
|
Fluorescent Dye
|
Others
|
|
MCA is a coumarin derivative. MCA quantitates platelet-activating factor by high-performance liquid chromatography with fluorescent detection. MCA can modify FRET peptide substrates for analyzing protease activities.
|
-
- HY-P1805
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
-
- HY-P1144
-
|
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
|
-
- HY-P1841
-
|
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
-
- HY-P2275B
-
-
- HY-P1376
-
|
|
mAChR
Adrenergic Receptor
|
Endocrinology
|
|
G-Protein antagonist peptide is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide competitively and reversibly inhibits M2 muscarinic receptor activation of Gi or Go and inhibits Gs activation by β-adrenoceptors.
|
-
- HY-P0215
-
|
|
CaMK
Autophagy
|
Neurological Disease
|
|
Autocamtide-2-related inhibitory peptide, myristoylated is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
|
-
- HY-P2491
-
|
|
Fluorescent Dye
|
Endocrinology
Cardiovascular Disease
|
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research.
|
-
- HY-P0215A
-
|
|
CaMK
Autophagy
|
Neurological Disease
|
|
Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
|
-
- HY-P1410
-
|
|
TRP Channel
Piezo Channel
|
Inflammation/Immunology
Neurological Disease
Cardiovascular Disease
|
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology.
|
-
- HY-P1186
-
|
Eledoisin-Related Peptide; Eledoisin RP
|
Neurokinin Receptor
|
Neurological Disease
|
|
Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
|
-
- HY-P1497
-
-
- HY-P3326
-
|
|
Bacterial
|
Infection
|
|
Targeting the bacterial sliding clamp peptide 46 is a short peptide targeting the bacterial sliding clamp(SC), inhibiting SC-dependent DNA synthesis.
|
-
- HY-P1144A
-
|
Glucagon-37 (bovine, porcine) (TFA)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin TFA, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist.
|
-
- HY-P1740
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
|
|
RGD peptide (GRGDNP) is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) plays an important role in cell adhesion, migration, growth, and differentiation.
|
-
- HY-P5205
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakA is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakB, and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS, GakA with GakB, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA.
|
-
- HY-P1021A
-
-
- HY-P5465
-
|
|
Bacterial
|
Others
|
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P2275
-
-
- HY-105066
-
|
|
Microtubule/Tubulin
Amyloid-β
|
Neurological Disease
|
|
Davunetide is an eight amino acid snippet derived from activity-dependent neuroprotective protein (ADNP), a neurotrophic factor that exists in the mammalian CNS. Davunetide possesses neuroprotective, neurotrophic and cognitive protective roperties. Davunetide, a microtubule-stabilizing peptide, interacts with and stabilises neuron-specific βIII-tubulin in vitro. Davunetide penetrates the blood-brain barrier and is non-toxic. Davunetide inhibits Aβ aggregation and Aβ-induced neurotoxicity.
|
-
- HY-P1115
-
|
|
Akt
|
Others
|
|
AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position.
|
-
- HY-P2264
-
|
|
Ephrin Receptor
|
Inflammation/Immunology
|
|
KYL peptide, an antagonistic peptide, selectively targets EphA4 receptor (IC50:4.22 μM, Kd:1.3 μM). KYL peptide binds to the ligand-binding domain of EphA4, effectively alleviates Aβ-induced synaptic dysfunction and synaptic plasticity defects in AD mice. KYL peptide can promote nerve regeneration after injury and modulating immune responses.
|
-
- HY-P2251
-
|
|
HIV
Microtubule/Tubulin
|
Cancer
Infection
Inflammation/Immunology
|
|
T-peptide, a Tuftsin analog, can be used for the research of human immunodeficiency virus (HIV) infection. T-peptide prevents cellular immunosuppression and improves survival rate in septic mice. T-peptide also can inhibit the growth of residual tumor cells after surgical resection.
|
-
- HY-P5329
-
|
|
NADPH Oxidase
|
Others
|
|
r8-Gly-Noxa A BH3 is a biological active peptide. (This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.)
|
-
- HY-P3710
-
|
|
Calcium Channel
|
Others
|
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization.
|
-
- HY-P5446
-
|
|
Bacterial
|
Others
|
|
BMAP-18 is a biological active peptide. (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the Cathelicidin family of peptides which displays rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at higher than microbicidal concentrations. BMAP-18 displays much higher cell selectivity as compared to parental BMAP-27 because of its decreased hemolytic activity and retained antimicrobial activity.)
|
-
- HY-N2466
-
|
MT-I; [Nle4,D-Phe7]-α-MSH
|
Melanocortin Receptor
|
Cancer
|
|
Melanotan I is a potent non-selective melanocortin receptor (MCR) agonist. Melanotan I is a synthetic analogue of α-melanocyte stimulating hormone (α-MSH) that stimulates melanogenesis. Melanotan I can induce skin tanning by mimicking the actions of a-MSH on the melanocortin type 1 receptors (MC1R) of melanocytes. Melanotan I can be used for sunlight-induced skin cancers research.
|
-
- HY-N6181
-
|
|
Others
|
Endocrinology
|
|
Terrelumamide A is a lumazine-containing peptide. Terrelumamide A is isolated from the culture broth of the marine-derived fungus Aspergillus terreus. Terrelumamide A exhibits pharmacological activity by improving insulin sensitivity. Terrelumamide A has the potential in the application of DNA sequence recognition.
|
-
- HY-N3997
-
|
|
Ser/Thr Protease
|
Cancer
Infection
Metabolic Disease
|
|
Nostosin G is a unique example of a linear peptide containing three subunits, 4-hydroxyphenyllactic acid (Hpla), homotyrosine (Hty), and argininal. Nostosin G has potent trypsin inhibitory property with an IC50 value of 0.1 μM.
|
-
- HY-P3560
-
|
TV 4710
|
Apoptosis
|
Inflammation/Immunology
|
|
Edratide (TV 4710) is a synthetic peptide of 19 amino acid based on the complementarity-determining region 1 (CDR1) of a human anti-DNA antibody that expresses a major idiotype denoted 16/6 Id. Edratide reduces the rates of apoptosis (Apoptosis) and down-regulates of caspase-8 and caspase-3, up-regulates Bcl-xL. Edratide has the potential for the research of systemic lupus erythematosus (SLE).
|
-
- HY-13545
-
|
|
Apoptosis
|
Cancer
Inflammation/Immunology
|
|
ABT-510 is an anti-angiogenic TSP peptide (Thrombospondin-1 analogue) that induces apoptosis and inhibits ovarian tumour growth in an orthotopic, syngeneic model of epithelial ovarian cancer. ABT-510 also reduces angiogenesis and inflammatory responses in a murine model of inflammatory bowel disease. ABT-510 can be used in studies of cancer (particularly epithelial ovarian cancer) and inflammatory bowel disease (IBD).
|
-
- HY-P1410A
-
|
|
TRP Channel
Piezo Channel
|
Inflammation/Immunology
Neurological Disease
Cardiovascular Disease
|
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology.
|
-
- HY-P5207
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA.
|
-
- HY-P1740A
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
RGD peptide (GRGDNP) TFA is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) TFA competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) TFA promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) TFA plays an important role in cell adhesion, migration, growth, and differentiation.
|
-
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
-
- HY-P0119A
-
|
|
GCGR
|
Metabolic Disease
|
|
Lixisenatide acetate is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
|
-
- HY-P4640
-
-
- HY-P0119
-
|
|
GCGR
|
Metabolic Disease
|
|
Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM).
|
-
- HY-P2519
-
-
- HY-P0141
-
|
|
Akt
|
Others
|
|
Akt/SKG Substrate Peptide is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or
MAPK1.
|
-
- HY-P3762
-
-
- HY-P1514
-
-
- HY-P3229
-
|
|
NF-κB
|
Cancer
|
|
SN52 is a potent, competitive, and cell-permeable inhibitor of NF-κB2. SN52 is a variant of the SN50 peptide and inhibits the nuclear translocation of p52-RelB heterodimers. SN52 has a strong radiosensitization effect on prostate cancer cells. SN52 can be used for cancer research.
|
-
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases.
|
-
- HY-P5422
-
|
|
Calcium Channel
|
Others
|
|
Caloxin 3A1 is a biological active peptide. (This peptide belongs to caloxins, the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP.)
|
-
- HY-P2468
-
|
BADBH3 103-127 (human); BADBH3 (human)
|
Bcl-2 Family
|
Cancer
|
|
BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL. BAD (103-127) (human) is reported to have almost 800-fold higher affinity for Bcl-XL than the 16-mer peptide.
|
-
- HY-P3709
-
|
|
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide is a specific TRAF6-p62 inhibitor. TRAF6 peptide potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke.
|
-
- HY-P3130
-
|
|
CRFR
|
Inflammation/Immunology
Neurological Disease
|
|
Stresscopin-related peptide (human) is a specific ligand for the type 2 CRH receptor. Stresscopin-related peptide (human) suppresses food intake, delayed gastric emptying and decreases heat-induced edema. Stresscopin-related peptide (human) maintains homeostasis after stress, and can be used in the research of stress-related diseases.
|
-
- HY-P99019
-
|
TEV-48125
|
CGRP Receptor
|
Neurological Disease
|
|
Fremanezumab (TEV-48125) is a humanized IgG2a monoclonal antibody that selectively and potently binds to calcitonin gene-related peptide (CGRP). CGRP is a 37-amino acid neuropeptide involved in central and peripheral pathophysiological events of migraine. Fremanezumab has the potential for chronic migraine research.
|
-
- HY-P1046
-
|
Amyloid β-Protein (1-15)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-15) is a fragment of β-Amyloid peptide. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P0141A
-
|
|
Akt
|
Others
|
|
Akt/SKG Substrate Peptide TFA is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or MAPK1.
|
-
- HY-P2519A
-
-
- HY-P5325F
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99), FAM labeled is a biological active peptide. (This is a 5-FAM-labeled Bid BH3 HY-P5325 peptide.)
|
-
- HY-P2538
-
-
- HY-P1085
-
|
|
EGFR
|
Cancer
|
|
Epidermal Growth Factor Receptor Peptide (985-996) is an amino acid peptide fragment derived from positions 985-996 in epidermal growth factor receptor (EGFR).
|
-
- HY-P2847
-
|
|
CRFR
|
Endocrinology
Metabolic Disease
|
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow.
|
-
- HY-P2294
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction.
|
-
- HY-P5169
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
LVGRQLEEFL (mouse) can be named as G * peptide, corresponding to amino acids 113 to 122 in apolipoprotein J ([113,122] apoJ)}. LVGRQLEEFL (mouse) exhibits anti-inflammatory and anti-atherogenic properties. LVGRQLEEFL (mouse) can be added to an apoJ mimetic, to form HM-10/10 peptide, which is a mimetic peptide and a novel chimeric high density lipoprotein. HM-10/10 peptide protects retinal pigment epithelium (RPE) and photoreceptors from oxidant induced cell death.
