1. Search Result
Search Result
Results for "

ATM and RAD3 related

" in MCE Product Catalog:

693

Inhibitors & Agonists

58

Screening Libraries

12

Dye Reagents

37

Biochemical Assay Reagents

135

Peptides

5

Inhibitory Antibodies

78

Natural
Products

496

Recombinant Proteins

44

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas
  • HY-144214
    ATR-IN-10

    ATM/ATR Cancer
    ATR-IN-10 is a potent and highly selective inhibitor of ataxia telangiectasia mutated and Rad3-Related (ATR) kinase with an IC50 value of 2.978 μM.
  • HY-144436
    ATR-IN-12

    ATM/ATR Cancer
    ATR-IN-12 (Compound 5g) is a potent inhibitor of ataxia telangiectasia and Rad3-related (ATR) kinase with an IC50 value of 0.007 μM. ATR-IN-12 displays good anti-tumor activity and significantly reduces the phosphorylation level of ATR and its downstream signaling protein. ATR-IN-12 is a promising lead compound for subsequent drug discovery targeting ATR kinase.
  • HY-144435
    ATR-IN-11

    ATM/ATR Cancer
    ATR-IN-11 (Compound Hit01) is a potent inhibitor of ataxia telangiectasia and Rad3-related (ATR) kinase. ATR kinase is a key regulating protein within the DNA damage response (DDR), responsible for sensing replication stress (RS). ATR-IN-11 is a promising lead compound for subsequent drug discovery targeting ATR kinase. ATR-IN-11 has the potential for the research of cancer disease.
  • HY-145450
    ATR-IN-9

    Others Cancer
    ATR-IN-9 is a potent inhibitor of Ataxia-telangiectasia and RAD-3-related protein kinase (ATR) extracted from patent WO2020087170A1, compound 59, has an IC50 of 10 nM.
  • HY-142931
    ATM-IN-1

    ATM/ATR Cancer Neurological Disease
    ATM-IN-1 is a potent inhibitor of ATM. ATM is located mainly in the nucleus and microsomes and is involved in cell cycle progression and in the cell cycle checkpoint response to DNA damage. ATM-IN-1 has the potential for the research of cancer and neurology diseases (extracted from patent WO2021139814A1, compound 3).
  • HY-144687
    ATM Inhibitor-4

    ATM/ATR PI3K mTOR Cancer
    ATM Inhibitor-4 (compound 39) is a potent and selective ATM inhibitor, with an IC50 of 0.32 nM. ATM Inhibitor-4 shows stronger inhibition of PI3K kinases family. ATM Inhibitor-4 shows a full inhibition of mTOR at 1 μM. ATM Inhibitor-4 exhibits favorable metabolic stability.
  • HY-144686
    ATM Inhibitor-3

    ATM/ATR PI3K mTOR Cancer
    ATM Inhibitor-3 (compound 34) is a potent and selective ATM inhibitor, with an IC50 of 0.71 nM. ATM Inhibitor-3 shows inhibition of PI3K kinases family. ATM Inhibitor-3 exhibits favorable metabolic stability.
  • HY-100948B
    ATM-3507 trihydrochloride

    Myosin Cancer
    ATM-3507 trihydrochloride is a potent tropomyosin inhibitor with IC50s from 3.83-6.84 μM in human melanoma cell lines.
  • HY-100948
    ATM-3507

    Myosin Cancer
    ATM-3507 is a potent tropomyosin inhibitor with IC50s from 3.83-6.84 μM in human melanoma cell lines.
  • HY-144685
    ATM Inhibitor-2

    ATM/ATR Cancer
    ATM Inhibitor-2 (compound 7) is a potent and selective ATM inhibitor, with an IC50 of <1 nM.
  • HY-112614
    ATM Inhibitor-1

    ATM/ATR Cancer
    ATM Inhibitor-1 is a highly potent, selective and orally active ATM inhibitor, with an IC50 of 0.7 nM, shows weak activity against mTOR (IC50, 21 μM), DNAPK (IC50, 2.8 μM), PI3Kα (IC50, 3.8 μM), PI3Kβ (IC50, 10.3 μM), PI3Kγ (IC50, 3 μM) and PI3Kδ (IC50, 0.73 μM). ATM Inhibitor-1 exhibits anti-tumor activity.
  • HY-141478
    Antitumor agent-28

    ATM/ATR Cancer
    Antitumor agent-28 selectively inhibits ataxia telangiectasia mutated (ATM) kinase. Antitumor agent-28 prevents ATM mediated disease and has potent anti-cancer activity.
  • HY-145312
    ATR-IN-4

    ATM/ATR Cancer
    ATR-IN-4 is a potent ATR (Ataxia telangiectasia mutated gene Rad 3-associated kinase) inhibitor. ATR-IN-4 inhibits growth of human prostate cancer cells DU145 and human lung cancer cells NCI-H460 with IC50s of 130.9 nM and 41 .33 nM, respectively. (Patent CN112142744A, compound 13).
  • HY-112477
    Chk2-IN-1

    Checkpoint Kinase (Chk) Cancer
    Chk2-IN-1 (compound 1) is a potent and selective inhibitor of checkpoint kinase 2 (Chk2), with IC50s of 13.5 nM and 220.4 nM for Chk2 and Chk1, respectively. Chk2-IN-1 can elicit a strong ataxia telangiectasia mutated (ATM)-dependent Chk2-mediated radioprotection effect.
  • HY-P1186
    Eledoisin Related Peptide

    Eledoisin-related Peptide; Eledoisin RP

    Neurokinin Receptor Neurological Disease
    Eledoisin Related Peptide is a Substance P analog that excites neurons and triggers behavioral responses. Eledoisin Related Peptide is also a tachykinin receptor ligand.
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
  • HY-P0215
    Autocamtide-2-related inhibitory peptide, myristoylated

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide, myristoylated is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-P0215A
    Autocamtide-2-related inhibitory peptide, myristoylated TFA

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide, myristoylated TFA is the myristoylated Autocamtide-2-related inhibitory peptide. Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-P0214
    Autocamtide-2-related inhibitory peptide

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-P0214A
    Autocamtide-2-related inhibitory peptide TFA

    CaMK Autophagy Neurological Disease
    Autocamtide-2-related inhibitory peptide (TFA) is a highly specific and potent inhibitor of CaMKII with an IC50 of 40 nM.
  • HY-142919
    μ opioid receptor agonist 2

    Opioid Receptor Neurological Disease
    μ opioid receptor agonist 2 (Compound H-3)is an optically pure oxaspiro ring substituted pyrrolopyrazole derivative, acts as a MOR receptor agonist and can be used for the research of pain and pain related diseases.
  • HY-142918
    μ opioid receptor agonist 1

    Opioid Receptor Neurological Disease
    μ opioid receptor agonist 1 (Compound H-1a)is an optically pure oxaspiro ring substituted pyrrolopyrazole derivative, acts as a MOR receptor agonist and can be used for the research of pain and pain related diseases.
  • HY-112305
    AZ32

    ATM/ATR Cancer
    AZ32 is an orally bioavailable and blood-brain barrier-penetrating ATM inhibitor with an IC50 of <6.2 nM for ATM enzyme, and an IC50 of 0.31 μM for ATM in cell.
  • HY-11002
    CP-466722

    ATM/ATR Cancer
    CP-466722 is a rapidly reversible inhibitor of ATM, with an IC50 of 4.1 μM, and has no effects on PI3K or closely related PI3K-like protein kinase (PIKK) family members.
  • HY-16705
    BRD4770

    Histone Methyltransferase Cancer
    BRD4770 is a histone methyltransferase G9a inhibitor. BRD4770 reduces di- and trimethylation of lysine 9 on histone H3 (H3K9) with an EC50 of 5 µM, and has less or little effect toward H3K27me3, H3K36me3, H3K4me3, and H3K79me3. BRD4770 can activate the ataxia telangiectasia mutated (ATM) pathway and induce cell senescence.
  • HY-P1913
    Calcitonin Gene Related Peptide (CGRP) II, rat

    CGRP Receptor Cardiovascular Disease
    Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases.
  • HY-P1913A
    Calcitonin Gene Related Peptide (CGRP) II, rat TFA

    CGRP Receptor Cardiovascular Disease
    Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases.
  • HY-145056
    ART615

    Others Cancer
    ART615 is the related isomer of ART558. ART615, the inactive of ART558, elicits <10% Polθ inhibition at 12 µM, thus serving as a control for ART558 (IC50=7.9 nM).
  • HY-P1566
    MPG, HIV related

    HIV Infection
    MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
  • HY-103241
    Ro 90-7501

    Amyloid-β ATM/ATR Phosphatase Apoptosis Cancer Neurological Disease
    Ro 90-7501 is an amyloid β42 (Aβ42) fibril assembly inhibitor that reduces 42-induced cytotoxicity (EC50 of 2 μM). Ro 90-7501 inhibits ATM phosphorylation and DNA repair. RO 90-7501 selectively enhances toll-like receptor 3 (TLR3) and RIG-I-like receptor (RLR) ligand-induced IFN-β gene expression and antiviral response. Ro 90-7501 also inhibits protein phosphatase 5 (PP5) in a TPR-dependent manner. Ro 90-7501 has significant radiosensitizing effects on cervical cancer cells.
  • HY-18650
    KU 59403

    ATM/ATR Cancer
    KU 59403 is a potent ATM inhibitor, with IC50 values of 3 nM, 9.1 μM and 10 μM for ATM, DNA-PK and PI3K, respectively.
  • HY-143226
    DK1

    Estrogen Receptor/ERR Metabolic Disease
    DK1 is a potent modulator of estrogen related receptor. DK1 has an ability in reducing blood glucose, and impacts the activity of ERRα receptor. DK1 has the potential for the research of diabetes.
  • HY-P1462
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat

    CGRP Receptor Neurological Disease
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor (CRLR).
  • HY-122624
    MMP13-IN-2

    MMP Inflammation/Immunology
    MMP13-IN-2 is a potent, selective and orally active MMP-13 inhibitor. MMP13-IN-2 exhibits excellent potency for MMP-13 (IC50=0.036 nM) and selectivities (greater than 1,500-fold) over MMP-1, 3, 7, 8, 9, 14, and TACE. MMP13-IN-2 has the ability to block the release of collagen from cartilage in vitro. MMP13-IN-2 has the potential for collagenase related disease research.
  • HY-142777
    Lp-PLA2-IN-9

    Phospholipase Neurological Disease
    Lp-PLA2-IN-9 (compound 17), a tetracyclic pyrimidinone compound, is a potent Lp-PLA2 inhibitor with a pIC50 of 10.1 for rhLp-PLA2. Lp-PLA2-IN-9 has the potential for neurodegenerative related diseases research.
  • HY-142774
    Lp-PLA2-IN-6

    Phospholipase Neurological Disease
    Lp-PLA2-IN-6 (compound 18), a tetracyclic pyrimidinone compound, is a potent Lp-PLA2 inhibitor with a pIC50 of 10.0 for rhLp-PLA2. Lp-PLA2-IN-6 has the potential for neurodegenerative related diseases research.
  • HY-P1462A
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat TFA

    CGRP Receptor Neurological Disease
    Calcitonin Gene Related Peptide (CGRP) (83-119), rat (TFA) is a 37 amino acid calcitonin family of neuropeptide, acts through calcitonin receptor-like receptor (CRLR).
  • HY-15520
    CGK733

    ATM/ATR Cancer
    CGK733 is a potent ATM/ATR inhibitor, used for the research of cancer.
  • HY-100016
    AZD0156

    ATM/ATR Apoptosis Cancer
    AZD0156 is a potent, selective and orally active ATM inhibitor with an IC50 of 0.58 nM. AZD0156 inhibits the ATM-mediated signaling, prevents DNA damage checkpoint activation, disrupts DNA damage repair, and induces tumor cell apoptosis.
  • HY-12016
    KU-55933

    ATM/ATR Autophagy Cancer
    KU-55933 is a potent ATM inhibitor with an IC50 and Ki of 12.9 and 2.2 nM, respectively, and is highly selective for ATM as compared to DNA-PK, PI3K/PI4K, ATR and mTOR.
  • HY-126542
    VRK-IN-1

    Others Neurological Disease
    VRK-IN-1 is a potent and selective inhibitor of vaccinia-related kinases 1 (VRK1), with an IC50 of 150 nM. VRK1 is human Ser/Thr protein kinases associated with increased cell division and neurological disorders.
  • HY-12061
    KU-60019

    ATM/ATR Cancer
    KU-60019 is an improved ATM kinase-specific inhibitor with IC50 of 6.3 nM.
  • HY-117693
    Mirin

    ATM/ATR Cancer
    Mirin is a potent Mre11-Rad50-Nbs1 (MRN) complex inhibitor. Mirin prevents MRN-dependent activation of ATM (IC50=12 μM) without affecting ATM protein kinase activity, and it inhibits Mre11-associated exonuclease activity. Mirin abolishes the G2/M checkpoint and homology-dependent repair in mammalian cells. Mirin prevents ATM activation in response to DNA double-strand breaks (DSBs) and blocks homology-directed repair (HDR) in mammalian cells.
  • HY-109566
    AZD1390

    ATM/ATR Cancer Inflammation/Immunology
    AZD1390 is a potent, highly selective, orally bioavailable, brain-penetrant ATM inhibitor with an IC50 of 0.78 nM in cell.
  • HY-134990
    Hematoporphyrin monomethyl ether

    Apoptosis Cancer
    Hematoporphyrin monomethyl ether, second generation of porphyrin-related photosensitizer, is characterized by its single form, high yield of singlet oxygen, high selectivity, and low toxicity, which has been widely used in the diagnosis and treatment of various tumors, including lung cancer, bladder cancer, and nevus flammeus and brain glioma.
  • HY-100867A
    TAK-659 hydrochloride

    Syk FLT3 Cancer
    TAK-659 hydrochloride is a highly potent, selective, reversible and orally available dual inhibitor of spleen tyrosine kinase (SYK) and fms related tyrosine kinase 3 (FLT3), with an IC50 of 3.2 nM and 4.6 nM for SYK and FLT3, respectively. TAK-659 hydrochloride induces cell death in tumor cells but not in nontumor cells, and with potential for the treatment of chronic lymphocytic leukemia (CLL).
  • HY-144217
    SKLB-197

    ATM/ATR Cancer
    SKLB-197 showed an IC50 value of 0.013 μM against ATR but very weak or no activity against other 402 protein kinases. It displayed potent antitumor activity against ATM-deficent tumors both in vitro and in vivo.
  • HY-135297
    Mono-and diglycerides

    Others Others
    Mono-and diglycerides is formed by triglycerides being broken down by pancreatic lipase in the gastrointestinal lumen. Mono-and diglycerides is a food additive used as a nonionic emulsifier and mainly present in food fats.
  • HY-17504AS
    Rosuvastatin D3

    ZD 4522 D3

    HMG-CoA Reductase (HMGCR) Autophagy Potassium Channel Metabolic Disease Cardiovascular Disease
    Rosuvastatin D3 (ZD 4522 D3) is a deuterium labeled Rosuvastatin. Rosuvastatin (ZD 4522) is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM, delayed cardiac repolarization, and thereby prolonged action potential durations (APDs) and corrected QT interval (QTc) intervals.
  • HY-119757
    Tyrphostin AG1433

    SU1433; AG1433

    PDGFR VEGFR Cancer
    Tyrphostin AG1433 (SU1433) is a tyrosine kinases inhibitor. AG1433 is also a selective PDGFRβ and VEGFR-2 (Flk-1/KDR) inhibitor with IC50s of 5.0 μM and 9.3 μM, respectively. Tyrphostin AG1433 prevents blood vessel formation.
  • HY-15290
    AIM-100

    Ack1 Cancer
    AIM-100 is a potent and selective Ack1 inhibitor with an IC50 of 21.58 nM. AIM-100 also inhibits Tyr 267 phosphorylation. AIM-100 does not inhibits other kinases including PI3-kinase and AKT subfamily members. AIM-100 has an anticancer effect.
  • HY-P2498A
    Cathepsin D and E FRET Substrate acetate

    Cathepsin Cancer
    Cathepsin D and E FRET Substrate acetate is a fluorogenic substrate for cathepsins D and E and not for B, H or L. The cleavage occurs at the Phe-Phe amide bond resul. Cathepsin D and E FRET Substrate is a valuable tool for routine assays and for mechanistic studies on cathepsins E and D.
  • HY-112147
    IDO1 and HDAC1 Inhibitor

    Indoleamine 2,3-Dioxygenase (IDO) HDAC Cancer
    IDO1 and HDAC1 Inhibitor (Compound 10) is a dual IDO1 and HDAC1 inhibitor with IC50s of 69.0 nM and 66.5 nM, respectively.
  • HY-P2498
    Cathepsin D and E FRET Substrate

    Cathepsin Others
    Cathepsin D and E FRET Substrate is a fluorogenic substrate for cathepsins D and E and not for B, H or L. The cleavage occurs at the Phe-Phe amide bond resul. Cathepsin D and E FRET Substrate is a valuable tool for routine assays and for mechanistic studies on cathepsins E and D.
  • HY-P1887
    p5 Ligand for Dnak and DnaJ

    HSP Infection
    p5 Ligand for Dnak and DnaJ is a nonapeptide, which corresponds to the main binding site for the 23-residue part of the presequence of mitochondrial aspartate aminotransferase. p5 Ligand for Dnak and DnaJ is a high-affinity ligand for DnaK and DnaJ.
  • HY-146005
    Tau-aggregation and neuroinflammation-IN-1

    Microtubule/Tubulin Inflammation/Immunology Neurological Disease
    Tau-aggregation and neuroinflammation-IN-1 is a potent tau-aggregation and neuroinflammation inhibitor. Tau-aggregation and neuroinflammation-IN-1 exhibits remarkable inhibitory activities against AcPHF6 and full-length tau aggregation. Tau-aggregation and neuroinflammation-IN-1 has a low cytotoxicity and reduced NO release in LPS-stimulated BV2 cells. Tau-aggregation and neuroinflammation-IN-1 can reverse okadaic acid-induced memory impairment in rats.
  • HY-126304A
    Glycerophosphoric acid disodium salt hydrate (α and β mixture)

    Others Others
    Glycerophosphoric acid (disodium salt hydrate) (α and β mixture) is a complex contains α and β Glycerophosphoric acid isomers.
  • HY-50862
    Akt1 and Akt2-IN-1

    Akt Cancer
    Akt1 and Akt2-IN-1 is an allosteric inhibitor of Akt1 (IC50=3.5 nM) and Akt2 (IC50=42 nM), with potent and balanced activity.
  • HY-N1423
    Glycocholic acid

    Endogenous Metabolite Cancer
    Glycocholic acid is a bile acid with anticancer activity, targeting against pump resistance-related and non-pump resistance-related pathways.
  • HY-100523
    ML385

    Keap1-Nrf2 Ferroptosis Cancer
    ML385 is a specific nuclear factor erythroid 2-related factor 2 (NRF2) inhibitor with an IC50 of 1.9 μM.
  • HY-B0099
    Edaravone

    MCI-186

    MMP Apoptosis Neurological Disease
    Edaravone is a strong novel free radical scavenger, and inhibits MMP-9-related brain hemorrhage in rats treated with tissue plasminogen activator.
  • HY-70027A
    p53 and MDM2 proteins-interaction-inhibitor dihydrochloride

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor dihydrochloride is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-143497
    HDAC1/2 and CDK2-IN-1

    HDAC CDK Apoptosis Cancer
    HDAC1/2 and CDK2-IN-1 (compound 14d) is a potent HDAC1, HDAC2 and CDK2 dual inhibitor, with IC50 values of 70.7, 23.1 and 0.80 μM, respectively. HDAC1/2 and CDK2-IN-1 can block the cell cycle and induce apoptosis. HDAC1/2 and CDK2-IN-1 exhibits desirable in vivo antitumor activity.
  • HY-B0097
    Floxuridine

    5-Fluorouracil 2'-deoxyriboside

    Nucleoside Antimetabolite/Analog DNA/RNA Synthesis Bacterial CMV HSV Apoptosis Cancer Infection
    Floxuridine (5-Fluorouracil 2'-deoxyriboside) is a pyrimidine analog and known as an oncology antimetabolite. Floxuridine inhibits Poly(ADP-Ribose) polymerase and induces DNA damage by activating the ATM and ATR checkpoint signaling pathways in vitro. Floxuridine is a extreamly potent inhibitor for S. aureus infection and induces cell apoptosis. Floxuridine has antiviral effects against HSV and CMV.
  • HY-112622
    GSK3186899

    DDD-853651

    Parasite Cancer
    GSK3186899 (DDD-853651) is an inhibitor of cdc-2-related kinase 12 (CRK12), with an EC50 of 1.4 μM for L. donovani in an intra-macrophage assay.
  • HY-14340
    WAY-181187

    SAX-187

    5-HT Receptor Neurological Disease
    WAY-181187 (SAX-187) is a potent and selective full 5-HT6 receptor agonist with a Ki of 2.2 nM and an EC50 of 6.6 nM. WAY181187 mediates 5-HT6 receptor-dependent signal pathways, such as cAMP, Fyn and ERK1/2 kinase, as specific agonist.
  • HY-110366
    WAY-181187 oxalate

    SAX-187 oxalate

    5-HT Receptor Neurological Disease
    WAY-181187 (SAX-187) oxalate is a potent and selective full 5-HT6 receptor agonist with a Ki of 2.2 nM and an EC50 of 6.6 nM. WAY-181187 oxalate mediates 5-HT6 receptor-dependent signal pathways, such as cAMP, Fyn and ERK1/2 kinase, as specific agonist.
  • HY-N1423S1
    Glycocholic acid-d5

    Endogenous Metabolite Cancer
    Glycocholic acid-d5 is the deuterium labeled Glycocholic acid. Glycocholic acid is a bile acid with anticancer activity, targeting against pump resistance-related and non-pump resistance-related pathways.
  • HY-70027
    p53 and MDM2 proteins-interaction-inhibitor (chiral)

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor (chiral) (Compound 32) is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-70028
    p53 and MDM2 proteins-interaction-inhibitor (racemic)

    MDM-2/p53 E1/E2/E3 Enzyme Cancer
    p53 and MDM2 proteins-interaction-inhibitor (racemic) (Compound 2j) is an inhibitor of the interaction between p53 and MDM2 proteins.
  • HY-139609
    RP-3500

    ATR inhibitor 4

    ATM/ATR mTOR Cancer
    RP-3500 (ATR inhibitor 4) is an orally active, selective ATR kinase inhibitor (ATRi) with an IC50 of 1.00 nM in biochemical assays. RP-3500 shows 30-fold selectivity for ATR over mTOR (IC50=120 nM) and >2,000-fold selectivity over ATM, DNA-PK, and PI3Kα kinases. RP-3500 has potent antitumor activity.
  • HY-129566
    Withanolide B

    ERK Wnt β-catenin Cancer Metabolic Disease Inflammation/Immunology Neurological Disease
    Withanolide B is an active component of W. somnifera Dunal. Withanolide B promotes osteogenic differentiation of hBMSCs via ERK1/2 and Wnt/β-catenin signaling pathways. Withanolide B exhibits neuroprotective, anti-arthritic, anti-aging and anti-cancer effects.
  • HY-N1871
    4-(2-Hydroxy-1-methoxyethyl)-1,2-benzenediol

    Others Inflammation/Immunology
    4-(2-Hydroxy-1-methoxyethyl)-1,2-benzenediol is a phenylethanoid isolated from the stem bark of Syringa reticulate (Bl.) Hara (Oleaceae) with expectorant and antiasthmatic activity.
  • HY-108324A
    Thiothixene hydrochloride

    Others Neurological Disease
    Thiothixene hydrochloride is an antipsychotic agent. Thiothixene hydrochloride can be used for borderline and schizotypal disorder research.
  • HY-17581
    Buparvaquone

    Parasite Antibiotic Infection
    Buparvaquone is a hydroxynaphthoquinone antiprotozoal drug related to parvaquone and atovaquone.
  • HY-101025
    Nrf2-IN-1