|
-
- HY-P4832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Acetyl-Tau Peptide (273-284) amide is an acetylated Tau peptide fragment. Acetyl-Tau Peptide (273-284) amide limits the substantial aggregation of Ac-Aβ(25–35)-NH2 and can be used as an inhibitor of Ac-Aβ(25–35)-NH2. Acetyl-Tau Peptide (273-284) amide can be used as an experimental model to investigate the Aβ/Tau cross-interaction .
|
-
- HY-P1083
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide blocks the dopamine D3 effect on GABAA receptors.
|
-
- HY-P5444
-
|
|
Bacterial
|
Others
|
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
-
- HY-151783A
-
|
|
ADC Linker
|
Others
|
|
DAPOA DCHA is a click chemistry reagent containing an azide. DAPOA DCHA can be used in peptide synthesis as a linker that can be further modified at the azido-groups using Staudinger ligation or click-chemistry. This material can be used as a building block for dendrimeric structures.
|
-
- HY-D0178
-
|
|
Biochemical Assay Reagents
|
Others
|
|
1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride is a carbodiimide reagent that can form nucleic acid and compounds with amide bonds. 1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride accelerates the formation reaction of esters, amides, and peptides, as a condensing and dehydrating agent, which are often used for polynucleotide synthesis, anhydroxydation, lactonization and esterification.
|
-
- HY-P0272
-
|
|
HIV
|
Infection
|
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-114118
-
|
|
GCGR
|
Metabolic Disease
|
|
Semaglutide, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide has the potential for type 2 diabetes treatment.
|
-
- HY-P5440
-
|
|
ERK
|
Others
|
|
ERKtide is a biological active peptide. (ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.)
|
-
- HY-P3709A
-
|
|
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide TFA is a specific TRAF6-p62 inhibitor. TRAF6 peptide TFA potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide TFA has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke.
|
-
- HY-P2268
-
|
|
Amyloid-β
|
Cancer
Inflammation/Immunology
|
|
RAGE antagonist peptide is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide (RAP) possesses anti-tumor and anti-inflammatory activities.
|
-
- HY-P5169A
-
|
|
Amino Acid Derivatives
|
Inflammation/Immunology
|
|
LVGRQLEEFL (mouse) TFA can be named as G * peptide, corresponding to amino acids 113 to 122 in apolipoprotein J ([113,122] apoJ)}. LVGRQLEEFL (mouse) TFA exhibits anti-inflammatory and anti-atherogenic properties. LVGRQLEEFL (mouse) TFA can be added to an apoJ mimetic, to form HM-10/10 peptide, which is a mimetic peptide and a novel chimeric high density lipoprotein. HM-10/10 peptide protects retinal pigment epithelium (RPE) and photoreceptors from oxidant induced cell death.
|
-
- HY-P5484
-
|
|
Bacterial
|
Others
|
|
SMAP-18 is a biological active peptide. (SMAP-18 is a 18-amino acid residue peptide amide which is a truncated form of SMAP-29. Sheep myeloid antimicrobial peptide-29 (SMAP-29) displays extremely high antimicrobial activity against Pseudomonas strains, other Gram-negative bacteria, and multidrug-resistant pathogens. SMAP-18 displays much higher cell selectivity as compared to parental SMAP-29 because of its decreased hemolytic activity and retained antimicrobial activity.)
|
-
- HY-P2294A
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 TFA peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide TFA shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide TFA displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction.
|
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P3981
-
-
- HY-129271
-
|
Deltorphin A; Dermenkephalin
|
Opioid Receptor
|
Others
|
|
Deltorphin (Deltorphin A; Dermenkephalin) is a biological active peptide. (Deltorphin A peptide was isolated from skin extracts of the South American frog, Phyllomedusa sauvagei. Deltorphin A is a potent and selective agonist for the delta-opioid receptor.)
|
-
- HY-P0272A
-
|
|
HIV
|
Infection
|
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-P3991
-
-
- HY-P0144
-
|
|
Apoptosis
|
Inflammation/Immunology
|
|
Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide.
|
-
- HY-P1083A
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors.
|
-
- HY-P3383
-
|
PL-5
|
Bacterial
|
Infection
|
|
Peceleganan (PL-5) is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan inhibits wound infection.
|
-
- HY-P3383A
-
|
PL-5 acetate
|
Bacterial
|
Infection
|
|
Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection.
|
-
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-15407B
-
|
AHU-377 sodium
|
Neprilysin
|
Infection
Cardiovascular Disease
|
|
Sacubitril sodium is a potent and orally active NEP (neprilysin) inhibitor, with an IC50 of 5 nM. Sacubitril sodium enhances the tone of the natriuretic peptide (NP) system and exerts significant antihypertensive effects. Sacubitril sodium is a component of the heart failure medicine LCZ696. Sacubitril sodium can be used for the research of heart failure, hypertension and COVID-19.
|
-
- HY-125586
-
|
|
DNA/RNA Synthesis
ADC Cytotoxin
|
Cancer
|
|
β-Amanitin is a cyclic peptide toxin in the poisonous Amanita phalloides mushroom. β-Amanitin inhibits inhibits eukaryotic RNA polymerase II and III. β-Amanitin inhibits protein synthesis. β-Amanitin can be used as a cytotoxic component of antibody-drug conjugates (ADCs).
|
-
- HY-P1626
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway.
|
-
- HY-P1376A
-
|
|
mAChR
Adrenergic Receptor
|
Endocrinology
|
|
G-Protein antagonist peptide TFA is a truncated substance P-related peptide, competes with receptor for G protein binding. G-Protein antagonist peptide TFA inhibits the activation of Gi or Go by M2 muscarinic cholinergic receptor (M2 mAChR) or of Gs by beta-adrenergic receptor in the reconstituted phospholipid vesicles, assayed by receptor-promoted GTP hydrolysis.
|
-
- HY-P2268A
-
|
|
Amyloid-β
|
Cancer
Inflammation/Immunology
|
|
RAGE antagonist peptide TFA is an advanced glycation end products (RAGE) antagonist. RAGE antagonist peptide TFA prevents RAGE from binding with several of its most important ligands, including HMGB-1, S100P, and S100A4. RAGE antagonist peptide TFA possesses anti-tumor and anti-inflammatory activities.
|
-
- HY-114424A
-
-
- HY-114118A
-
|
|
GCGR
|
Metabolic Disease
|
|
Semaglutide TFA, a long-acting GLP-1 analogue, is a glucagon-like peptide-1 (GLP-1) receptor agonist. Semaglutide TFA has the potential for type 2 diabetes treatment.
|
-
- HY-P2466
-
|
|
Apoptosis
|
Cancer
|
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models.
|
-
- HY-114424
-
-
- HY-P1399
-
|
Myr-Pep2m
|
PKC
|
Neurological Disease
|
|
Pep2m, myristoylated (Myr-Pep2m) is a cell-permeable peptide. Pep2m, myristoylated can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC).
|
-
- HY-P1231
-
-
- HY-P1246
-
-
- HY-P1229
-
-
- HY-13259
-
MG-132
Maximum Cited Publications
728 Publications Verification
Z-Leu-Leu-Leu-al; MG132
|
Proteasome
Autophagy
Apoptosis
|
Cancer
|
|
MG-132 (Z-Leu-Leu-Leu-al) is a potent proteasome and calpain inhibitor with IC50s of 100 nM and 1.2 μM, respectively. MG-132 effectively blocks the proteolytic activity of the 26S proteasome complex. MG-132, a peptide aldehyde, also is an autophagy activator. MG-132 also induces apoptosis.
|
-
- HY-P3944
-
|
|
CaMK
|
Neurological Disease
|
|
Calmodulin Dependent Protein Kinase Substrate is a Ca 2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate is a synthetic peptide substrate for protein kinases.
|
-
- HY-P1731B
-
|
LY3298176 hydrochloride
|
GLP Receptor
|
Metabolic Disease
|
|
Tirzepatide hydrochloride (LY3298176 hydrochloride) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes.
|
-
- HY-P1495
-
-
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases.
|
-
- HY-P5469
-
|
|
Formyl Peptide Receptor (FPR)
|
Others
|
|
WRW4-OH is a biological active peptide. (This peptide inhibits binding of one of formyl peptide receptor-like 1 (FPRL1) agonists WKYMVm to its specific receptor. FPRL1 is an important classical chemoattractant receptor that is expressed in phagocytic cells in the peripheral blood and brain. Activation of FPRL1 is closely related to inflammatory responses in the host defense mechanism and neurodegenerative disorders.)
|
-
- HY-15940
-
|
5(6)-FAM; 5-(and-6)-Carboxyfluorescein mixed isomers
|
Fluorescent Dye
|
Cancer
|
|
5(6)-Carboxyfluorescein (5(6)-FAM) is an amine-reactive pH-sensitive green fluorescent probe. 5(6)-Carboxyfluorescein (5(6)-FAM) can be used to label proteins, peptides and nucleotides. 5(6)-Carboxyfluorescein can be used for the detection of tumour areas in vivo.
|
-
- HY-103539
-
|
|
γ-secretase
|
Metabolic Disease
|
|
3,5-Bis(4-nitrophenoxy)benzoic acid is an inhibitor of γ-secretase. 3,5-Bis(4-nitrophenoxy)benzoic acid causes a decrease in the released levels of Aβ42 and notch-1 Aβ-like peptide 25 (Nβ25). 3,5-Bis(4-nitrophenoxy)benzoic acid, as a marker for fetal hypothyroidism, is a 3,3’-diiodothyronine sulfate (T2S) cross-reactive material in maternal serum.
|
-
- HY-P1345
-
|
|
Complement System
|
Endocrinology
Neurological Disease
|
|
TLQP-21, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor 1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8 μM). TLQP-21 activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 is used for the research in regulation of nociception and other relevant physiologic functions.
|
-
- HY-P4157
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells.
|
-
- HY-P4157A
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells.
|
-
- HY-P0224
-
|
fMLP; N-Formyl-MLF
|
TNF Receptor
|
Inflammation/Immunology
|
|
N-Formyl-Met-Leu-Phe (fMLP; N-Formyl-MLF) is a chemotactic peptide and a specific ligand of N-formyl peptide receptor (FPR). N-Formyl-Met-Leu-Ph is reported to inhibit TNF-alpha secretion.
|
-
- HY-P4779
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (2-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor.