    Keap1-Nrf2 Cancer
    Nrf2-IN-1 is an inhibitor of nuclear factor-erythroid 2-related factor 2 (Nrf2). Nrf2-IN-1 is developed for the research of acute myeloid leukemia (AML).
  • HY-B0521
    Altrenogest

    Allyltrenbolone; RU2267

    Progesterone Receptor Endocrinology
    Altrenogest (Allyltrenbolone) is a progestogen structurally related to veterinary steroid trenbolone.
  • HY-116399
    MMP-2/MMP-9-IN-1

    MMP Cancer
    MMP-2/MMP-9-IN-1 is a highly selective, orally active and potent type IV collagenase (MMP-9 and MMP-2) inhibitor with IC50s of 0.24 and 0.31 μM for MMP-9 and MMP-2, respectively. MMP-2/MMP-9-IN-1 is orally active in animal models of tumor growth and metastasis. MMP-2/MMP-9-IN-1 can be used for the research of cancer.
  • HY-B0099S
    Edaravone-d5

    MCI-186-d5

    MMP Apoptosis Neurological Disease
    Edaravone D5 is a deuterium labeled Edaravone. Edaravone is a strong novel free radical scavenger, and inhibits MMP-9-related brain hemorrhage in rats treated with tissue plasminogen activator.
  • HY-N10308
    TF-DG-cThea

    Others Others
    TF-DG-cThea is a storage-related marker compound in black tea.
  • HY-16445
    Sapacitabine

    CS682; CYC682

    Nucleoside Antimetabolite/Analog Cancer
    Sapacitabine is an orally available nucleoside analog prodrug that is structurally related to cytarabine.
  • HY-145039
    HPK1-IN-13

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-13 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-13 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 64) .
  • HY-145038
    HPK1-IN-12

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-12 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-12 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 85) .
  • HY-145040
    HPK1-IN-14

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-14 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-14 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 79) .
  • HY-145035
    HPK1-IN-9

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-9 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-9 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 112) .
  • HY-145037
    HPK1-IN-11

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-11 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-11 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 2).
  • HY-145036
    HPK1-IN-10

    MAP4K Cancer Inflammation/Immunology
    HPK1-IN-10 is potent inhibitor of HPK1. HPK1 is a serine/threonine protein kinase cloned from hematopoietic progenitor cells and belongs to the MAP4K family of mammalian Ste-20-related protein kinases. HPK1-IN-10 has the potential for the research of HPK1 related diseases (extracted from patent WO2021213317A1, compound 103) .
  • HY-124526
    Chiauranib

    CS2164

    VEGFR PDGFR c-Kit Aurora Kinase c-Fms Cancer
    Chiauranib (CS2164) is an orally active multi-target inhibitor against tumor angiogenesis. Chiauranib potently inhibits the angiogenesis-related kinases (VEGFR1, VEGFR2, VEGFR3, PDGFRα and c-Kit), mitosis-related kinase Aurora B, and chronic inflammation-related kinase CSF-1R, with IC50 values ranging from 1-9 nM. Chiauranib has strongly anticancer effects.
  • HY-146681
    PAK1-IN-1

    PAK Cancer
    PAK1-IN-1 is a potent and selective PAK1 inhibitor with an IC50 of 9.8 nM. PAK1-IN-1 inhibits the migration and invasion of PAK1-related tumour cells in a dose-dependent manner.
  • HY-128839
    PROTAC ERRα Degrader-2

    PROTACs Estrogen Receptor/ERR Cancer
    PROTAC ERRα Degrader-2 comprises a MDM2 ligand binding group, a linker and an estrogen-related receptor alpha (ERRa) binding group. PROTAC ERRα Degrader-2 is an estrogen-related receptor alpha (ERRa) degrader.
  • HY-147865
    Apoptosis inducer 8

    Galectin Apoptosis Cancer
    Apoptosis inducer 8 (Compound 7c) is a galectin-1 (gal-1) mediated apoptosis-inducing agent against global major leading lung cancer burden. Apoptosis inducer 8 significantly reduced the gal-1 protein level. Apoptosis inducer 8 is also a PET imaging agent.
  • HY-Y0520
    Itaconic acid

    Endogenous Metabolite Inflammation/Immunology
    Itaconic acid, a precursor of polymers, chemicals, and fuels, can be synthesized by many fungi. Itaconic acid also is a macrophage-specific metabolite. Itaconic acid mediates crosstalk between macrophage metabolism and peritoneal tumors.
  • HY-N10431
    Stigmane B

    Keap1-Nrf2 Neurological Disease
    Stigmane B (Compound 2) is a nuclear factor E2-related factor (Nrf2) activator. Stigmane B downregulates apoptosis and reactive oxygen species (ROS) generation, and increases antioxidant enzyme activities. Stigmane B shows neuroprotective effects.
  • HY-128838
    PROTAC ERRα Degrader-1

    PROTACs Estrogen Receptor/ERR Cancer
    PROTAC ERRα Degrader-1 comprises a MDM2 ligand binding group, a linker and an estrogen-related receptor alpha (ERRa) binding group. PROTAC ERRα Degrader-1 is an PROTAC estrogen-related receptor alpha (ERRa) degrader.
  • HY-18670
    HQ-415

    Others Neurological Disease
    HQ-415 is a class of clinically relevant bioactive metal chelators related to clioquinol.
  • HY-17420
    Cyclophosphamide

    DNA Alkylator/Crosslinker Cancer
    Cyclophosphamide is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic activity, a immunosuppressant.
  • HY-17420A
    Cyclophosphamide hydrate

    Cyclophosphamide monohydrate

    DNA Alkylator/Crosslinker Cancer
    Cyclophosphamide hydrate is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic and immunosuppressive activities.
  • HY-B0466A
    Cloxacillin

    Antibiotic Bacterial Cancer Infection Inflammation/Immunology
    Cloxacillin is an orally active antibacterial agent and β-lactamase inhibitor with IC50 of 0.04 µM. Cloxacillin can suppress the S. aureus-induced inflammatory response by inhibiting the activation of MAPKs, NF-кB and NLRP3-related proteins.
  • HY-B0466
    Cloxacillin sodium monohydrate

    Bacterial Antibiotic Infection Inflammation/Immunology Cancer
    Cloxacillin sodium monohydrate is an orally active antibacterial agent and β-lactamase inhibitor with IC50 of 0.04 µM. Cloxacillin sodium monohydrate can suppress the S. aureus-induced inflammatory response by inhibiting the activation of MAPKs, NF-кB and NLRP3-related proteins.
  • HY-B0466B
    Cloxacillin sodium

    Bacterial Antibiotic Infection Inflammation/Immunology Cancer
    Cloxacillin sodium is an orally active antibacterial agent and β-lactamase inhibitor with IC50 of 0.04 µM. Cloxacillin sodium can suppress the S. aureus-induced inflammatory response by inhibiting the activation of MAPKs, NF-кB and NLRP3-related proteins.
  • HY-113301
    Hexacosanoic acid

    Endogenous Metabolite Cardiovascular Disease
    Hexacosanoic acid is a long-chain fatty acid related to various diseases such as adrenoleukodystrophy (ALD), adrenomyeloneuropathy (AMN) and atherosclerosis.
  • HY-116010
    Oleandomycin

    Bacterial Antibiotic Infection
    Oleandomycin is a macrolide antibiotic structurally closely related to Erythromycin. Oleandomycin is similar to Erythromycin with antimicrobial activity.
  • HY-N10310
    TF-3-G-cThea

    Others Others
    TF-3-G-cThea is a storage-related marker compound in black tea.
  • HY-18940A
    Cilobradine hydrochloride

    DK-AH 269

    HCN Channel Cardiovascular Disease
    Cilobradine is an HCN Channel blocker; an open channel blocker of neuronal Ih and related cardiac If channels.
  • HY-145353
    HTL22562

    CGRP Receptor Neurological Disease
    HTL22562 is a calcitonin gene-related peptide (CGRP) receptor antagonist for acute treatment of migraine.
  • HY-14197A
    Clorgyline hydrochloride

    Monoamine Oxidase Metabolic Disease
    Clorgyline hydrochloride is an irreversible and selective inhibitor of monoamine oxidase A (MAO-A) that is used in scientific research; structurally related to Pargyline.
  • HY-N10309
    TF-3ʹ-G-cThea

    Others Others
    TF-3ʹ-G-cThea is a storage-related marker compound in black tea.
  • HY-B1063
    Terpin hydrate

    Terpin monohydrate; cis-Terpin hydrate

    Others Inflammation/Immunology
    Terpin hydrate is an expectorant, commonly used to loosen mucus in patients presenting with acute or chronic bronchitis, and related conditions.
  • HY-B0257A
    Dydrogesterone

    Progesterone Receptor Endocrinology
    Dydrogesterone is a potent, orally active progestogen indicated in a wide variety of gynaecological conditions related to progesterone deficiency.
  • HY-143227
    DK3

    Estrogen Receptor/ERR Metabolic Disease
    DK3 is a potent and selective estrogen-related receptor alpha (ERRα) agonist.
  • HY-P1006
    Ac-DEVD-pNA

    Others Others
    Ac-DEVD-pNA is a colorimetric substrate for caspase-3 (CPP32) and related cysteine proteases.
  • HY-125120
    Kansuiphorin C

    Others Others
    Kansuiphorin C ameliorates malignant ascites by modulating gut microbiota and related metabolic functions.
  • HY-144690
    D5261

    Trk Receptor Cancer
    D5261 is a potent, type III allosteric tropomyosin-related kinase A (TrkA) inhibitor.
  • HY-145435
    SARS-CoV-2-IN-12

    SARS-CoV Infection
    SARS-CoV-2-IN-12 (Compound 27) is a potent SARS-CoV-2-related 3C-like protease inhibitor (Ki=32.1 pM) for preventing SARS-CoV-2 viral replication and that could be useful in the research of COVID-19.
  • HY-113158
    4-Hydroxyhippuric acid

    Others Others
    4-Hydroxyhippuric acid is a by-product of metabolism of polyphenols and increases the microflora activity related to the refeeding.
  • HY-12799
    6-Alpha Naloxol

    Alpha-Naloxol

    Opioid Receptor Neurological Disease
    6-Alpha Naloxol(Alpha-Naloxol) is an opioid antagonist closely related to naloxone; a human metabolite of naloxone.
  • HY-131118
    Desmethyl Ketoprofen

    Others Inflammation/Immunology Cardiovascular Disease
    Desmethyl Ketoprofen has anti-inflammatory activities. Desmethyl Ketoprofen can be used for the study of angiogenesis-related disorders.
  • HY-N3425
    Kazinol U

    AMPK Others
    Kazinol U inhibits melanogenesis through the inhibition of tyrosinase-related proteins via AMPK activation.
  • HY-P1014
    HCGRP-(8-37)

    Human α-CGRP (8-37)

    CGRP Receptor Metabolic Disease Cardiovascular Disease
    HCGRP-(8-37) is a human calcitonin gene-related peptide (hCGRP) fragment and also an antagonist of CGRP receptor.
  • HY-115879
    SHR168442

    ROR Cancer Inflammation/Immunology
    SHR168442 is a modulator of retinoid-related orphan receptor gamma (RORγ) with an IC50 value of 0.035 μM.
  • HY-124063
    BI-1935

    Epoxide Hydrolase Cardiovascular Disease
    BI-1935 is a potent soluble epoxide hydrolase (sEH) inhibitor for diseases related to cardiovascular disease.
  • HY-N6927
    Isoforskolin

    Coleonol B

    TNF Receptor Interleukin Related Inflammation/Immunology
    Isoforskolin is the principle active component of C. forskohlii native to China. Isoforskolin reduces the secretion of lipopolysaccharide (LPS)-induced cytokines, namely TNF-α, IL-1β, IL-6 and IL-8, in human mononuclear leukocytes. Isoforskolin acts as an anti-inflammatory agent for the treatment of Lyme arthritis.
  • HY-139149
    NiCur