|
-
- HY-P5437
-
|
|
PKC
|
Others
|
|
PKCε (85-92) is a biological active peptide. (This peptide is the e-PKC specific activator, it also activates MARCKS phosphorylation in wild type cells, and has no effect on MARCKS phosphorylation in the cells derived from knockout mice.)
|
-
- HY-P2319
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes.
|
-
- HY-P4782
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (3-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor.
|
-
- HY-P4784
-
|
|
Androgen Receptor
|
Neurological Disease
|
|
Acetyl-ACTH (4-24) (human, bovine, rat) is a fragment of proopiomelanocortin (POMC) peptide. POMC peptides such as adrenocorticotrophin (ACTH), which is the precursor of α-MSH, is also an agonist at the MC-1 receptor.
|
-
- HY-P0290
-
GRGDSP
3 Publications Verification
|
Integrin
|
Cancer
|
|
GRGDSP, a synthetic linear RGD peptide, is an integrin inhibitor.
|
-
- HY-P1063
-
-
- HY-P0175A
-
|
740YPDGFR TFA; PDGFR 740Y-P TFA
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.
|
-
- HY-P5155
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats.
|
-
- HY-P2319A
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide TFA, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes.
|
-
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases.
|
-
- HY-P1247
-
|
|
Phosphatase
|
Neurological Disease
|
|
Calcineurin autoinhibitory peptide is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide could protect neurons from excitatory neuronal death.
|
-
- HY-P1731A
-
|
LY3298176 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Tirzepatide TFA (LY3298176 TFA) is a dual glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor agonist that is being developed for the treatment of type 2 diabetes.
|
-
- HY-P1807
-
|
|
Histamine Receptor
|
Inflammation/Immunology
|
|
Mast Cell Degranulating Peptide HR-2, a 14-membered linear peptide isolated from the venom of the giant hornet Vespa orientalis, is capable of degranulating mast cells and thus initiating histamine release.
|
-
- HY-P3943
-
|
|
CaMK
|
Neurological Disease
|
|
Calmodulin Dependent Protein Kinase Substrate Analog is a Ca 2+- and calmodulin (CaM)-dependent protein kinase (CaMK) substrate peptide. Calmodulin Dependent Protein Kinase Substrate Analog is a synthetic peptide substrate for protein kinases.
|
-
- HY-P3245
-
|
|
Apoptosis
|
Cancer
|
|
HXR9 is a cell-permeable peptide and a competitive antagonist of HOX/PBX interaction. HXR9 antagonizes the interaction between HOX and a second transcrip-tion factor (PBX), which binds to HOX proteins in paralogue groups1 to 8. HXR9 selectively decreases cell proliferation and promotes apoptosis in cells with a high level of expression of the HOXA/PBX3 genes, such as MLL-rearranged leukemic cells.
|
-
- HY-P1399A
-
|
Myr-Pep2m TFA
|
PKC
|
Neurological Disease
|
|
Pep2m, myristoylated TFA (Myr-Pep2m TFA) is a cell-permeable peptide. Pep2m, myristoylated TFA can disrupt the protein kinase ζ (PKMζ) downstream targets, N-ethylmaleimide-sensitive factor/glutamate receptor subunit 2 (NSF/GluR2) interactions. PKMζ is an autonomously active isozyme of protein kinase C (PKC).
|
-
- HY-P3245A
-
|
|
Apoptosis
|
Cancer
|
|
HXR9 hydrochloride is a cell-permeable peptide and a competitive antagonist of HOX/PBX interaction. HXR9 hydrochloride antagonizes the interaction between HOX and a second transcrip-tion factor (PBX), which binds to HOX proteins in paralogue groups1 to 8. HXR9 hydrochloride selectively decreases cell proliferation and promotes apoptosis in cells with a high level of expression of the HOXA/PBX3 genes, such as MLL-rearranged leukemic cells.
|
-
- HY-126810
-
|
|
Fungal
|
Infection
|
|
NP213 is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide (AMP), has anti-fungal activities. NP213 targets the fungal cytoplasmic membrane and plays it role via membrane perturbation and disruption. NP213 is effective and well-tolerated in resolving nail fungal infections.
|
-
- HY-130994
-
|
|
NF-κB
ADC Cytotoxin
|
Cancer
Inflammation/Immunology
|
|
Aeruginosin 865, isolated from terrestrial cyanobacterium Nostoc sp. Lukešová 30/93, is the first aeruginosin-type peptide containing both a fatty acid and a carbohydrate moiety. Aeruginosin 865 inhibits translocation of NF-kB to the nucleus. Aeruginosin 865 has anti-inflammatory effect
|
-
- HY-P3904
-
|
|
Biochemical Assay Reagents
|
Others
|
|
P34cdc2 Kinase Substrate Peptide is a synthetic peptide substrates for P34 cdc2 kinase, with a Km of 74 μM for the purified human enzyme. P34cdc2 Kinase Substrate Peptide can be used in a rapid assay of P34 cdc2 phosphorylation in vitro. P34 cdc2, a protein serinehhreonine kinase, is a cell division cycle-regulated protein kinase.
|
-
- HY-P1195
-
|
|
iGluR
|
Neurological Disease
|
|
PDZ1 Domain inhibitor peptide, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). PDZ1 Domain inhibitor peptide disrupts the GluR6/PSD-95 interaction and is very efficient in competing against the C terminus of GluR6 for the PDZ1 domain.
|
-
- HY-106975
-
|
|
Neprilysin
|
Cardiovascular Disease
|
|
SCH-42354 is a potent, orally active neutral endopeptidase (NEP) inhibitor, is the pharmacologically active form of the proagent SCH-42495. SCH-42354 inhibits the hydrolysis of NEP to enhance the activity of atrial natriuretic peptide (ANP). SCH-42354 inhibits hydrolysis of leu-enkephalin and ANF with IC50 values of 8.3 nM and 10.0 nM, respectively. SCH-42354 has antihypertensive activity.
|
-
- HY-P1345A
-
|
|
Complement System
|
Endocrinology
Neurological Disease
|
|
TLQP-21 TFA, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8μM). TLQP-21 TFA activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 TFA is used for the research in regulation of nociception and other relevant physiologic functions.
|
-
- HY-P1889
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
|
-
- HY-P1872
-
|
|
Bacterial
|
Infection
|
|
OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa.
|
-
- HY-P3838
-
|
|
PKC
|
Others
|
|
Protein Kinase C γ Peptide is a peptide fragment of Protein Kinase Cγ. Protein Kinase Cγ is a protein causative for dominant ataxia, that can negatively regulate nuclear import of recessive-ataxia-related aprataxin.
|
-
- HY-D1596
-
|
Cy3.5 NHS ester chloride; Cy 3.5 chloride
|
Fluorescent Dye
|
Others
|
|
Cyanine 3.5 (Cy3.5 NHS ester) chloride is an analog of Cy3.5 fluorophore. Cyanine 3.5 chloride is a reactive, red fluorescent dye. Cyanine 3.5 chloride is used for labeling of amino-groups in peptides, proteins, and oligonucleotides. (λex=591 nm, λem=604 nm).
|
-
- HY-P5523
-
-
- HY-P1063A
-
-
- HY-106225
-
|
ZP123
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Rotigaptide (ZP123) is a novel and specific modulator of connexin 43 (Cx43). Rotigaptide prevents the uncoupling of Cx43-mediated gap junction communication and normalizes cell-to-cell communication during acute metabolic stress. Rotigaptide is a potent antiarrhythmic peptide (AAP) with improved stability and has the potential for the investigation of cardiac arrhythmias-specifically atrial fibrillation.
|
-
- HY-13222
-
|
|
Opioid Receptor
|
Cancer
Neurological Disease
|
|
BAN ORL 24 is a nociceptin/orphanin FQ (N/OFQ) peptide receptor (NOP) antagonist. BAN ORL 24 has antagonistic effect for nociceptin (NOP) receptor with KI value of 0.24 nM in CHO cell. BAN ORL 24 can be used for the research of cancer and analgesic.
|
-
- HY-P1247A
-
|
|
Phosphatase
|
Neurological Disease
|
|
Calcineurin autoinhibitory peptide TFA is a selective inhibitor of Ca 2+/calmodulin-dependent protein phosphatase (calcineurin), with an IC50 of ~10 μM. Calcineurin autoinhibitory peptide TFA could protect neurons from excitatory neuronal death.
|
-
- HY-P0128
-
|
Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells.
|
-
- HY-P1889A
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV TFA is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins.
|
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research.
|
-
- HY-P0322
-
|
EMD 56574
|
Integrin
|
Metabolic Disease
Cardiovascular Disease
|
|
GRGDSPK (EMD 56574) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK (EMD 56574) is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK is used to study the role of integrins in bone formation and resorption.
|
-
- HY-P1230
-
|
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity.
|
-
- HY-P5506
-
|
|
Complement System
|
Others
|
|
C5a Receptor agonist, mouse, human is a biological active peptide. (This peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions as a C5a receptor agonist. C5a is a plasma protein involved in cellular inflammatory processes by inducing chemotaxis, degranulation of leukocytes, increased vascular permeability, and cytokine production. The cyclohexylalanine at position 5 is crucial to agonist function. Arg at the last position is of the d-isomer.)
|
-
- HY-P1195A
-
|
|
iGluR
|
Neurological Disease
|
|
PDZ1 Domain inhibitor peptide TFA, a cyclic peptide, incorporates a β-Ala lactam side chain linker and targets the PDZ1 domains of the postsynaptic density protein 95 (PSD-95). PDZ1 Domain inhibitor peptide TFA disrupts the GluR6/PSD-95 interaction and is very efficient in competing against the C terminus of GluR6 for the PDZ1 domain.
|
-
- HY-P1821A
-
|
MHP4-14 TFA
|
PKC
|
Neurological Disease
|
|
Myelin Basic Protein (MHP4-14) TFA, a synthetic peptide comprising residues 4-14 of myelin basic protein, is a very selective PKC substrate (Km=7 μM). Myelin Basic Protein TFA is not phosphorylated by cyclic AMP-dependent protein kinase, casein kinases I and II, Ca 2+/calmodulin-dependent protein kinase II, or phosphorylase kinase, and can be routinely used for the assay of protein kinase C with low background in the crude tissue extracts.
|
-
- HY-P1418
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 in ex vivo and in vivo assays of bone resorption.
|
-
- HY-P3892
-
|
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-35) Peptide is the PKC pseudosubstrate inhibitor/region. Protein Kinase C (19-35) Peptide possibly blocks the substrate-binding site in its kinase domain, makes the cytoplasmic form of PKC inactive.