    Histone Acetyltransferase Cancer
    NiCur is a potent and selective CBP histone acetyltransferase (HAT) inhibitor with an IC50 value of 0.35 μΜ. NiCur, which blocks CBP HAT activity and downregulates p53 activation upon genotoxic stress. NiCur can be used for performing mechanistic studies without affecting the expression of target proteins.
  • HY-143270
    PROTAC BRD9-binding moiety 5

    Ligands for Target Protein for PROTAC Epigenetic Reader Domain Cancer
    PROTAC BRD9-binding moiety 5 is a selective BRD9 binder with an IC50 value of 4.20 μM, can be used for the synthesis of PROTACs. PROTAC BRD9-binding moiety 5 has antiproliferative activity against cancer cells.
  • HY-147701
    OfHex1-IN-1

    Others Others
    OfHex1-IN-1 (compound 11c) is a potent and selective OfHex1 (β-N-acetylhexosaminidase from Ostrinia furnacalis) inhibitor, with an IC50 of 28.1 μM and a Ki of 25.6 μM. OfHex1-IN-1 can be used for OfHex1-related green pesticides research.
  • HY-133552
    RORγt Inverse agonist 10

    ROR Inflammation/Immunology
    RORγt Inverse agonist 10 is a potent and orally bioavailable RORγt (retinoic acid receptor-related orphan nuclear receptor gamma t) inverse agonist, with an IC50 of 51 nM. RORγt is a major transcription factor of genes related to psoriasis pathogenesis such as IL-17A, IL-22, and IL-23R
  • HY-145590
    Retezorogant

    ROR Cancer
    Retezorogant is a retinoid-related orphan receptor γ (RORγ) antagonist, extracted from patent WO2016093342 A1.
  • HY-N0184A
    Dipotassium glycyrrhizinate

    Glycyrrhizic acid dipotassium; Dipotassium glycyrrhizate

    Virus Protease Inflammation/Immunology
    Dipotassium glycyrrhizinate is a natural compound, inhibits atopic dermatitis-related gene expression with anti-anti-inflammatory activity.
  • HY-U00300
    Cancer-Targeting Compound 1

    Others Cancer
    Cancer-Targeting Compound 1 is used in the research of hormone-​related cancer, extracted from patent WO 2008021331 A2.
  • HY-118160
    PPM-18

    NSC 73233

    NO Synthase Inflammation/Immunology Cancer
    PPM-18 (NSC 73233), a potent anti-inflammatory agent, inhibits nitric oxide synthase expression. PPM-18 is a potent inhibitor of iNOS expression by blocking the binding of NF-κB to promoter. PPM-18, an analog of Vitamin K, induces autophagy and apoptosis in bladder cancer cells through ROS and AMPK signaling pathways.
  • HY-16916
    NS1643

    Potassium Channel Autophagy Others
    NS1643 is a partial agonist of human ether-a-go-go-related gene (hERG) K(+) channels with an EC50 of 10.5 μM.
  • HY-13452
    CID-1067700

    ML282

    Ras Inflammation/Immunology
    CID-1067700 (ML282) is a pan GTPase inhibitor, and competitively inhibits Ras-related in brain 7 (Rab7) with a Ki of 13 nM.
  • HY-144835
    FHD-286

    Epigenetic Reader Domain Cancer
    FHD-286 is a BRG1/BRM ATPase inhibitor for the treatment of BAF-related disorders such as acute myeloid leukemia.
  • HY-Y0172
    Butylated hydroxytoluene

    Ferroptosis Cancer
    Butylated hydroxytoluene is an antioxidant widely used in foods and in food-related products. Butylated hydroxytoluene is a Ferroptosis inhibitor.
  • HY-16467
    Squalamine lactate

    MSI-1256F

    Bacterial Infection Cardiovascular Disease
    Squalamine lactate is an aminosterol compound discovered in the tissues of the dogfish shark, with antimicrobial activity, and used for the treatment of neovascular age-related macular degeneration.
  • HY-16927
    CK-869

    Arp2/3 Complex Cancer
    CK-869 is an Actin-Related Protein 2/3 (ARP2/3) complex inhibitor, with an IC50 of 7 μM.
  • HY-145963
    DRB18

    GLUT Cancer
    DRB18 is a potent pan-class GLUT inhibitor. DRB18 alters energy-related metabolism in A549 cells by changing the abundance of metabolites in glucose-related pathways. DRB18 can eventually lead to G1/S phase arrest and increase oxidative stress and necrotic cell death. DRB18 has anti-tumor activity.
  • HY-128838A
    (rel)-PROTAC ERRα Degrader-1

    Others Others
    (rel)-PROTAC ERRα Degrader-1 is a relative configuration of PROTAC ERRα Degrader-1. PROTAC ERRα Degrader-1 comprises a MDM2 ligand binding group, a linker and an estrogen-related receptor alpha (ERRa) binding group. PROTAC ERRα Degrader-1 is an estrogen-related receptor alpha (ERRa) degrader.
  • HY-139847
    RORγt inverse agonist 23

    ROR Inflammation/Immunology
    RORγt inverse agonist 23 is a potent, selective, and orally available novel retinoic acid receptor-related orphan receptor γt inverse agonist.
  • HY-B0184A
    Felbamate hydrate

    W-554 hydrate; ADD-03055 hydrate

    iGluR Neurological Disease
    Felbamate hydrate (W-554 hydrate) is a potent nonsedative anticonvulsant whose clinical effect may be related to the inhibition of N-methyl-D-aspartate (NMDA) .
  • HY-108594
    PD-118057

    Potassium Channel Metabolic Disease
    PD-118057 is a human ether-a-go-go-related gene (hERG) channel activator that does not cause hERG blockade.
  • HY-B0799
    Dihydroergotoxine mesylate

    Ergoloid mesylates

    GABA Receptor Neurological Disease
    Dihydroergotoxine mesylate is a complex of closely related alkaloid salts; Binds with high affinity to the GABAA receptor Cl- channel, producing an allosteric interaction with the benzodiazepine site.
  • HY-N0763
    Angelicin

    Isopsoralen

    Apoptosis Virus Protease Cancer
    Angelicin, a furocoumarin naturally occurring tricyclic aromatic compound, structurally related to psoralens, is reported to have anti-cancer, antiviral, anti-inflammatory activity.
  • HY-15886
    Mdivi-1

    Mitochondrial division inhibitor 1

    Dynamin Mitophagy Autophagy Apoptosis Cancer
    Mdivi-1 is a selective dynamin-related protein 1 (Drp1) inhibitor. Mdivi-1 is a mitochondrial division/mitophagy inhibitor.
  • HY-12780S
    6-beta-Naloxol D5 hydrochloride

    6β-Naloxol D5 hydrochloride

    Opioid Receptor Neurological Disease
    6-beta-Naloxol D5 hydrochloride is the deuterium labeled 6-beta-Naloxol, which is an opioid antagonist closely related to naloxone.
  • HY-12213
    CDDO-EA

    CDDO ethyl amide; TP319; RTA 405

    Keap1-Nrf2 Cancer
    CDDO-EA is an NF-E2 related factor 2/antioxidant response element (Nrf2/ARE) activator.
  • HY-16762
    Artefenomel

    OZ439

    Parasite Ferroptosis Infection
    Artefenomel (OZ439) is a synthetic antimalarial agent with the artemisinin pharmacophore. Artefenomel (OZ439) is a long-acting artemisinin-related agent.
  • HY-N5118
    Chimonanthine

    (-)-Chimonanthine

    Tyrosinase Cancer
    Chimonanthine is an alkaloid of Chimonanthus praecox, inhibits tyrosinase and tyrosine-related protein-1 mRNA expression, amd inhibits melanogenesis.
  • HY-B0184
    Felbamate

    W-554; ADD-03055

    iGluR Neurological Disease
    Felbamate (W-554) is a potent nonsedative anticonvulsant whose clinical effect may be related to the inhibition of N-methyl-D-aspartate (NMDA).
  • HY-136352
    Adenosine 5'-succinate

    Others Others
    Adenosine 5'-succinate is a chemically AMP-related compound and potently inhibits Denatonium benzoate/taste receptor activation of transducin.
  • HY-17420S1
    Cyclophosphamide-d8

    DNA Alkylator/Crosslinker Cancer
    Cyclophosphamide-d8 is deuterium labeled Cyclophosphamide. Cyclophosphamide is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic activity, a immunosuppressant.
  • HY-139078
    Furosine dihydrochloride

    Others Metabolic Disease
    Furosine dihydrochloride, an amino acid derivative, is an important chemical marker of early-stage Maillard reactions. Furosine dihydrochloride is closely related to a variety of diseases such as diabetes.
  • HY-139557
    Zastaprazan

    Proton Pump Inflammation/Immunology
    Zastaprazan is a proton pump inhibitor (WO2018008929). Zastaprazan can be used for the research of gastrointestinal inflammatory diseases or gastric acid-related diseases.
  • HY-N10283
    Neoechinulin C

    Endogenous Metabolite Neurological Disease
    Neoechinulin C, an echinulin-related indolediketopiperazine alkaloid, protects the neuronal cells against paraquat-induced damage in a Parkinson’s disease model.
  • HY-100958
    4-DAMP

    4-DAMP methiodide

    mAChR Inflammation/Immunology
    4-DAMP is a potent antagonist of M3 receptor and also has a high affinity for the closely-related M5 receptor.
  • HY-145946
    BRM/BRG1 ATP Inhibitor-2

    Epigenetic Reader Domain Cancer
    BRM/BRG1 ATP Inhibitor-2 is a BRG1/BRM ATPase inhibitor for the treatment of BAF-related disorders.
  • HY-B0521S
    Altrenogest-d5

    Allyltrenbolone-d5; RU2267-d5

    Progesterone Receptor Endocrinology
    Altrenogest-d5 (Allyltrenbolone-d5) is the deuterium labeled Altrenogest. Altrenogest (Allyltrenbolone) is a progestogen structurally related to veterinary steroid trenbolone.
  • HY-12366
    Ubrogepant

    MK-1602

    CGRP Receptor Neurological Disease Cardiovascular Disease
    Ubrogepant (MK-1602) is a novel oral calcitonin gene-related peptide receptor (CGRP) antagonist in development for acute treatment of migraine.
  • HY-129623
    Ethyl nonanoate

    Endogenous Metabolite Metabolic Disease
    Ethyl nonanoate is a rich ester in spirits and its presence is commonly related to the pleasant fruity bouquet of alcoholic beverages. Ethyl nonanoate is an endogenous metabolite.
  • HY-147317
    Epothilone E

    Microtubule/Tubulin Cancer
    Epothilone E is a related compound of epothilone, which inhibits microtubule protein function and blocks cell division, and has anti-tumor activity.
  • HY-132810
    Bevurogant

    ROR Inflammation/Immunology
    Bevurogant is a retinoid-related orphan receptor-gamma t (RORγt) antagonist. Bevurogant can be used for the research of chronic inflammatory diseases.
  • HY-P1441
    Mambalgin 1

    Sodium Channel Others
    Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation.
  • HY-124564
    Methisazone

    Marboran

    SARS-CoV Orthopoxvirus Infection
    Methisazone (Marboran) is an antiviral agent that works by inhibiting mRNA and protein synthesis. Methisazone is also a SARS-CoV-2 (COVID-19) inhibitor. Methisazone is mainly used in pox viruses.
  • HY-P1871A
    Amylin (IAPP), feline TFA

    Amylin Receptor Metabolic Disease
    Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion.
  • HY-150576
    c-Met-IN-13

    c-Met/HGFR Cancer
    c-Met-IN-13 is a potent c-Met inhibitor with an IC50 value of 2.43 nM. c-Met-IN-13 shows excellent cytotoxicity for cancer cells. c-Met-IN-13 shows antiproliferative activity in a concentration- and time- dependent manner. c-Met-IN-13 has the potential for the research of cancer.
  • HY-16915
    RPR-260243

    Potassium Channel Cardiovascular Disease
    RPR-260243, a potent activator of human ether-a-go-go-related gene (hERG), slows deactivation and attenuates inactivation of hERG1 channels. RPR260243-modified HERG currents are inhibited by Dofetilide (IC50=58 nM). RPR260243 displays no activator-like effects on other voltage-dependent ion channels, including the closely related ERG3 K+ channel.
  • HY-11053
    S 24795

    nAChR Neurological Disease
    S 24795 is a partial agonist of α7 nAChR and improves mnemonic function in aged mice for the treatment of aging-related memory disturbances.
  • HY-W011151
    trans-Zeatinriboside

    Others Others
    trans-Zeatinriboside is a type of cytokinin precursor, acts as a major long-distance signalling form in xylem vessels, regulates leaf size and meristem activity-related traits.
  • HY-B0257AS
    Dydrogesterone-D6

    Progesterone Receptor Endocrinology
    Dydrogesterone-D6 is the deuterium labeled Dydrogesterone. Dydrogesterone is a potent, orally active progestogen indicated in a wide variety of gynaecological conditions related to progesterone deficiency.
  • HY-N0470
    L-Lysine hydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-N6953
    Garcinone D

    STAT Keap1-Nrf2 Reactive Oxygen Species Neurological Disease
    Garcinone D, a natural xanthone from mangosteen, promotes the proliferation of C17.2 neural stem cell. Garcinone D increases the protein levels of phosphorylated signal transducer and activator of transcription 3 (p-STAT3), Cyclin D1 and nuclear factor erythroid 2-related factor (Nrf2), heme oxygenase-1 (HO-1) in concentration- and time- dependent manners.
  • HY-115506
    PF-05105679

    TRP Channel Neurological Disease
    PF-05105679 is an orally active and selective TRPM8 antagonist with an IC50 of 103 nM. PF-05105679 has the potential for cold-related pain.
  • HY-P9938
    Erenumab

    CGRP Receptor Others
    Erenumab is a fully human monoclonal antibody. Erenumab inhibits the calcitonin gene–related peptide (CGRP) receptor. Erenumab can be used for the prevention of episodic migraine.
  • HY-147889
    BBR-BODIPY

    Apoptosis Caspase Bcl-2 Family Others
    BBR-BODIPY is a fluorescent probe that allows screening its interaction with the targeted cells. BBR-BODIPY induces apoptosis and changes the expression of apoptosis-related proteins.
  • HY-17420S
    Cyclophosphamide-d4

    DNA Alkylator/Crosslinker Cancer
    Cyclophosphamide-d4 is the deuterium labeled Cyclophosphamide. Cyclophosphamide is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic activity, a immunosuppressant.
  • HY-109022
    Atogepant

    MK-8031; AGN-241689

    CGRP Receptor Neurological Disease
    Atogepant (MK-8031) is an orally active and selective calcitonin gene–related peptide receptor (CGRP) antagonist. Atogepant can be used for researching migraine.
  • HY-120330
    Nek2-IN-5

    Others Cancer
    Nek2-IN-5 (compound 6) is a potent and irreversible Nek2 ((Never in mitosis gene a)-related kinase 2) inhibitior.
  • HY-113301S1
    Hexacosanoic acid-d4-1

    Endogenous Metabolite Cardiovascular Disease
    Hexacosanoic acid-d4-1 is the deuterium labeled Hexacosanoic acid. Hexacosanoic acid is a long-chain fatty acid related to various diseases such as adrenoleukodystrophy (ALD), adrenomyeloneuropathy (AMN) and atherosclerosis.
  • HY-17420AS
    Cyclophosphamide-d8 hydrate

    DNA Alkylator/Crosslinker Cancer
    Cyclophosphamide-d8 hydrate is the deuterium labeled Cyclophosphamide hydrate. Cyclophosphamide hydrate is a synthetic alkylating agent chemically related to the nitrogen mustards with antineoplastic and immunosuppressive activities.
  • HY-N6802
    Tigloylgomisin H

    Others Cancer
    Tigloylgomisin H is a lignan isolated from the fruits of S. chinensis, can induce quinone reductase (QR) activity in Hepa1c1c7 mouse hepatocarcinoma cells. Tigloylgomisin H functions as a monofunctional inducer that specifically upregulates phase II detoxification enzyme NQO1 through the NF-E2-related factor 2 (Nrf2)-ARE pathway, thus represents a potential liver cancer prevention agent.
  • HY-12076
    BMS 777607

    BMS 817378

    c-Met/HGFR TAM Receptor Cancer
    BMS 777607 (BMS 817378) is a Met-related inhibitor for c-Met, Axl, Ron and Tyro3 with IC50s of 3.9 nM, 1.1 nM, 1.8 nM and 4.3 nM, respectively, and 40-fold more selective for Met-related targets than Lck, VEGFR-2, and TrkA/B, with more than 500-fold greater selectivity versus all other receptor and non receptor kinases.
  • HY-120944
    BAY-7598

    MMP Inflammation/Immunology
    BAY-7598 is a potent, orally bioavailable, and selective MMP12 inhibitor probe with IC50s of 0.085, 0.67 and 1.1 nM for human MMP12, murine MMP12, and rat MMP12, respectively.
  • HY-N1798
    Quercetin 3,7-dimethyl ether

    Others Cardiovascular Disease
    Quercetin 3,7-dimethyl ether, isolated from Croton schiedeanus Schlecht, has a NO/cGMP pathway-related profile, with increased vasorelaxant activity.
  • HY-N1100
    Vasicinone

    (-)-Vasicinone

    Others Neurological Disease
    Vasicinone is a quinazoline alkaloid isolated from the Adhatoda vasica plant. Vasicinone is a potential agent for Parkinson's disease and possibly other oxidative stress-related neurodegenerative disorders.
  • HY-111484A
    GDC-0927 Racemate

    SRN-927 Racemate

    Estrogen Receptor/ERR Cancer
    GDC-0927 Racemate (SRN-927 Racemate) is a degrader of estrogen receptor, potently inhibits ER-α activity, with an IC50 of 0.2 nM, and is used in the research of ER-related diseases.
  • HY-N0775
    Isocorynoxeine

    7-Isocorynoxeine

    5-HT Receptor Neurological Disease
    Isocorynoxeine, an isorhynchophylline-related alkaloid, exhibits a dose-dependent inhibition of 5-HT2A receptor-mediated current response with an IC50 of 72.4 μM.
  • HY-P1440
    BeKm-1

    Potassium Channel Cardiovascular Disease
    BeKm-1 is a HERG (human ether-a-go-go-related gene) blocking compound. BeKm-1 can be used for the research of heart disease.
  • HY-12327
    Trk-IN-1

    Trk Receptor Cancer Neurological Disease
    Trk-IN-1 (example 9), a potent tropomyosin-related kinase (Trk) inhibitor, shows potency against TrkA (3.7 nM) and TrkB (94 nM), respectively.
  • HY-109164
    Zelquistinel

    AGN-241751; GATE-251

    iGluR Neurological Disease
    Zelquistinel (AGN-241751) is a N-methyl-D-aspartate (NMDA) receptor partial agonist used for the research of depression, anxiety and other related psychiatric disorders.
  • HY-141551B
    (R)-GNE-274

    Others Others
    (R)-GNE-274 is a enantiomer of GNE-274. GNE-274 is a non-degrader that is structurally related to GDC-0927 (estrogen receptor degrader).
  • HY-147664
    hCAXII-IN-1

    Carbonic Anhydrase Cancer
    These compounds show selective inhibition on tumor related subtypes HCA IX and XII, and are also considered as the leading molecules for the development of future cancer therapeutic drugs based on new mechanisms of action.
  • HY-P99017
    Eptinezumab

    CGRP Receptor Others
    Eptinezumab is a human monoclonal antibody. Eptinezumab binds to calcitonin gene-related peptide (CGRP) and blocks its binding to the receptor. Eptinezumab can be used for the prevention of migraine in adults.
  • HY-P1763
    Urechistachykinin II

    Uru-TK II

    Bacterial Infection
    Urechistachykinin II (Uru-TK II), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
  • HY-32709
    Telcagepant

    MK-0974

    CGRP Receptor Neurological Disease
    Telcagepant (MK-0974) is an orally active calcitonin gene-related peptide (CGRP) receptor antagonist with Kis of 0.77 nM and 1.2 nM for human and rhesus CGRP receptors, respectively.
  • HY-P1768
    Urechistachykinin I

    Uru-TK I

    Bacterial Infection
    Urechistachykinin I (Uru-TK I), an invertebrate tachykinin-related peptides (TRPs) isolated from echiuroid worms, shows antimicrobial activities without a hemolytic effect.
  • HY-146973
    HIV-IN-3

    HIV Infection
    HIV-IN-3 (Compound 22a) is a potent inhibitor of HIV with an IC50 of 1.5 μM. HIV-IN-3 has the potential for the research of HIV-related diseases.
  • HY-15492
    AG-13958

    AG-013958

    VEGFR Cardiovascular Disease
    AG-13958 (AG-013958), a potent VEGFR tyrosine kinase inhibitor, is used for treatment of choroidal neovascularization associated with age-related macular degeneration (AMD).
  • HY-B1272A
    Desipramine

    Adrenergic Receptor Neurological Disease
    Desipramine is a tricyclic antidepressant. Desipramine inhibits the norepinephrine reuptake receptor in the central nervous system and reduces the sleep-related loss of genioglossus activity and improves pharyngeal collapsibility.
  • HY-15498
    Rimegepant

    BMS-927711

    CGRP Receptor Neurological Disease
    Rimegepant (BMS-927711) is a highly potent, oral calcitonin gene-related peptide (CGRP) receptor antagonist with a Ki of 0.027 nM and an IC50 of 0.14 nM for hCGRP receptor.
  • HY-129634
    TrkA-IN-1

    Trk Receptor Neurological Disease
    TrkA-IN-1 is a potent and selective Tropomyosin-related kinase A (TrkA) inhibitor with an IC50 of 99 nM in a cell-based assay. TrkA-IN-1 has analgesic activity.
  • HY-W011522
    Taurolidine

    Bacterial Apoptosis Antibiotic Cancer Infection
    Taurolidine is a broad-spectrum antimicrobial for the prevention of central venous catheter-related infections. Taurolidine has a direct and selective antineoplastic effect on brain tumor cells by the induction of apoptosis.
  • HY-N6985
    Baccatin III

    Others Cancer
    Baccatin III is a natural product isolated from Pacific yew tree and related species. Baccatin III reduces tumor progression by inhibiting the accumulation and suppressive function of MDSCs.
  • HY-109561
    Pegaptanib sodium

    EYE001; NX1838

    VEGFR Metabolic Disease Inflammation/Immunology
    Pegaptanib sodium is an RNA aptamer directed against vascular endothelial growth factor (VEGF)-165. Pegaptanib could be used for the study of neovascular age-related macular degeneration (AMD) .
  • HY-15797
    UNC2250

    TAM Receptor Cancer
    UNC2250 is a potent and selective Mer inhibitor with an IC50 of 1.7 nM, about 160- and 60-fold selectivity over the closely related kinases Axl/Tyro3.
  • HY-126245
    Keap1-Nrf2-IN-1

    Keap1-Nrf2 Metabolic Disease Inflammation/Immunology
    Keap1-Nrf2-IN-1 is a Keap1 (Kelch-like ECH-associated protein 1)-Nrf2 (nuclear factor erythroid 2-related factor 2) protein-protein interaction inhibitor, and with an IC50 of 43 nM for Keap1 protein. Keap1-Nrf2-IN-1 activates Nrf2-regulated cytoprotective response and antagonizes Acetaminophen-induced liver injury.
  • HY-34887
    Acridone-4-carboxylic acid

    Others Others
    Acridone-4-carboxylic acid (ACA) (Compound 2c) is a heme-interacting acridone derivatives that prevents free heme-mediated protein oxidation and degradation. Acridone-4-carboxylic acid inhibits protein carbonyl formation with an IC50 of 43 μM.
  • HY-W268334
    1,2,3,4-Tetrahydronorharman-1-one

    Bacterial Parasite Antibiotic Infection
    1,2,3,4-Tetrahydronorharman-1-one is a manzamine alkaloid with activity against infectious and tropical parasitic diseases from an Indonesian sponge.
  • HY-145732
    SN38 NHS ester