|
-
- HY-P1362
-
|
Amyloid β Peptide (42-1)(human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
|
-
- HY-P1755F
-
-
- HY-P0080
-
-
- HY-P5379
-
|
|
Proteasome
|
Others
|
|
Calpastatin subdomain B is a biological active peptide. (inhibit calpain activity)
|
-
- HY-P1000
-
-
- HY-P0136
-
SAMS
2 Publications Verification
|
AMPK
|
Metabolic Disease
|
|
SAMS peptide is a specific substrate for the AMP-activated protein kinase (AMPK).
|
-
- HY-P1522
-
-
- HY-W008922
-
-
- HY-P0030
-
-
- HY-14743B
-
|
SCV 07 hydrochloride; Gamma-D-glutamyl-L-tryptophan hydrochloride
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod hydrochloride (SCV 07 hydrochloride), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod hydrochloride (SCV 07 hydrochloride) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod hydrochloride (SCV 07 hydrochloride) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2).
|
-
- HY-P0322A
-
|
EMD 56574 TFA
|
Integrin
|
Metabolic Disease
Cardiovascular Disease
|
|
GRGDSPK TFA (EMD 56574 TFA) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK TFA is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK TFA is used to study the role of integrins in bone formation and resorption.
|
-
- HY-P1418A
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 TFA in ex vivo and in vivo assays of bone resorption.
|
-
- HY-P1362A
-
|
Amyloid β Peptide (42-1)(human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (42-1), human TFA is the inactive form of Amyloid β Peptide (1-42). β-Amyloid (42-1), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease.
|
-
- HY-P3766
-
|
|
PKC
|
Others
|
|
Protein kinase C α peptide (TFA) is a peptide of PKC-α. PKC-α acts as a lipid-dependent ser/thr protein kinase, can modulate various cellular processes, including cell survival, proliferation, differentiation, migration, adhesion and so on.
|
-
- HY-P5341
-
-
- HY-P1860
-
-
- HY-P0080A
-
-
- HY-P0261
-
|
|
Bacterial
|
Infection
|
|
Indolicidin is a potent antimicrobial peptide purified from the cytoplasmic granules of bovine neutrophils.
|
-
- HY-P1880
-
-
- HY-P0241
-
-
- HY-P1875A
-
-
- HY-15664
-
-
- HY-P0191
-
-
- HY-P1891
-
-
- HY-P0163
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Gramicidin is an antimicrobial peptide assembling as channels in membranes and increasing their permeability towards cations.
|
-
- HY-P1595
-
|
|
PKA
|
Metabolic Disease
|
|
CREBtide, a synthetic 13 amino acid peptide, has been reported as a PKA substrate.
|
-
- HY-P5443
-
|
|
Bacterial
|
Others
|
|
Pyrrhocoricin is a biological active peptide. (Antimicrobial activity against Gram-negative bacteria)
|
-
- HY-P1879
-
-
- HY-P1255
-
-
- HY-P0300F
-
-
- HY-P5342
-
-
- HY-P1893
-
-
- HY-15580
-
-
- HY-P1174
-
|
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (1-13), human is an amino acid peptide fragment derived from GnRH. GAP can increase the secretion of luteinizing hormone (LH) and follicle-stimulating hormone (FSH) in rat anterior pituitary cells. GAP also inhibit the secretion of prolactin.
|
-
- HY-P1753
-
|
|
HIV
|
Infection
|
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains.
|
-
- HY-P5158
-
|
|
Adrenergic Receptor
|
Others
|
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs.
|
-
- HY-114782
-
|
L-Tyrosyl-L-tyrosine
|
Angiotensin-converting Enzyme (ACE)
|
Cardiovascular Disease
|
|
H-Tyr-Tyr-OH (L-Tyrosyl-L-tyrosine) is an antihypertensive peptide. H-Tyr-Tyr-OH inhibits angiotensin I-converting enzyme (ACE) with an IC50 value of 0.028 mg/mL. H-Tyr-Tyr-OH can be used for the research of high blood pressure.
|
-
- HY-P1401
-
|
|
PKC
|
Metabolic Disease
|
|
Protein Kinase C (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (PKC), with an IC50 of 0.18 μM. Protein Kinase C (19-36) markedly attenuated vascular hyperproliferation and hypertrophy as well as glucose-induced suppression of natriuretic peptide receptor response.
|
-
- HY-P0078
-
TRAP-6
2 Publications Verification
PAR-1 agonist peptide; Thrombin Receptor Activator Peptide 6
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
TRAP-6 (PAR-1 agonist peptide), a peptide fragment, is a selective protease activating receptor 1 (PAR1) agonist. TRAP-6 activates human platelets via the thrombin receptor. TRAP-6 shows no activity at PAR4.
|
-
- HY-P1224
-
-
- HY-P5360
-
-
- HY-P5328
-
-
- HY-P0304
-
|
|
Influenza Virus
|
Infection
|
|
CEF4 is a peptide that corresponds to aa 342-351 of the influenza A virus nucleocapsid protein.
|
-
- HY-P1228
-
-
- HY-P1223
-
-
- HY-P0191A
-
-
- HY-P0092
-
-
- HY-P1013A
-
-
- HY-P1226
-
|
|
GCGR
|
Metabolic Disease
|
|
HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner
|
-
- HY-P3841
-
|
|
PKC
|
Others
|
|
Protein Kinase C β Peptide is a peptide fragment of Protein Kinase Cβ. Protein Kinase Cβ is related with hyperglycemia decreases endothelium-derived nitric oxide. Inhibition of Protein kinase Cβ prevents the reduction in endothelium-dependent vasodilation induced by acute hyperglycemia.
|
-
- HY-P3689
-
|
|
CGRP Receptor
Adenylate Cyclase
|
Others
|
|
[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat is a fragments 22-37 of rat calcitonin gene related peptide (CGRP), targeting CGRP receptor and adenylate cyclase. Calcitonin is mainly produced by thyroid C cells while CGRP is secreted and stored in the nervous system.
|
-
- HY-P3577
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
[Tyr0] Gastric Inhibitory Peptide (23-42), human, a glucose-dependent insulinotropic polypeptide (GIP), is a weak inhibitor of gastric acid secretion that also stimulates insulin secretion. [Tyr0] Gastric Inhibitory Peptide (23-42), human can be used in diabetes, obesity research.
|
-
- HY-P3994
-
-
- HY-P0052A
-
|
T20 acetate; DP178 acetate
|
HIV
|
Infection
|
|
Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P1867
-
-
- HY-P1331
-
-
- HY-P1560
-
|
Lysozyme C (46-61) (chicken)
|
Bacterial
|
Infection
|
|
Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
|
-
- HY-P3783
-
-
- HY-131095
-
-
- HY-P5330
-
-
- HY-P1774
-
|
|
HBV
|
Infection
|
|
Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
|
-
- HY-P0317
-
-
- HY-14743A
-
|
SCV 07 TFA; Gamma-D-glutamyl-L-tryptophan TFA
|
Bacterial
STAT
|
Infection
Inflammation/Immunology
Cancer
|
|
Golotimod TFA (SCV 07 TFA), an immunomodulating peptide with antimicrobial activity, significantly increases the efficacy of antituberculosis therapy, stimulates thymic and splenic cell proliferation, and improves macrophage function. Golotimod TFA (SCV 07 TFA) inhibits STAT3 signaling and modulates the duration and severity of oral mucositis in animal models that received radiation or a combination of radiation and Cisplatin. Golotimod TFA (SCV 07 TFA) is also a potential therapeutic for recurrent genital herpes simplex virus type 2 (HSV-2).
|
-
- HY-P1047
-
|
[Pro18, Asp21] β-Amyloid (17-21)
|
Amyloid-β
|
Neurological Disease
|
|
β-Sheet Breaker Peptide iAβ5 is a potent degrader of cerebral amyloid-beta (Abeta). Abeta deposition is associatied with the Alzheimer disease (AD), due to its related toxicity linked to its beta-sheet conformation and/or aggregation. β-Sheet Breaker Peptide iAβ5 reproducibly induces in vivo disassembly of fibrillar amyloid deposits. Thus, β-Sheet Breaker Peptide iAβ5 prevents and/or reverses neuronal shrinkage caused by Abeta, and reduces the extent of interleukin-1beta positive microglia-like cells that surround the Abeta deposits. β-Sheet Breaker Peptide iAβ5 reduces the size and/or number of cerebral amyloid plaques in AD. β-Sheet Breaker Peptide iAβ5 labeled by hydrophobic benzyl alcohol (HBA) tag, can be used for quantitative assay by showing vivid blue color under acidic conditions.
|
-
- HY-P0245
-
-
- HY-P2559
-
|
|
CDK
|
Cancer
|
|
CDK7/9 tide is peptide substrate for CDK7 or CDK9.
|
-
- HY-P3887
-
-
- HY-P1895
-
-
- HY-P4146
-
-
- HY-P1903
-
-
- HY-P1541
-
|
Motilin (canine)
|
Motilin Receptor
|
Metabolic Disease
|
|
Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
|
-
- HY-P1579
-
|
|
HIV
|
Infection
|
|
TAT 2-4 is a peptide derived from HIV-1 transactivator of transcription (Tat) protein.
|
-
- HY-P3388
-
-
- HY-P1898
-
-
- HY-P5327
-
|
|
Bcl-2 Family
|
Others
|
|
r8 Bid BH3 is a biological active peptide. (The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.)
|
-
- HY-14174
-
|
|
γ-secretase
|
Cancer
Neurological Disease
|
|
MRK-560 is an orally active, brain barrier-penetrating γ-Secretase inhibitor, can potently reduces Aβ peptide in rat brain and cerebrospinal fluid. MRK-560 also decreases mutant NOTCH1 processing by selectively inhibiting PSEN1. MRK-560 can be used in studies of Alzheimer's disease and T-cell acute lymphoblastic leukaemia (T-ALL).
|
-
- HY-P0175
-
|
740YPDGFR; PDGFR 740Y-P
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P (740YPDGFR; PDGFR 740Y-P) is a potent and cell-permeable PI3K activator. 740 Y-P readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone.
|
-
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB.
|
-
- HY-P1884
-
|
|
Bacterial
|
Infection
|
|
LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on the N-terminus and amidated on the C-terminus. The single human cathelicidin peptide LL-37 has antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host.
|
-
- HY-P4106A
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD).
|
-
- HY-P5486
-
|
|
Bacterial
|
Others
|
|
Tet-20 is a biological active peptide. (Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cells)
|
-
- HY-P0214
-
-
- HY-P1524
-
-
- HY-P1521
-
|
Beta-Amyloid (15-21)
|
Amyloid-β
|
Neurological Disease
|
|
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
|
-
- HY-P1576A
-
|
|
AMPK
|
Others
|
|
AMARA peptide (TFA) is a substrate for salt-inducible kinase (SIK) and adenosine monophosphate activated protein kinase (AMPK).
|
-
- HY-P4420
-
-
- HY-P3366
-
-
- HY-P1510
-
-
- HY-P0212
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion.
|
-
- HY-P5336
-
-
- HY-P1580
-
|
|
Influenza Virus
|
Infection
|
|
PA (224-233), Influenza is a 10-aa peptide, a fragment of polymerase 2 protein in influenza A virus.
|
-
- HY-P1484
-
-
- HY-P1062
-
-
- HY-P1751
-
|
|
Bacterial
|
Infection
|
|
Ceratotoxins B is antibacterial peptide produced by the sexually mature females of Ceratitis capitata. Lytic and antibacterial activity .
|
-
- HY-P1517
-
-
- HY-P1448
-
-
- HY-P1117
-
|
|
Formyl Peptide Receptor (FPR)
Calcium Channel
|
Inflammation/Immunology
Neurological Disease
|
|
MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity.
|
-
- HY-P0212A
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion.
|
-
- HY-P1593
-
-
- HY-P0291
-
|
|
PKA
|
Others
|
|
Kemptide (Phospho-Ser5) is a phosphate acceptor peptide that serves as a specific substrate for cAMP-dependent protein kinase (PKA).
|
-
- HY-P1145A
-
|
HuGLP-1 TFA
|
GCGR
|
Metabolic Disease
|
|
Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.
|
-
- HY-P4803
-
-
- HY-P1014
-
-
- HY-P1334A
-
-
- HY-P1581
-
|
|
Bacterial
|
Infection
|
|
Ceratotoxin A, a 29-residue peptide isolated from the accessory gland secretion fluid, with strong anti-bacterial activity.
|
-
- HY-P2549
-
-
- HY-P5522
-
|
L-Ala-γ-D-Glu-meso-diaminopimelic acid
|
NOD-like Receptor (NLR)
|
Others
|
|
TriDAP (L-Ala-γ-D-Glu-meso-diaminopimelic acid) is a biological active peptide. (specific Nod1 activator)
|
-
- HY-P2392
-
-
- HY-41912B
-
|
Boc-D-Nle-OH; N-BOC-D-norleucine
|
Amino Acid Derivatives
|
Others
|
|
Boc-D-norleucine (Boc-D-Nle-OH) is a leucine derivative that can be used for peptide synthesis.
|
-
- HY-P0214A
-
-
- HY-P1032
-
|
|
Endogenous Metabolite
|
Others
|
|
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).
|
-
- HY-P1062A
-
-
- HY-P0315
-
|
|
Akt
|
Others
|
|
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
|
-
- HY-P1490
-
-
- HY-P4036
-
|
|
HCV
|
Infection
|
|
HCV Core Protein (59-68) is a peptide containing residues 59-68 of the HCV core protein.
|
-
- HY-P3590
-
|
|
HCV
|
Others
|
|
PQDVKFP is a synthetic peptide, recognizing antigenic domains within the hepatitis C virus (HCV) core protein.
|
-
- HY-P0173A
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P1572
-
|
|
Renin
|
Inflammation/Immunology
|
|
Handle region peptide, rat is a prorenin receptor antagonist, suppresses the progression of diabetic nephropathy and has anti-inflammatory in the eye.
|
-
- HY-P1117A
-
|
|
Formyl Peptide Receptor (FPR)
Calcium Channel
|
Inflammation/Immunology
Neurological Disease
|
|
MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC50s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity.
|
-
- HY-119640
-
-
- HY-P1088
-
|
|
PKC
|
Others
|
|
[Ser25] Protein Kinase C (19-31) is a substrate of protein kinase C (PKC) (Km: 0.3 μM). [Ser25] Protein Kinase C (19-31) is derived from the pseudo-substrate regulatory domain of PKCα (19-31) with a Serine at position 25 replacing the wild-type Alanine.
|
-
- HY-P3558
-
-
- HY-P1141A
-
|
|
GCGR
|
Metabolic Disease
|
|
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor.
|
-
- HY-P2230
-
|
A6 Peptide
|
PAI-1
|
Cancer
|
|
Angstrom6 (A6 Peptide) is an 8 amino-acid peptide derived from single-chain urokinase plasminogen activator (scuPA) and interferes with the uPA/uPAR cascade and abrogates downstream effects. Angstrom6 binds to CD44 resulting in the inhibition of migration, invasion, and metastasis of tumor cells, and the modulation of CD44-mediated cell signaling.
|
-
- HY-P5287
-
|
|
Integrin
|
Cancer
|
|
cRGDfK-thioacetyl ester is a bioactive polypeptide molecule. It is composed of several amino acid residues, including cysteine (C), arginine (R), glycine (G), aspartic acid (D), phenylalanine (F), and lysine (K). This polypeptide has a specific sequence, called "cRGDfK". cRGDfK peptide has a selective affinity for integrins. cRGDfK peptide can modify NIR fluorescent probes for cancer targeting imaging.
|
-
- HY-P4882
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.
|
-
- HY-P5480
-
|
|
Keap1-Nrf2
|
Others
|
|
Keap1-Nrf2-IN-16 is a biological active peptide. (KEAP1 binding activity)
|
-
- HY-P0081
-
|
BIP-V5; BAX Inhibiting Peptide V5
|
Bcl-2 Family
Apoptosis
|
Cancer
|
|
Bax inhibitor peptide V5 (BIP-V5) is a Bax-mediated apoptosis inhibitor, used for cancer treatment.
|
-
- HY-P0228
-
|
|
Autophagy
|
Neurological Disease
|
|
Calcineurin substrate is a peptide from the regulatory RII subunit of cAMP-dependent protein kinase. It can be used in the calcineurin activity assay.
|
-
- HY-P1053
-
-
- HY-P1452A
-
|
|
Bacterial
|
Infection
|
|
RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
|
-
- HY-P3657A
-
|
|
Fluorescent Dye
|
Cancer
|
|
Biotin-KKKRKV acetate is the biotinylated KKKRKV acetate. KKKRKV is a nuclear localization signal (NLS) peptide derived from simian virus 40.
|
-
- HY-P0250
-
-
- HY-79404A
-
|
|
Amino Acid Derivatives
|
Others
|
|
Boc-beta-t-butyl-d-alanine is an intermediate, can be used in the synthesis of peptides and other amino acids.
|
-
- HY-P4071
-
|
Cathelicidin-OH antimicrobial peptide
|
Bacterial
|
Infection
|
|
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra).
|
-
- HY-P1034
-
DAPTA
1 Publications Verification
D-Ala-peptide T-amide; Adaptavir
|
CCR
HIV
|
Infection
Endocrinology
|
|
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
|
-
- HY-P2416
-
-
- HY-P1592
-
|
|
Galectin
|
Cancer
|
|
G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
-
- HY-P1593A
-
-
- HY-P1097
-
-
- HY-13948
-
|
Angiotensin II; Ang II; DRVYIHPF
|
Angiotensin Receptor
Apoptosis
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway.
|
-
- HY-P3375
-
|
IBI-362; LY-3305677; OXM-3
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Mazdutide (IBI-362; LY-3305677) is a long-acting synthetic oxyntomodulin analog. Mazdutide is also a glucagon-like peptide-1 (GLP-1R)/glucagon receptor GCGR co-agonist. Mazdutide has safety and tolerability, and it can be used for research in obesity and type 2 diabetes (T2D).
|
-
- HY-P4882A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.
|
-
- HY-P3375A
-
|
IBI-362 TFA; LY-3305677 TFA; OXM-3 TFA
|
GCGR
GLP Receptor
|
Metabolic Disease
|
|
Mazdutide (IBI-362; LY-3305677) TFA is an glucagon-like peptide-1 (GLP-1R)/glucagon receptor GCGR co-agonist, and a long-acting synthetic oxyntomodulin analog. Mazdutide TFA has safety and tolerability, and it can be used for research in obesity and type 2 diabetes (T2D).
|
-
- HY-P2612
-
|
|
TNF Receptor
|
Others
|
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
- HY-P1164
-
-
- HY-P5383
-
|
|
MMP
|
Others
|
|
Mca-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a biological active peptide. (MMP substrate)
|
-
- HY-P5343
-
|
p53 Consensus binding sequence
|
MDM-2/p53
|
Others
|
|
p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)
|
-
- HY-P1592A
-
|
|
Galectin
|
Cancer
|
|
G3-C12 (TFA) is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
-
- HY-P1534
-
-
- HY-P1469
-
-
- HY-P0181
-
|
|
Tau Protein
|
Neurological Disease
|
|
Microtubule-associated protein tau (26-44) is a synthetic peptide chain with an amine group attached to glutamine and an carboxyl group attached to lysine.
|
-
- HY-W048199
-
-
- HY-P3918
-
|
|
p38 MAPK
|
Others
|
|
EGF-R (661-681) T669 Peptide is a MAPK substrate that can used to measure MAPK catalytic activity.
|
-
- HY-P2318
-
|
|
Fungal
|
|
|
Bac2A TFA is an antimicrobial and immunomodulatory peptide. Bac2A TFA is a linear variant of bactenecin and is very effective against fungal pathogens.
|
-
- HY-P3670
-
-
- HY-P5544
-
|
N-Acetylmuramyl-L-Ala-γ-D-Glu-meso-diaminopimelic acid
|
NOD-like Receptor (NLR)
|
Others
|
|
M-TriDAP (N-Acetylmuramyl-L-Ala-γ-D-Glu-meso-diaminopimelic acid) is a biological active peptide. (NOD1/2 Agoist)
|
-
- HY-P1164A
-
-
- HY-148031
-
|
|
ADC Linker
|
Others
|
|
MC-Ala-Ala-Asn-PAB-PNP is a peptide, can be used to synthesize specifically activated micromolecular target coupling body.
|
-
- HY-P0225
-
|
Autocamtide II
|
CaMK
Autophagy
|
Neurological Disease
|
|
Autocamtide 2 is a highly selective peptide substrate of calcium/calmodulin-dependent protein kinase II (CaMKII). It can be used in the CaMKII activity assay.
|
-
- HY-P1244
-
|
Secretin (rat)
|
Secretin Receptor
|
Neurological Disease
|
|
Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
|
-
- HY-P1772
-
-
- HY-P1562
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
|
-
- HY-P1225
-
-
- HY-P1284
-
ZIP
1 Publications Verification
|
PKC
|
Neurological Disease
Cancer
|
|
ZIP is a selective peptide inhibitor of PKMζ. ZIP injections can block the impairment in morphine conditioned place preference induced.
|
-
- HY-P0263
-
|
|
Bacterial
Fungal
Antibiotic
|
Infection
|
|
Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration.