    Drug-Linker Conjugates for ADC Cancer
    SN38 NHS ester is the NHS ester derivative of SN38. SN-38 is an active metabolite of the Topoisomerase I inhibitor Irinotecan. SN-38 inhibits DNA and RNA synthesis. SN38 NHS ester can be used for the synthesis of antibody-drug conjugates (ADCs).
  • HY-144121
    Ph-Ph+

    Bacterial Fungal Apoptosis Cancer Infection
    Ph-Ph+ is a hemiprotonic compound, which is produced from phenanthroline (ph) dimerization. Ph-Ph+ has antitumor, antibacterial and antifungal activities.
  • HY-13622
    Elomotecan hydrochloride

    BN 80927

    Topoisomerase Cancer
    Elomotecan hydrochloride (BN 80927) is a potent inhibitor of topoisomerases I and II. Elomotecan hydrochloride (BN 80927) is a camptothecin analog belonging to the homocamptothecin family (hCPT). Elomotecan hydrochloride (BN 80927) reduces the proliferation of different tumor cells with higher potency than other anticancer drugs of reference targeting topoisomerases I and II.
  • HY-P1871
    Amylin (IAPP), feline

    Amylin Receptor Metabolic Disease
    Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion.
  • HY-122743
    Iperoxo

    mAChR Neurological Disease
    Iperoxo is a potent superagonist of muscarinic acetylcholine receptor (mAChR). [ 3H]Iperoxo can be used for direct probing activation-related conformational transitions of muscarinic receptors.
  • HY-106554
    Trimazosin

    Adrenergic Receptor Cardiovascular Disease
    Trimazosin is an orally active, quinazoline derivative which is structurally related to prazosin. Trimazosin shows hypotensive effect by selectively block α1-adrenoceptors.
  • HY-118208
    ML-097

    CID-2160985

    Ras Cancer
    ML-097 (CID-2160985) is a pan Ras-related GTPases activator that can activate Rac1, cell division cycle 42, Ras, and Rab7.
  • HY-107530
    3F8

    GSK-3 Cancer Metabolic Disease Cardiovascular Disease
    3F8 is a potent and selective GSK-3β inhibitor that could be useful as new reagent and potential therapeutic candidate for GSK3 related diseases.
  • HY-100650
    Carbodenafil

    Phosphodiesterase (PDE) Others
    Carbodenafil is a Sildenafil (UK-92480) related compound found in health foods. Sildenafil is a potent phosphodiesterase type 5 (PDE5) inhibitor with an IC50 of 5.22 nM.
  • HY-145443
    Fludarabine-Cl

    Others Cancer
    Fludarabine-Cl has inhibition effect on RNA adenosine deaminase 1(ADAR1), and can be used for preventing and/or treating cancer or tumor-related diseases.
  • HY-N6253
    Pinoresinol

    (+)-Pinoresinol

    Apoptosis Cancer
    Pinoresinol is a lignol of plant origin serving for defense in a caterpillar. Pinoresinol drastically sensitizes cancer cells against TNF-related apoptosis-inducing ligand (TRAIL) -induced apoptosis.
  • HY-141495A
    Razpipadon

    (-)-PW0464

    Dopamine Receptor Neurological Disease
    Razpipadon ((-)-PW0464), an aromatic compound, is a dopamine receptor partial agonist. Razpipadon can be used in the study of dopamine D1 ligand-mediated related psychiatric disorders.
  • HY-A0148A
    Halofantrine hydrochloride

    SKF-102886; WR-171669 hydrochloride

    Parasite Infection
    Halofantrine hydrochloride (SKF-102886) is a blocker of delayed rectifier potassium current via the inhibition of human-ether-a-go-go-related gene (HERG) channel and a potent antimalarial compound.
  • HY-113334
    Turanose

    Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    Turanose is an isomer of Sucrose that naturally exists in honey. Turanose has anti-inflammatory and regulates adipogenesis effect. Turanose has potential for obesity and related chronic diseases research.
  • HY-110285
    ML382

    Others Neurological Disease
    ML382 is a potent and selective MRGPRX1 (Mas-related G protein-coupled receptor X1, MrgX1) positive allosteric modulator, with an EC50 of 190 nM.
  • HY-109546
    Omeprazole magnesium

    Proton Pump Metabolic Disease
    Omeprazole magnesium is an orally active proton pump inhibitor (PPI) and can suppress gastric acid. Omeprazole magnesium can be used for acid reflux-related symptoms and frequent heartburn research.
  • HY-114411
    ERRγ Inverse Agonist 1

    Estrogen Receptor/ERR Cancer
    ERRγ Inverse Agonist 1 (Compound 12) is a potent, selective and orally bioavailable Estrogen-related Receptor grammar (ERRγ) inverse agonist, with an IC50 of 40 nM.
  • HY-N1362
    Salvianolic acid B

    Lithospermic acid B

    Autophagy Cardiovascular Disease
    Salvianolic acid B is an active ingredient of Salvia miltiorrhiza, which has been widely applied in China for the management of various microcirculation-related disorders, such as cardiovascular disease, cerebrovascular disease, and diabetic vascular complication.
  • HY-144383
    RXR antagonist 2

    RAR/RXR Others
    RXR antagonist 2 (compound 6b) is a potent antagonist of RXR with a Ki and Kd of 0.391 and 0.281 μM. RXR antagonist 2 has the potential for the research of RXR related diseases.
  • HY-N6017
    Bakkenolide A

    HDAC Cancer
    Bakkenolide A is a natural product extracted from Petasites tricholobus. Bakkenolide A inhibits leukemia by regulation of HDAC3 and PI3K/Akt-related signaling pathways.
  • HY-107999
    CADD522

    Others Cancer
    CADD522 is a potent inhibitor of runt-related transcription factor-2 (RUNX2)-DNA binding with an IC50 of 10 nM. CADD522 exhibits antitumor activity.
  • HY-112248A
    HAMI 3379

    Leukotriene Receptor Inflammation/Immunology Cardiovascular Disease
    HAMI 3379 is a potent and selective CysLT2 receptor antagonist. HAMI 3379 has a protective effect on acute and subacute ischemic brain injury, and attenuates microglia-related inflammation.
  • HY-110011
    Cromakalim

    BRL 34915

    Potassium Channel Inflammation/Immunology
    Cromakalim is a potassium channel opener. Cromakalim can be used as a bronchodilator in asthma. Cromakalim inhibits the spontaneous tone of human isolated bronchi in a concentration-related manner being nearly as effective as isoprenaline or theophylline.
  • HY-107560
    4-Methylhistamine dihydrochloride

    Histamine Receptor Cancer
    4-Methylhistamine (dihydrochloride) is the potent agonist of histamine 4 receptor (H4R). 4-Methylhistamine (dihydrochloride) has the potential for the research of immune-related diseases such as cancer and autoimmune disorders.
  • HY-128853
    Taurodeoxycholate sodium salt

    Endogenous Metabolite Inflammation/Immunology
    Taurodeoxycholate sodium salt is a bile salt-related anionic detergent used for isolation of membrane proteins including inner mitochondrial membrane proteins. Taurodeoxycholate (TDCA) inhibits various inflammatory responses [2].
  • HY-119374
    BRM/BRG1 ATP Inhibitor-1

    Epigenetic Reader Domain Cancer
    BRM/BRG1 ATP Inhibitor-1 (compound 14) is an orally active allosteric dual brahma homolog (BRM)/SWI/SNF related matrix associated actin dependent regulator of chromatin subfamily A member 2 (SMARCA2) and brahma related gene 1 (BRG1)/SMARCA4 ATPase activity inhibitor, both IC50s are below 0.005 µM. BRM/BRG1 ATP Inhibitor-1 has anticancer activity[1] .
  • HY-12341
    ML355

    Lipoxygenase Inflammation/Immunology
    ML355 is a potent and selective inhibitor of 12-Lipoxygenase (12-LOX) with an IC50 of 0.34 μM, shows excellent selectivity over related lipoxygenases and cyclooxygenases, and possesses favorable ADME properties.
  • HY-N1481
    Methyl linoleate

    Others Metabolic Disease
    Methyl linoleate, a major active constituent of Sageretia thea fruit (HFSF), is a major anti-melanogenic compound. Methyl linoleate downregulates microphthalmia-associated transcription factor (MITF) and tyrosinase-related proteins.
  • HY-107901
    Pparδ agonist 1

    PPAR Metabolic Disease Cardiovascular Disease
    Pparδ agonist 1 is a PPAR-δ agonist, with an EC50 of 5.06 nM, used in the research of PPAR-delta related diseases, such as mitochondrial diseases, muscular diseases, vascular diseases, demyelinating diseases and metabolic diseases.
  • HY-N2483
    Hydroprotopine

    Others Cancer
    Hydroprotopine is a alkaloid from Hypecoum leptocarpumand. Leptopidine can suppress growth and induce cytotoxicity in breast cancer cells and that the cytotoxicity of leptopidine may be related to its inhibitory effect on fatty acid synthase expression.
  • HY-130118
    MRGPRX1 agonist 1

    Others Neurological Disease
    MRGPRX1 agonist 1 is a highly potent agonist of MRGPRX1 (Mas-related G-protein-coupled receptor X1), with an EC50 of 50 nM, and is inactive on MRGPRC11. Analgesic effect.
  • HY-147605
    Factor B-IN-3

    Complement System Inflammation/Immunology
    Factor B-IN-3 (Example 3 target compound) is a potent complement factor B inhibitor. Factor B-IN-3 can be used for the research of diseases related to inflammation and immunity.
  • HY-W013699
    Chlorhexidine diacetate

    Bacterial Antibiotic Infection
    Chlorhexidine diacetate is a biguanide disinfectant with rapid bactericidal activity against both Gram-positive and Gram-negative organism. The antibacterial effect of chlorhexidine diacetate is related to its action on the bacterial cell membrane and to precipitation of intracellular contents.
  • HY-N1933
    Allocryptopine

    Potassium Channel Cardiovascular Disease
    Allocryptopine, a derivative of tetrahydropalmatine, is extracted from Corydalis decumbens (Thunb.) Pers. Papaveraceae. Allocryptopine has antiarrhythmic effects and potently blocks human ether-a-go-go related gene (hERG) current.
  • HY-124306
    ML-099

    CID-888706

    Ras Cancer
    ML-099 (CID-888706) is a pan Ras-related GTPases activator that can activate Rac1, cell division cycle 42, Ras, Rab7, and Rab-2A.
  • HY-12866
    Larotrectinib

    LOXO-101; ARRY-470

    Trk Receptor Apoptosis Cancer
    Larotrectinib (LOXO-101) is an ATP-competitive oral, selective inhibitor of the tropomyosin-related kinase (TRK) family receptors, with low nanomolar 50% inhibitory concentrations against all three isoforms (TRKA, B, and C).
  • HY-144312
    Galectin-3-IN-1

    Galectin Cancer Metabolic Disease
    Galectin-3-IN-1 (Compound 1) is a potent multivalent inhibitor of galectin-3 (Gal-3). Galectin-3 participates in many cancer-related metabolic processes.
  • HY-B1176
    Equilin

    7-Dehydroestrone

    Estrogen Receptor/ERR Endocrinology
    Equilin (7-Dehydroestrone) is an important member of the large group of oestrogenic substances and is chemically related to menformon (oestrone). Equilin increases the growth of cortical neurons via an NMDA receptor-dependent mechanism.
  • HY-U00425
    PROTAC ERRα ligand 1

    Estrogen Receptor/ERR Cancer
    PROTAC ERRα ligand 1 is an estrogen-related receptor α (ERRα) antagonist with IC50s of 0.04 and 2.8 μM for ERRα and ERRγ, respectively.
  • HY-16966
    SBI-0206965

    ULK Autophagy Apoptosis Cancer
    SBI-0206965 is a potent, selective and cell permeable autophagy kinase ULK1 inhibitor with IC50s of 108 nM for ULK1 kinase and 711 nM for the highly related kinase ULK2.
  • HY-101213
    OSW-1

    Others Cancer
    OSW-1, isolated from Ornithogalum caudatum, is a specific antagonist of osterol-binding protein (OSBP) and OSBP-related protein 4 (ORP4) with GI50s in the nanomolar range in human cancer lines.
  • HY-143423A
    (S)-MALT1-IN-5

    MALT1 Cancer Inflammation/Immunology
    (S)-MALT1-IN-5 is a potent inhibitor of MALT1 protease. (S)-MALT1-IN-5 inhibits the activity of MALT1 is expected to be able to correct the enhancement of MALT1 activity due to abnormality of T cell receptor signal or B cell receptor signal, and cancer or inflammatory disease caused by MALT1 activity is expected. (S)-MALT1-IN-5 has the potential for the research of MALT1-related diseases (extracted from patent WO2020111087A1, compound 1).
  • HY-112075
    Lidoflazine

    Potassium Channel Calcium Channel Cardiovascular Disease
    Lidoflazine is a high affinity blocker of the HERG (human ether-a-go-go-related gene) K + channel. Lidoflazine is an antianginal calcium channel blocker that carries a significant risk of QT interval prolongation and ventricular arrhythmia.
  • HY-106659
    SCH 900978

    NK-1 Antagonist 1

    Neurokinin Receptor Neurological Disease Endocrinology
    SCH 900978 (NK-1 Antagonist 1) is an antagonist of NK-1 receptor, used in the research of NK-1 related diseases and conditions such as cough, overactive bladder, alcohol dependency and depression.
  • HY-144194
    MIF-IN-2

    Others Inflammation/Immunology
    MIF-IN-2 is a migration inhibitory factor (MIF) inhibitor extracted from patent WO2021258272A1 compound 1. MIF-IN-2 can be used for the research of immune inflammation-related diseases.
  • HY-10095A
    Olcegepant hydrochloride

    BIBN-4096 hydrochloride; BIBN4096BS hydrochloride

    CGRP Receptor Neurological Disease
    Olcegepant hydrochloride (BIBN-4096 hydrochloride) is a potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and with a Ki of 14.4 pM for human CGRP.
  • HY-80013A
    THZ1 Hydrochloride

    CDK Cancer
    THZ1 Hydrochloride is a selective and potent covalent CDK7 inhibitor with an IC50 of 3.2 nM. THZ1 Hydrochloride also inhibits the closely related kinases CDK12 and CDK13 and downregulates MYC expression.
  • HY-144188
    PRMT5-IN-17

    Histone Methyltransferase Cancer
    PRMT5-IN-17 (Compound 6) is a PRMT5 inhibitor with anti-tumor activity. PRMT5 is a type of protein arginine methyltransferase, and is a new anti-tumor target related to epigenetic modification.
  • HY-144187
    PRMT5-IN-16

    Histone Methyltransferase Cancer
    PRMT5-IN-16 (Compound 20) is a PRMT5 inhibitor with anti-tumor activity. PRMT5 is a type of protein arginine methyltransferase, and is a new anti-tumor target related to epigenetic modification.
  • HY-10095
    Olcegepant

    BIBN-4096; BIBN 4096BS

    CGRP Receptor Neurological Disease
    Olcegepant (BIBN-4096) is a potent and selective non-peptide antagonist of the calcitonin gene-related peptide 1 (CGRP1) receptor with IC50 of 0.03 nM and Ki of 14.4 pM for human CGRP.
  • HY-N1282
    Seneciphylline

    Gutathione S-transferase Cytochrome P450 Cancer
    Seneciphylline is a toxic pyrrolizidine alkaloid in Senecio plants. Seneciphylline significantly increases the activities of epoxide hydrase and glutathione-S-transferase but causes reduction of cytochrome P-450 and related monooxygenase activities.
  • HY-145581
    Mitiperstat

    Glutathione Peroxidase Cardiovascular Disease
    Mitiperstat is the potent inhibitor of myeloperoxidase (MPO). Mitiperstat is particularly useful in the research of prophylaxis of cardiovascular disorders such as heart failure and coronary artery disease related conditions (extracted from patent US20160152623A1).
  • HY-147240
    Acloproxalap

    Others Infection Inflammation/Immunology Cardiovascular Disease
    Acloproxalap is a quinoline-based aldehyde scavenger that can be used in studies of diseases with toxic aldehyde accumulation, such as inflammatory diseases of the eye and skin, respiratory diseases such as pneumonia, organ diseases, and viral infection-related syndromes.
  • HY-B0762
    Acetyl-L-carnitine hydrochloride

    O-Acetyl-L-carnitine hydrochloride; ALCAR hydrochloride

    Endogenous Metabolite Neurological Disease
    Acetyl-L-carnitine (O-Acetyl-L-carnitine) hydrochloride is a blood-brain permeable acetyl ester of the amino acid L-carnitine found in the body. Acetyl-L-carnitine hydrochloride is often used as a dietary supplement, and exibits anti-stress-related psychiatric disorders.
  • HY-80013
    THZ1

    CDK Cancer
    THZ1 is a selective and potent covalent CDK7 inhibitor with an IC50 of 3.2 nM. THZ1 also inhibits the closely related kinases CDK12 and CDK13 and downregulates MYC expression.
  • HY-N7273
    Soyasaponin III

    Apoptosis Cancer
    Soyasaponin III, a monodesmodic oleanane triterpenoid, is one of the main potentially bioactive saponins found in soy (Glycine max) and related products. Soyasaponin III can induce apoptosis in Hep-G2 cells.
  • HY-144195
    MIF-IN-3

    Others Inflammation/Immunology
    MIF-IN-3 is a migration inhibitory factor (MIF) inhibitor extracted from patent WO2021258272A1 compound 31. MIF-IN-3 can be used for the research of immune inflammation-related diseases.
  • HY-122678
    LQZ-7F

    Survivin Apoptosis Cancer
    LQZ-7F, a survivin dimerization inhibitor, induces spontaneous apoptosis and synergizes with Docetaxel in prostate cancer cells. LQZ-7F dose-dependently inhibits survival of both PC-3 and C4-2 cells with IC50s of 2.99 and 2.47 µM, respectively.
  • HY-120782
    Yhhu-3792

    Notch Neurological Disease
    Yhhu-3792 enhances the self-renewal capability of neural stem cells (NSCs). Yhhu-3792 activates Notch signaling pathway and promotes the expression of Hes3 and Hes5. Yhhu-3792 expands the NSCs pool and promotes endogenous neurogenesis in the hippocampal dentate gyrus (DG) in mouse. Yhhu-3792 increases the spatial and episodic memory abilities of mice. Yhhu-3792 has the potential for the research of impairment of learning and memory associated DG dysfunction.
  • HY-P3204
    POT-4

    AL-78898A

    Complement System Metabolic Disease
    POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
  • HY-N0470S4
    L-Lysine-d8 hydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-Lysine-d8 hydrochloride is the deuterium labeled L-Lysine hydrochloride. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-147606
    Factor B-IN-4

    Complement System Inflammation/Immunology
    Factor B-IN-4 (Example 13 target compound) is a potent complement factor B inhibitor, with an IC50 of 1 μM. Factor B-IN-4 can be used for the research of diseases related to inflammation and immunity.
  • HY-B0590
    Tetrabenazine

    Ro 1-9569

    Monoamine Transporter Neurological Disease
    Tetrabenazine (Ro 1-9569) is a reversible inhibitor of the vesicular monoamine transporter VMAT2 with the Kd value of 1.34 nM. Tetrabenazine can be used for research on diseases related to hyperactive movement disorders such as Huntington's disease.
  • HY-B0590E
    Tetrabenazine mesylate

    Ro 1-9569 mesylate

    Monoamine Transporter Neurological Disease
    Tetrabenazine (Ro 1-9569) mesylate is a reversible inhibitor of the vesicular monoamine transporter VMAT2 with the Kd value of 1.34 nM. Tetrabenazine mesylate can be used for research on diseases related to hyperactive movement disorders such as Huntington's disease.
  • HY-N1077
    Vomifoliol

    Cholinesterase (ChE) Endogenous Metabolite Others
    Vomifoliol, a compound related to abscisie acid (ABA), has a modified 2,4-pentadiene side chain and has activity equal to that displayed by ABA. Vomifoliol exhibits antiacetylcholinesterase activity and displays moderate antileishmanial activity.
  • HY-W009708
    Bis(2-methyl-3-furyl)disulfide

    Others Others
    Bis(2-methyl-3-furyl)disulfide, compound (2), is intended to provide a flavoring compound to enhance a natural feeling, a fresh feeling and a milk-rich feeling of a milk-related product.
  • HY-117851
    AC-265347

    CaSR Metabolic Disease Endocrinology
    AC-265347 is a calcium-sensing receptor (CaSR) agonist and positive allosteric modulator (ago-PAM) with the functional affinity (pKB) of 5.1. AC-265347 can be used for the research of hyperparathyroidism and related diseases.
  • HY-N0470S5
    L-Lysine-d9 hydrochloride

    Virus Protease Endogenous Metabolite
    L-Lysine-d9 (hydrochloride) is the deuterium labeled L-Lysine. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-N0470S6
    L-Lysine-d4 hydrochloride

    Virus Protease Endogenous Metabolite
    L-Lysine-d4 (hydrochloride) is the deuterium labeled L-Lysine. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-136010
    RIP2 Kinase Inhibitor 4

    RIP kinase PROTACs Inflammation/Immunology
    RIP2 Kinase Inhibitor 4 is a potent and selective RIPK2 PROTAC. RIP2 Kinase Inhibitor 4 effectively degrades RIPK2 (pIC50 of 8) and inhibits the release of related TNF-α.
  • HY-126245A
    Keap1-Nrf2-IN-1 TFA

    Keap1-Nrf2 Metabolic Disease Inflammation/Immunology
    Keap1-Nrf2-IN-1 TFA (compound35) is a Kelch-like ECH-associated protein 1-nuclear factor erythroid 2-related factor 2 (Keap1-Nrf2) protein-protein interaction inhibitor, and with an IC50 of 43 nM for Keap1 protein. Keap1-Nrf2-IN-1 TFA activates Nrf2-regulated cytoprotective response and antagonizes acetaminophen-induced liver injury both in cellular and in vivo models.
  • HY-142778
    Lp-PLA2-IN-10

    Phospholipase Metabolic Disease Neurological Disease
    Lp-PLA2-IN-10 is a potent inhibitor of lipoprotein-associated phospholipase A2 (Lp-PLA2). Lp-PLA2 previously known as platelet- activating factor acetylhydrolase (PAF-AH), is a phospholipase A2 enzyme involved in hydrolysis of lipoprotein lipids or phospholipids. Lp-PLA2-IN-10 has the potential for the research of neurodegenerative-related diseases such as Alzheimer's disease (AD), glaucoma, age-related macular degeneration (AMD), or cardiovascular diseases including atherosclerosis (extracted from patent WO2022001881A1, compound 4).
  • HY-147802
    EGFR-IN-59

    EGFR Apoptosis Cancer
    EGFR-IN-59 (Compound 8c) is a EGFR inhibitor (IC50=190 nM) and apoptosis inducer. EGFR-IN-59 exhibits cytotoxicity against non-small lung cancer cell lines (A549) and normal lung fibroblasts (WI38) with IC50s of 8.62 and 52.6 µM, respectively. EGFR-IN-59 can be used for the research of various cancers such as non-small cell lung cancer (NSCLC), head and neck cancer, breast cancer and colorectal cancer.
  • HY-P7060
    NT 13

    TPPT

    iGluR Neurological Disease
    NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases.
  • HY-132845
    Utreloxastat

    Others Neurological Disease
    Utreloxastat is a compound used for the research of the disorders including α-synucleinopathies, tauopathies, Amyotrophic lateral sclerosis (ALS), traumatic brain injury, and ischemic-reperfusion related injuries (patent WO2020081879A2, example A1).
  • HY-147607
    Factor B-IN-5

    Complement System Inflammation/Immunology
    Factor B-IN-5 (Example 5 target compound) is a potent complement factor B inhibitor, with an IC50 of 1.2 μM. Factor B-IN-5 can be used for the research of diseases related to inflammation and immunity.
  • HY-112706
    PF-06747711