|
-
- HY-P5525
-
|
Autocamtide-3 Derived Inhibitory Peptide
|
CaMK
|
Others
|
|
AC3-I, myristoylated is a biological active peptide. (This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.)
|
-
- HY-P2231A
-
|
MEDI0382 acetate
|
GCGR
|
Metabolic Disease
|
|
Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide acetate can be used in the research of obesity and type 2 diabetes (T2D).
|
-
- HY-P4032
-
|
|
HCV
|
Inflammation/Immunology
|
|
HCV Peptide (35-44), a HCV core protein at positions 35 to 44, is a HLA-A2-restricted CTL epitope. HCV Peptide (35-44) inhibits NK cell activity via two distinct mechanisms, directly via KIR2DL2/3, and synergistically via the CD94:NKG2A receptor.
|
-
- HY-W012000
-
|
Boc-N-Me-Ile-OH
|
Amino Acid Derivatives
|
Others
|
|
Boc-N-methyl-L-isoleucine (Boc-N-Me-Ile-OH) is a peptide products and can be used as a precursor in organic synthesis and pharmaceuticals.
|
-
- HY-P1590
-
-
- HY-N6708
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Alamethicin, isolated from Trichoderma viride, is a channel-forming peptide antibiotic and induces voltage-gated conductance in model and cell membranes.
|
-
- HY-114161
-
-
- HY-P0173B
-
|
|
Chloride Channel
|
Cancer
|
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker. Anti-cancer activity.
|
-
- HY-P4050
-
|
|
HBV
|
Infection
|
|
HBV Seq1 aa:18-27 is a hepatitis B virus (HBV) core antigen 18-27 peptide fragment.
|
-
- HY-P3702
-
|
|
TRP Channel
|
Others
|
|
CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1.
|
-
- HY-P2523
-
|
|
Bacterial
Fungal
|
Infection
|
|
Temporin L is a potent antimicrobial peptide and is active against Gram-negative bacteria and yeast strains. Temporin L also has antiendotoxin properties.
|
-
- HY-P3595
-
|
|
GHSR
|
Endocrinology
|
|
GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone.
|
-
- HY-P0313
-
|
|
Influenza Virus
|
Infection
|
|
CEF6 is a 9-aa-long peptide corresponding to aa 418-426 of the influenza A virus (H1N1) nucleocapsid protein.
|
-
- HY-P1707A
-
|
|
Tau Protein
|
Neurological Disease
|
|
Tau protein (592-597), human TFA is a peptide fragment of human Tau protein. The dysfunction of Tau protein is involved in neurodegeneration and dementia.
|
-
- HY-P0324
-
|
|
Bacterial
|
Infection
|
|
Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
|
-
- HY-P1874
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II).
|
-
- HY-P3503A
-
|
BMN 111 acetate
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth.
|
-
- HY-P1196
-
-
- HY-P4048
-
|
|
HBV
|
Infection
|
|
HBV Seq1 aa:93-100 is a hepatitis B virus (HBV) core antigen 93-100 peptide fragment.
|
-
- HY-P1854
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-9), an N-terminal fragment of beta amyloid, consists of amino acid residues 1 to 9. β-Amyloid (1-9) contains a B cell epitope, but it does not include T cell epitopes. Omission of residues 1 to 9 from the full-length Alzheimer'sβ-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism .
|
-
- HY-P3542
-
|
|
GCGR
|
Metabolic Disease
|
|
Des His1, Glu8 Exendin-4 is a potent glucagon-like peptide-1 receptor (GLP-1-R) antagonist. Des His1, Glu8 Exendin-4 improves glucose homeostasis by regulating both insulin secretion and glucose production. Des His1, Glu8 Exendin-4 can be used for the research of type 2 diabetic and gastrointestinal.
|
-
- HY-P2463
-
|
|
Arp2/3 Complex
|
Inflammation/Immunology
|
|
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing.
|
-
- HY-P3523
-
|
|
Integrin
|
Others
|
|
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser.
|
-
- HY-P1284A
-
|
|
PKC
|
Neurological Disease
|
|
ZIP TFA is a selective peptide inhibitor of PKMζ. ZIP TFA injections can block the impairment in morphine conditioned place preference induced.
|
-
- HY-107911
-
|
|
Thrombin
|
Metabolic Disease
|
|
Protamine sulfate, polycationic peptide and a antiheparin agent, could neutralize the anticoagulant action of heparin and enhances lipid-mediated gene transfer.
|
-
- HY-P0263A
-
|
|
Bacterial
Fungal
|
Infection
|
|
Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration.
|
-
- HY-P1843
-
|
|
Arenavirus
|
Infection
|
|
Glycoprotein (276-286) is a Db-restricted peptide derived from lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), corresponds to amino acids 276-286[1].
|
-
- HY-P4822
-
|
|
Tau Protein
|
Others
|
|
Acetyl-PHF5 amide is an amyloidogenic protein tau peptide. Acetyl-PHF5 amide can polymerization into filamentous structures.
|
-
- HY-P1465A
-
-
- HY-114161A
-
-
- HY-P2716
-
|
|
MMP
|
Others
|
|
Mca-Arg-Pro-Lys-Pro-Tyr-Ala-Nva-Trp-Met-Lys(Dnp)-NH2 is a biological active peptide. (MMP substrate)
|
-
- HY-103473A
-
|
Boc-Met-Leu-Phe-OH TFA
|
Formyl Peptide Receptor (FPR)
|
Inflammation/Immunology
|
|
Boc-MLF (TFA) is a peptide, used as a specific formyl peptide receptor (FPR) antagonist, also inhibits the signaling through formyl peptide receptor like 1 (FPRL1) at higher concentrations.
|
-
- HY-107732
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
JNJ-5207787 is a nonpeptidic, selective and penetrate the blood-brain barrier neuropeptide Y Y2 receptor (Y2) antagonist. JNJ-5207787 inhibits the binding of peptide YY (PYY) with pIC50s of 7.0 and 7.1 for human Y2 receptor and rat Y2 receptor, respectively. JNJ-5207787 is >100-fold selective versus human Y1, Y4, and Y5 receptors.
|
-
- HY-P1928
-
|
|
Bcl-2 Family
|
Endocrinology
Neurological Disease
|
Humanin, an anti-apoptotic peptide of 24 amino acids, is a Bax inhibitor. Humanin prevents the translocation of Bax from cytosol to mitochondria, blocks Bax from the inactive to active conformation. Humanin is a mitochondria-associated peptide with a neuroprotective effect against AD-related neurotoxicity. Humanin also improves overall insulin sensitivity in animal. Humanin are related to aging.
Humanin analogue, in which the serine at position 14 is replaced by glycine, names HNG.
|
-
- HY-P1567
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
|
-
- HY-P1170
-
|
Ac-L-Tyr-Gly-Gly-L-Phe-D-Leu-COOH
|
Opioid Receptor
|
Neurological Disease
|
|
N-terminally acetylated Leu-enkephalin is the N-terminally acetylated form of Leu-enkephalin. Leu-enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.
|
-
- HY-P4327
-
|
|
Bacterial
|
Infection
|
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative.
|
-
- HY-P1308
-
-
- HY-P0283
-
-
- HY-P1388
-
|
Amyloid β-peptide (1-42) (rat/mouse)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
-
- HY-P3213
-
-
- HY-P0165
-
|
ITM077; R1583; BIM51077
|
GCGR
|
Metabolic Disease
|
|
Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist developed for treatment of type 2 diabetes, with an EC50 value of 0.06 nM.
|
-
- HY-P1196A
-
-
- HY-P0020
-
|
tos-GPR-ANBA-IPA
|
Biochemical Assay Reagents
|
Others
|
|
Tos-Gly-Pro-Arg-ANBA-IPA is a chromogenic peptide substrate. Tos-Gly-Pro-Arg-ANBA-IPA can be used for luminescence measurement.
|
-
- HY-P4399
-
|
|
Bacterial
|
Others
|
|
Z-Gly-Gly-Leu-AMC is the substrate of ClpP1 and ClpP2, to detect the enzymatic activity in the presence of the activating peptide Z-Leu-Leu.
|
-
- HY-P2550A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled TFA is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).
|
-
- HY-P3868A
-
|
|
Apoptosis
|
Cardiovascular Disease
|
|
QEQLERALNSS TFA is a helix B surface peptide (HBSP) derived from erythropoietin with tissue protective activities. QEQLERALNSS TFA protects cardiomyocytes from apoptosis.
|
-
- HY-P4044
-
|
|
HBV
|
Infection
|
|
HBV Seq2 aa:28-39 is a HBsAg peptide, which binds to major histocompatibility complex (MHC) class I molecules.
|
-
- HY-148263
-
|
|
Fluorescent Dye
|
Cancer
|
|
Biotin-PEG-Thiol (MW 2000) is an active compound. Biotin-PEG-Thiol (MW 2000) is pegylated by binding to streptavidin or antibiotin with high affinity and specificity. Biotin-PEG-Thiol (MW 2000) can modify biomolecules, proteins, peptides and other small molecule materials. Biotin-PEG-Thiol (MW 2000) is widely used in the research of agent release and nano new materials.
|
-
- HY-P0014S1
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
Liraglutide- 13C5, 15N (tetraTFA)is the 13C and 15N labeledLiraglutide(HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus.
|
-
- HY-113952
-
|
(-)-Actinonin
|
Aminopeptidase
Bacterial
MMP
Apoptosis
Antibiotic
|
Cancer
Infection
|
|
Actinonin ((-)-Actinonin) is a naturally occurring antibacterial agent produced by Actinomyces. Actinonin inhibits aminopeptidase M, aminopeptidase N and leucine aminopeptidase. Actinonin is a potent reversible peptide deformylase (PDF) inhibitor with a Ki of 0.28 nM. Actinonin also inhibits MMP-1, MMP-3, MMP-8, MMP-9, and hmeprin α with Ki values of 300 nM, 1,700 nM, 190 nM, 330 nM, and 20 nM, respectively. Actinonin is an apoptosis inducer. Actinonin has antiproliferative and antitumor activities.
|
-
- HY-P3474
-
|
|
MMP
|
Cancer
|
|
Mca-PLGL-Dpa-AR-NH2 is a fluorescent peptide MMP substrate.
|
-
- HY-119523
-
|
DSSeb; Sebacic acid bis N-succinimidyl ester
|
Biochemical Assay Reagents
|
Others
|
|
Disuccinimidyl sebacate (DSSeb) is a cross-linker that can be used in the synthesis of the intermolecular cross-linked peptides.
|
-
- HY-P5215
-
|
|
Bacterial
|
Infection
|
|
LfcinB 17–28 TFA has weak antimicrobial activity (MIC: 200 μM against E. coli). LfcinB 17–28 TFA is a fragment of Bovine Lactoferricin (LfcinB).
|
-
- HY-P0089A
-
|
Growth Hormone Releasing Factor human TFA; Somatorelin (1-44) amide (human) (TFA)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.
|
-
- HY-P4715
-
|
|
PTHR
|
Endocrinology
|
|
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand.
|
-
- HY-P0324A
-
|
|
Bacterial
|
Infection
|
|
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
|
-
- HY-P4744
-
|
|
Bacterial
|
Cancer
Infection
|
|
LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research.
|
-
- HY-P0228A
-
|
|
Autophagy
|
Metabolic Disease
|
|
Calcineurin substrate (TFA) is a peptide from the regulatory RII subunit of cAMP-dependent protein kinase. Calcineurin substrate (TFA) can be used in the calcineurin activity assay.
|
-
- HY-P1736
-
|
|
Influenza Virus
|
Infection
|
|
Influenza HA (126-138) is a influenza virus hemagglutinin (HA) peptide comprising amino acids 126-138, induces thymic and peripheral T-cell apoptosis.
|
-
- HY-P3969
-
-
- HY-P2323
-
-
- HY-P3879
-
|
PKC βII (660-673)
|
PKC
|
Others
|
|
Protein Kinase C (660-673) (PKC βII (660-673)) is the PKC βII V5 peptide with RACK1-binding affinity.
|
-
- HY-P2550
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).
|
-
- HY-P4154
-
|
ALM-488
|
Fluorescent Dye
|
Neurological Disease
|
|
Bevonescein (ALM-488) is a fluorescently-labeled peptide that specifically binds to the human neurons or human nerves. Bevonescein can be used as a diagnostic imaging agent.
|
-
- HY-P1742
-
|
|
Opioid Receptor
|
Metabolic Disease
|
|
Gluten Exorphin B5 is an exogenous opioid peptides derived from wheat gluten, acts on opioid receptor, increases postprandial plasma insulin level in rats.
|
-
- HY-P2008
-
|
IEGR-AMC
|
Factor Xa
|
Cardiovascular Disease
|
|
Boc-Ile-Glu-Gly-Arg-AMC (IEGR-AMC) is an activated factor X (FXa) specific fluorogenic peptide substrate used for Factor VIII determination.
|
-
- HY-P3747
-
|
|
Influenza Virus
|
Infection
|
|
Hemagglutinin (48-68) is the 48-68 fragment of influenza virus hemagglutinin. Hemagglutinin (48-68) can induce proliferation of the peptide specific T-cell clones.
|
-
- HY-P0288
-
|
Leu-enkephalin; Leucine enkephalin; Leucyl-enkephalin
|
Opioid Receptor
Endogenous Metabolite
|
Neurological Disease
|
|
[Leu5]-Enkephalin is a pentapeptide with morphine like properties. [Leu5]-Enkephalin is a five amino acid endogenous peptide that acts as an agonist at opioid receptors.
|
-
- HY-108896
-
|
HOE 140 acetate
|
Bradykinin Receptor
|
Inflammation/Immunology
|
|
Icatibant acetate (HOE-140 acetate) is a potent and specific peptide antagonist of bradykinin B2 receptor with an IC50 and Ki of 1.07 nM and 0.798 nM respectively.
|
-
- HY-P1029
-
|
|
Myosin
CaMK
Autophagy
|
Others
|
|
MLCK inhibitor peptide 18 is a myosin light chain kinase (MLCK) inhibitor with an IC50 of 50 nM, and inhibits CaM kinase II only at 4000-fold higher concentrations.
|
-
- HY-P2207
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide can be used for synthetic phospholipids surfactants improvement.
|
-
- HY-P1562A
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 TFA is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
|
-
- HY-P1789
-
|
|
MMP
|
Cancer
Inflammation/Immunology
|
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM.
|
-
- HY-P1388A
-
|
Amyloid β-peptide (1-42) (rat/mouse) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
-
- HY-129658A
-
|
|
GCGR
|
Metabolic Disease
|
|
TT-OAD2 is a non-peptide glucagon-like peptide-1 (GLP-1) receptor agonist with an EC50 of 5 nM. TT-OAD2 has the potential for diabetes treatment.
|
-
- HY-P5372
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
Ala-parafluoroPhe-Arg-Cha-Cit-Tyr-NH2 is a biological active peptide. (Protease activated receptor 1 (PAR-1) belongs to a subfamily of G-protein coupled receptors and is known to mediate the cellular effects of thrombin. This peptide is a PAR-1 selective agonist displaying a high level of specificity to PAR-1 over PAR-2. The specificity of peptide was evaluated in cell-based calcium signaling assay using HEK293 cells. PAR-1 selective agonists can be used to study PAR-1 activation in vivo. In addition to its varied cellular effects of thrombin, PAR-1 has also been shown to coordinate with PAR-4 and regulate thrombin-induced hepatocellular carcinoma harboring thrombin formation within the tumor environment classified as 'coagulation type'.)
|
-
- HY-D1423
-
|
|
Fluorescent Dye
|
Others
|
|
Dibromobimane is a thiol-selective fluorescent imaging agent. Dibromobimane is used to crosslink cysteine- and homocysteine-containing peptides.
|
-
- HY-W012479
-
-
- HY-P1746A
-
|
PKC (19-31) (TFA)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31) TFA, a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31) with a serine at position 25 replacing the wild-type alanine, is used as protein kinase C substrate peptide for testing the protein kinase C activity. Protein kinase C (PKC) TFA is involved in controlling the function of other proteins through the phosphorylation of hydroxyl groups of serine and threonine amino acid residues on these proteins.
|
-
- HY-P1746
-
|
PKC (19-31)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31), a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31) with a serine at position 25 replacing the wild-type alanine, is used as protein kinase C substrate peptide for testing the protein kinase C activity. Protein kinase C (PKC) is involved in controlling the function of other proteins through the phosphorylation of hydroxyl groups of serine and threonine amino acid residues on these proteins.
|
-
- HY-P2004
-
|
|
MMP
|
Cancer
|
|
FFAGLDD is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
|
-
- HY-P2502
-
|
|
HCV Protease
HCV
|
Infection
|
|
Hepatitis Virus C NS3 Protease Inhibitor 2 is a product-based peptide inhibitor of hepatitis C virus (HCV) NS3 protease, with a Ki of 41 nM.
|
-
- HY-P3811A
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate.
|
-
- HY-129077
-
|
|
Fungal
|
Infection
|
|
FR179642 is a key intermediate in the synthesis of the echinocandin antifungal Micafungin. FR179642 is the cyclic peptide nucleus of the echinocandin-like antifungal lipopeptide FR901379.
|
-
- HY-P3459
-
|
|
Bacterial
|
Infection
|
|
Tet-213 is a antimicrobial peptide. Tet-213 has broad spectrum antibacterial activity. Tet-213 can promote infected wound repair.
|
-
- HY-P1244A
-
|
Secretin (rat) (TFA)
|
Secretin Receptor
|
Neurological Disease
|
|
Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
|
-
- HY-P1789A
-
|
|
MMP
|
Cancer
Inflammation/Immunology
|
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM.
|
-
- HY-P1763
-
|
Uru-TK II
|
Bacterial
|
Infection
|
|
Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
|
-
- HY-P1768
-
|
Uru-TK I
|
Bacterial
|
Infection
|
|
Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
|
-
- HY-P3811
-
|
|
CaMK
|
Neurological Disease
|
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate.
|
-
- HY-A0162A
-
|
|
Bacterial
|
Infection
|
|
Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits.
|
-
- HY-P0197
-
|
Substance K; Neurokinin α; Neuromedin L
|
Neurokinin Receptor
|
Neurological Disease
Endocrinology
|
|
Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues.
|
-
- HY-P4043
-
|
|
HBV
|
Infection
Inflammation/Immunology
|
|
Hepatitis b virus pre-s region (120-145) is a preS2 peptide that inhibits the binding of single-chain Fv fragment (scFv) or IgG to r-HBsAg.
|
-
- HY-P1308A
-
-
- HY-P0204A
-
-
- HY-P0199
-
-
- HY-P3911
-
|
|
Bacterial
|
Infection
|
|
CAP 37 (20-44) is a peptide based on amino acid residues 20 through 44 of CAP37. CAP37, a Cationic antimicrobial protein of 37 kDa, is a multifunctional protein.
|
-
- HY-P2562
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
|
-
- HY-P2535
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
|
-
- HY-P3730
-
|
|
CDK
|
Cancer
|
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner.
|
-
- HY-P3203A
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
DSTYSLSSTLTLSK TFA is a generic human peptide and can be used for infliximab quantitative detection. Infliximab (Avakine) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
|
-
- HY-P2004A
-
|
|
MMP
|
Cancer
|
|
FFAGLDD TFA is MMP9 selective cleavage peptides, which used for cytosolic delivery of Doxorubi-cin (DOX) and achieve temporally and spatially controlled slow drug delivery and release.
|
-
- HY-P2207A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Sinapultide TFA is a 21-amino-acid peptide that mimics the action of human surfactant protein-B (SP-B). Sinapultide TFA can be used for synthetic phospholipids surfactants improvement.
|
-
- HY-P0062B
-
-
- HY-P1082
-
Gap 26
5 Publications Verification
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Gap 26 is a connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.
|
-
- HY-P1866
-
-
- HY-114426
-
-
- HY-129658
-
|
|
GCGR
|
Metabolic Disease
|
|
TT-OAD2 free base is a non-peptide glucagon-like peptide-1 (GLP-1) receptor agonist with an EC50 of 5 nM. TT-OAD2 free base has the potential for diabetes treatment.
|
-
- HY-108795
-
|
GLP-1-Gly8; GLP-1 (7-36) analog
|
GLP Receptor
|
Metabolic Disease
|
|
Albiglutide fragment (GLP-1 (7-36) analog) is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies.
|
-
- HY-P1564
-
-
- HY-12537
-
-
- HY-P1591A
-
-
- HY-P1591
-
-
- HY-P1468
-
|
Amyloid β-Protein (1-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P1504
-
-
- HY-P2563
-
|
|
Angiotensin Receptor
|
Metabolic Disease
|
|
[Tyr(P)4] Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.
|
-
- HY-P1519B
-
|
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
|
-
- HY-P1894
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid Protein Precursor 770 (135-155) is a peptide of amyloid precursor protein isoform (APP 770). APP 770 produces Aβ40/42.
|
-
- HY-P0020A
-
|
tos-GPR-ANBA-IPA acetate
|
Biochemical Assay Reagents
|
Others
|
|
Tos-Gly-Pro-Arg-ANBA-IPA (tos-GPR-ANBA-IPA) acetate is a chromogenic peptide substrate. Tos-Gly-Pro-Arg-ANBA-IPA acetate can be used for luminescence measurement.
|
-
- HY-P2291
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.
|
-
- HY-P1289
-
|
|
PKC
|
Others
|
|
[Ala113]MBP(104-118) is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 28-62 μM.
|
-
- HY-18678A
-
|
PT-141 Acetate
|
Melanocortin Receptor
|
Endocrinology
|
|
Bremelanotide Acetate (PT-141 Acetate), a synthetic peptide analogue of α-MSH, is an agonist at melanocortin receptors including the MC3R and MC4R for the treatment of sexual dysfunction.
|
-
- HY-P1519
-
|
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).
|
-
- HY-P3436
-
|
|
Apoptosis
|
Cardiovascular Disease
|
|
WLSEAGPVVTVRALRGTGSW is a cardiomyocyte specific peptide. WLSEAGPVVTVRALRGTGSW-expressing exosomes can improve specific uptake by cardiomyocytes, decrease cardiomyocyte apoptosis, and enhance cardiac retention following intramyocardial injection in vivo.
|
-
- HY-P1289A
-
|
|
PKC
|
Others
|
|
[Ala107]MBP(104-118) is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 46-145 μM.
|
-
- HY-P1082A
-
|
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Gap 26 TFA is a connexin mimetic peptide, composed of residue numbers 63-75 of the first extracellular loop of connexin 43 (gap junction blocker), containing the SHVR amino acid motif.
|
-
- HY-P1466
-
|
Amyloid β-Protein (1-16)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-16) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P2558
-
|
|
GSK-3
|
Others
|
|
GSK3 Substrate, α, β subunit is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used to measure GSK-3 activity.
|
-
- HY-P0197A
-
|
Substance K TFA; Neurokinin α TFA; Neuromedin L TFA
|
Neurokinin Receptor
|
Endocrinology
Neurological Disease
|
|
Neurokinin A TFA (Substance K TFA), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues.
|
-
- HY-142162
-
|
|
GCGR
|
Metabolic Disease
|
|
LSN3318839 is an orally efficacious positive allosteric modulator of the glucagon-like peptide-1 receptor (GLP-1R).
|
-
- HY-112679
-
|
|
GCGR
|
Others
|
|
GLP-1 receptor agonist 2 is a glucagon-like peptide-1 receptor (GLP-1R) agonist.
|
-
- HY-114426A
-
-
- HY-111360
-
|
|
γ-secretase
|
Inflammation/Immunology
|
|
SPL-707 is an orally active, selective signal peptide peptidase-like 2a (SPPL2a) inhibitor with an IC50 of 77 nM for hSPPL2a. SPL-707 inhibits γ-secretase (IC50=6.1 μM) and SPP (IC50=3.7 μM). SPL-707 has the potential for autoimmune diseases research by targeting B cells and dendritic cells.
|
-
- HY-P3985
-
|
Bradykinin potentiating peptide B
|
Angiotensin-converting Enzyme (ACE)
|
Others
|
|
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent ACE inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.
|
-
- HY-P5297
-
|
|
CXCR
|
Cancer
|
|
DOTA-CXCR4-L is a CXCR4 targeting peptide. DOTA-CXCR4-L can be used in the study of cancers, including glioblastoma and triple-negative breast cancer.
|
-
- HY-P1955
-
|
AMG 416; KAI-4169
|
CaSR
|
Endocrinology
|
|
Etelcalcetide (AMG 416) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis.
|
-
- HY-P1504A
-
-
- HY-P1437
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Neuropeptide S (Mouse) is a bioactive peptide. Neuropeptide S (Mouse), as a neurotransmitter/neuromodulator of 20 amino acids, can be used for the research of arousal, anxiety, locomotion, feeding behaviors, memory and agent addiction.
|
-
- HY-P1596
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Gluten exorphin C is an opioid peptide derived from wheat gluten. Its IC50 values are 40 μM and 13.5 μM for μ opioid and δ opioid activities in the GPI and MVD assays, respectively.
|
-
- HY-P3842
-
|
|
PKC
|
Cancer
|
|
Protein Kinase C (661-671) is a fragment peptide of β1 subspecies of protein kinase C (PKC). PKC plays a role in cellular growth control and tumor promotion.
|
-
- HY-P2203A
-
|
|
Notch
|
|
|
SAHM1 TFA is a Notch pathway inhibitor. SAHM1 TFA stabilizes hydrocarbon-stapled alpha helical peptide. SAHM1 TFA targets the protein-protein interface and prevents Notch complex assembly.
|
-
- HY-P1564A
-
|
AngiotensinII TFA; Angiotensin 2 TFA
|
Angiotensin Receptor
|
Others
|
|
[Sar1, Ile8]-Angiotensin II (TFA) is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.
|
-
- HY-P1818
-
-
- HY-P1955A
-
|
AMG 416 hydrochloride; KAI-4169 hydrochloride
|
CaSR
|
Endocrinology
|
|
Etelcalcetide hydrochloride (AMG 416 hydrochloride) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide hydrochloride is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis.
|
-
- HY-P3459A
-
|
|
Bacterial
|
Infection
|
|
Tet-213 TFA is a antimicrobial peptide. Tet-213 TFA has broad spectrum antibacterial activity. Tet-213 TFA can promote infected wound repair.
|
-
- HY-P3436A
-
|
|
Apoptosis
|
Cardiovascular Disease
|
|
WLSEAGPVVTVRALRGTGSW TFA is a cardiomyocyte specific peptide. WLSEAGPVVTVRALRGTGSW-expressing exosomes can improve specific uptake by cardiomyocytes, decrease cardiomyocyte apoptosis, and enhance cardiac retention following intramyocardial injection in vivo.
|
-
- HY-P3293
-
|
POL6014
|
Elastase
|
Inflammation/Immunology
|
|
Lonodelestat (POL6014) is a potent, orally active and selective peptide inhibitor of human neutrophil elastase (hNE). Lonodelestat (POL6014) has the potential for the research of cystic fibrosis (CF).
|
-
- HY-P1752A
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, human (TFA) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior.
|
-
- HY-P0107
-
|
|
Bombesin Receptor
|
Inflammation/Immunology
|
|
RC-3095 is a bombesin/gastrin releasing peptide receptor (GRPR) antagonist. RC-3095 exerts protective effects by reducing gastric oxidative injury in the arthritic mice.
|
-
- HY-P1980
-
|
|
Apoptosis
|
Metabolic Disease
|
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells.
|
-
- HY-P1236
-
|
Atrial natriuretic factor (1-28) (rat)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P1289C
-
|
|
PKC
|
Others
|
|
[Ala113]MBP(104-118) TFA is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 28-62 μM.
|
-
- HY-P1288
-
|
PKC fragment (530-558)
|
PKC
|
Others
|
|
Protein Kinase C (530-558), a peptide fragment of protein kinase C (PKC), is a potent PKC activator. Protein Kinase C (530-558) significantly inhibits osteoclastic bone resorption.
|
-
- HY-P3704
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Enterostatin (rat), an orally active activation peptide of procolipase, selectively reduces fat intake. Enterostatin (rat) reduces serum cholesterol levels by way of a CCK1 receptor-dependent mechanism.
|
-
- HY-P2291A
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens.
|
-
- HY-P1289B
-
|
|
PKC
|
Others
|
|
[Ala107]MBP(104-118) TFA is an noncompetitive peptide inhibitors of protein kinase C (PKC), with IC50s ranging from 46-145 μM.
|
-
- HY-108795A
-
|
GLP-1-Gly8 TFA; GLP-1 (7-36) analog TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Albiglutide fragment (GLP-1 (7-36) analog) TFA is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment TFA significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies.
|
-
- HY-P2497
-
|
|
GCGR
|
Neurological Disease
|
|
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
|
-
- HY-P2246
-
|
|
JNK
|
Cancer
|
|
JTP10-△-TATi TFA is a selective JNK2 peptide inhibitor, with an IC50 of 92 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3.
|
-
- HY-P1586
-
|
HIV-1 rev Protein (34-50)
|
HIV
|
Infection
|
|
HIV-1 Rev (34-50) is a 17-aa peptide derived from the Rev-responsive element (RRE)-binding domains of Rev in HIV-1, with anti-HIV-1 activity.
|
-
- HY-P1795
-
-
- HY-P0271
-
|
|
CaMK
Autophagy
|
Neurological Disease
|
|
Syntide 2, a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected.
|
-
- HY-P1236A
-
|
Atrial natriuretic factor (1-28) (rat) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P3293A
-
|
POL6014 TFA
|
Elastase
|
Inflammation/Immunology
|
|
Lonodelestat TFA (POL6014 TFA) is a potent, orally active and selective peptide inhibitor of human neutrophil elastase (hNE). Lonodelestat TFA has the potential for the research of cystic fibrosis (CF).
|
-
- HY-P3818
-
|
|
PKC
|
Others
|
|
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431.
|
-
- HY-P0062A
-
-
- HY-P5286
-
|
|
Bacterial
|
Cancer
Infection
|
|
BMAP-27 is an antimicrobial peptide capable of disrupting the membrane integrity of microorganisms. Due to its membrane permeability, MAP-27 has inhibitory activity against both bacteria and cancer cells.
|
-
- HY-P2746
-
|
EC 3.4.2.2
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Carboxypeptidase B is a peptide exonuclease that can specifically degrade peptide chains. Carboxypeptidase B is progressively degraded from the C-terminal to release free amino acids. Carboxypeptidase B hydrolyzes only peptide bonds with basic amino acids (such as arginine and lysine) as C-terminal residues.
|
-
- HY-W011165
-
|
Lysyllysine dihydrochloride
|
Others
|
Others
|
|
L-Lysyl-L-lysine (Lysyllysine) dihydrochloride is an enzyme cleavable basic amino acid. L-Lysyl-L-lysine dihydrochloride can be used for delivering multiple biologically active peptides.
|
-
- HY-P1536
-
-
- HY-P0139
-
Gap 27
3 Publications Verification
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment.
|
-
- HY-P1348
-
|
|
GCGR
|
Metabolic Disease
|
|
GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.
|
-
- HY-P3365
-
|
|
Bacterial
|
Cancer
Inflammation/Immunology
|
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory.
|
-
- HY-P2203
-
SAHM1
1 Publications Verification
|
Notch
|
Inflammation/Immunology
|
|
SAHM1, a peptide mimetic of a dominant negative form of mastermind-like (MAML), inhibits canonical Notch transcription complex formation. SAHM1 can be used for the research of allergic airway inflammation in mice.
|
-
- HY-P1277<