    ROR Inflammation/Immunology
    PF-06747711 is a potent, selective, and orally active retinoic acid receptor-related orphan C2 (RORC2, also known as RORγt) inverse agonist, with an IC50 of 4.1 nM. Anti-skin inflammatory activity.
  • HY-109527
    5-HT7 agonist 1

    5-HT Receptor Neurological Disease
    5-HT7 agonist 1 is a selective 5-HT7 receptor agonist, with an IC50 of 222.93 nM, can be used for the 5-HT7 receptor related disease, such as CNS disorders.
  • HY-147604
    Factor B-IN-2

    Complement System Inflammation/Immunology
    Factor B-IN-2 (Example 1 target compound) is a potent complement factor B inhibitor, with an IC50 of 1.5 μM. Factor B-IN-2 can be used for the research of diseases related to inflammation and immunity.
  • HY-P2457
    rCRAMP (rat)

    Bacterial Infection Inflammation/Immunology
    rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS.
  • HY-128829
    Kv3 modulator 2

    Potassium Channel Inflammation/Immunology
    Kv3 modulator 2 (formula (I)) is a potent Kv3 channels modulator extracted from patent WO2018109484A1, compound formula (I) , has analgesic activity and is used in the prophylaxis or treatment of related disorders.
  • HY-145601
    Tinengotinib

    Aurora Kinase VEGFR Cancer
    Tinengotinib is the modulator of one or more protein kinases such as Aurora kinase and VEGFR kinase. Tinengotinib has the potential for the research of these kinase abnormalities diseases mediated, especially cancer-related diseases (extracted from patent WO2018108079A1).
  • HY-B0184S
    Felbamate-d4

    iGluR Neurological Disease
    Felbamate-d4 (W-554-d4) is the deuterium labeled Felbamate. Felbamate (W-554) is a potent anticonvulsant whose clinical effect may be related to the inhibition of N-methyl-D-aspartate (NMDA).
  • HY-N4180
    Pennogenin 3-O-beta-chacotrioside

    Autophagy Cancer
    Pennogenin 3-O-beta-chacotrioside is an active component isolated from Paris polyphylla, modulates autophagy via increasing the expressions of autophagy-related proteins LC3 and Beclin-1. Anti-colorectal cancer activity.
  • HY-147106
    Mrgx2 antagonist-1

    Mas-related G-protein-coupled Receptor (MRGPR) Inflammation/Immunology Cardiovascular Disease
    Mrgx2 antagonist-1 (example 1) is a potent Mrgx2 (Mas-related Gene X2) antagonist. Mrgx2 antagonist-1 can be used for the research of MrgX2-mediated diseases and disorders.
  • HY-109079A
    Abeprazan hydrochloride

    DWP14012 hydrochloride; Fexuprazan hydrochloride

    Proton Pump Metabolic Disease
    Abeprazan hydrochloride (DWP14012 hydrochloride) is a potassium-competitive acid blocker. Abeprazan hydrochloride inhibits H +, K +- ATPase by reversible potassium-competitive ionic binding with no acid activation required. Abeprazan hydrochloride is developed as a potential alternative to proton pump inhibitor for the treatment of acid-related diseases.
  • HY-145554
    Bafrekalant

    Others Others
    Bafrekalant is a diazabicyclic substituted imidazo[l,2-a]pyrimidine-derivative. Bafrekalant has the potential for the research of breathing disorders, including sleep-related breathing disorders such as obstructive and central sleep apnea and snoring (extracted from patent WO2018228907A1).
  • HY-109079
    Abeprazan

    DWP14012; Fexuprazan

    Proton Pump Metabolic Disease
    Abeprazan (DWP14012) is a potassium-competitive acid blocker. Abeprazan inhibits H +, K +- ATPase by reversible potassium-competitive ionic binding with no acid activation required. Abeprazan is developed as a potential alternative to proton pump inhibitor for the treatment of acid-related diseases.
  • HY-142444
    SSAO/VAP-1 inhibitor 1

    Others Metabolic Disease
    SSAO/VAP-1 inhibitor 1 is a potent inhibitor of SSAO/VAP-1. SSAO/VAP-1 promotes the transfer of Glucose transport 4 (GLUT 4) from adipocytes to the cell membrane, thereby regulating glucose transport. In endothelial cells, SSAO/VAP-1 can mediate the adhesion and exudation of leukocytes and endothelial cells, and participate in inflammatory responses. SSAO/VAP-1 inhibitor 1 has the potential for the research of inflammation and/or inflammation-related disease or diabetes and/or diabetes-related disease (extracted from patent WO2021102774A1, compound E3).
  • HY-P1418
    DPC-AJ1951

    Thyroid Hormone Receptor Endocrinology
    DPC-AJ1951, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 in ex vivo and in vivo assays of bone resorption.
  • HY-N0470S2
    L-Lysine-13C dihydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-Lysine-13C dihydrochloride is the 13C-labeled L-Lysine dihydrochloride. L-lysine dihydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-123604A
    TH1834 dihydrochloride

    Histone Acetyltransferase Apoptosis Cancer
    TH1834 dihydrochloride is a specific Tip60 (KAT5) histone acetyltransferase inhibitor. TH1834 dihydrochloride induces apoptosis and increases DNA damage in breast cancer. TH1834 dihydrochloride does not affect the activity of related histone acetyltransferase MOF. Anticancer activity.
  • HY-100518
    T-26c

    MMP Inflammation/Immunology
    T-26c is highly potent and selective matrix metalloproteinase-13 (MMP-13) inhibitor with an IC50 of 6.75 pM and more than 2600-fold selectivity over the other related metalloenzymes.
  • HY-147080
    Avacincaptad pegol sodium

    ARC1905

    Complement System Others
    Avacincaptad pegol (ARC1905) is is an anti-C5 RNA aptamer that inhibits the cleavage of complement factor 5 (C5) into C5a and C5b. Avacincaptad pegol is being used for the study of age-related macular degeneration (AMD).
  • HY-P3204A
    POT-4 TFA

    AL-78898A TFA

    Complement System Metabolic Disease
    POT-4 TFA (AL-78898A TFA), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 TFA can be used for age-related macular degeneration research.
  • HY-145431
    BPTF-IN-1

    Epigenetic Reader Domain Parasite Infection
    BPTF-IN-1 (compound AU1) is a selective bromodomain and PHD finger containing transcription factor (BPTF) bromodomain inhibitor with a Kd of 2.8 μM. BPTF-IN-1 shows to be selective for BPTF over BRD4 bromodomain. BPTF-IN-1 shows antimalarial activity.
  • HY-145849
    VEGFR2-IN-1

    VEGFR Cancer
    VEGFR2-IN-1 is a potent and selective VEGFR2 inhibitor (IC50=19.8 nM). VEGFR2-IN-1 inhibits cell proliferation and migration through apoptosis activation and VEGFR2 inhibition.
  • HY-147565
    ATR-IN-13

    ATM/ATR Cancer
    ATR-IN-13 (compound A9) is a potent ATR kinase inhibitor, with an IC50 of 2 nM. ATR-IN-13 can be used for ATR kinase mediated diseases research, such as proliferative diseases and cancer.
  • HY-123604
    TH1834

    Histone Acetyltransferase Apoptosis Cancer
    TH1834 is a specific Tip60 (KAT5) histone acetyltransferase (HAT) inhibitor. TH1834 induces apoptosis and increases DNA damage in breast cancer. TH1834 does not affect the activity of related histone acetyltransferase MOF. Anticancer activity.
  • HY-16994
    OICR-0547

    Others Cancer
    OICR-0547 is a closely related derivative of OICR-9429. OICR-9429 is a novel small-molecule antagonist of the Wdr5-MLL interaction, while OICR-0547 is an inactive control compound that no longer binds to WDR5.
  • HY-100540B
    Golgicide A-2

    GCA-2

    Enterovirus Infection
    Golgicide A-2 (GCA-2), a Golgicide A (GCA) derivative, is the most active enantiomer of GCA. Golgicide A-2 displays high selectivity and efficiency in killing An. stephensi larvae and can be used for the research of dengue virus related diseases.
  • HY-109157
    Ralmitaront

    RO6889450

    Others Neurological Disease
    Ralmitaront (RO6889450), a potent and orally active partial agonist of the trace amine-associated receptor 1 (TAAR1), acts as a neuroleptic agent. Ralmitaront can be used for the research of neuro-related diseases, such as schizophrenia (SCZ), schizoaffective disorder, and negative symptoms.
  • HY-19414
    MLN-4760

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    MLN-4760 is a potent and selective human ACE2 inhibitor (IC50, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC50, >100 μM) and bovine carboxypeptidase A (CPDA; IC50, 27 μM).
  • HY-19933
    Vibegron

    MK-4618

    Adrenergic Receptor Others
    Vibegron (MK-4618) is a potent, highly selective β3-adrenoceptor agonist (EC50=1.1 nM). Vibegron can be used for severe urgency urinary incontinence related to overactive bladder.
  • HY-N7698B
    Hexa-N-acetylchitohexaose

    Others Cancer Inflammation/Immunology
    Hexa-N-acetylchitohexaose is an inducer of disease resistance in crop plants, which could elicit an increase of lignification-related and antioxidative enzymes in soybean plants. Hexa-N-acetylchitohexaose is a substrate of lysozyme. Hexa-N-acetylchitohexaose shows antitumor effect.
  • HY-141863
    Lepidozin G

    Apoptosis Cancer
    Lepidozin G inhibits the growth of a panel of cancer cell lines with IC50 values ranging from 4.2 ± 0.2 to 5.7 ± 0.5 μM. Lepidozin G induces PC-3 cell death via mitochondrial-related apoptosis.
  • HY-120855
    CCG-100602

    Ras Cardiovascular Disease
    CCG-100602 is a specific inhibitor of myocardin-related transcription factor A/serum response factor (MRTF-A/SRF) signaling. CCG-100602 specifically block MRTF-A nuclear localization and thus inhibit the fibrogenic transcription factor SRF.
  • HY-144313
    Galectin-3-IN-2

    Galectin Cancer Metabolic Disease
    Galectin-3-IN-2 (Compound 9) is a potent multivalent inhibitor of galectin-3 (Gal-3; IC50=8.3 μM). Galectin-3 participates in many cancer-related metabolic processes.
  • HY-P1376
    G-Protein antagonist peptide

    mAChR Adrenergic Receptor Endocrinology
    G-Protein antagonist peptide is the substance P-related peptide that inhibits binding of G proteins to their receptors. G-Protein antagonist peptide competitively and reversibly inhibits M2 muscarinic receptor activation of Gi or Go and inhibits Gs activation by β-adrenoceptors.
  • HY-N1934
    Dihydroberberine

    Potassium Channel HSP Cancer Inflammation/Immunology Cardiovascular Disease
    Dihydroberberine inhibits human ether-a-go-go-related gene (hERG) channels and remarkably reduces heat shock protein 90 (Hsp90) expression and its interaction with hERG. Dihydroberberine has anti-inflammatory, anti-atherosclerotic, hypolipidemic and antitumor activities.
  • HY-12866A
    Larotrectinib sulfate

    LOXO-101 sulfate; ARRY-470 sulfate

    Trk Receptor Apoptosis Cancer
    Larotrectinib sulfate (LOXO-101 sulfate; ARRY-470 sulfate) is an ATP-competitive oral, selective inhibitor of the tropomyosin-related kinase (TRK) family receptors, with low nanomolar 50% inhibitory concentrations against all three isoforms (TRKA, B, and C).
  • HY-141873
    Wnt/β-catenin agonist 2

    β-catenin Others
    Wnt/β-catenin agonist 2 is a potent Wnt agonist. Wnt/β-catenin agonist 2 activates Wnt/β-catenin signaling and can be used in the research of diseases related to the signal transduction. (From patent WO2007078113A1, compound 39)
  • HY-P1418A
    DPC-AJ1951 TFA

    Thyroid Hormone Receptor Endocrinology
    DPC-AJ1951 TFA, a 14 amino acid peptide that acts as a potent agonist of the parathyroid hormone (PTH)/PTH-related peptide receptor (PPR). And characterized the activity of DPC-AJ1951 TFA in ex vivo and in vivo assays of bone resorption.
  • HY-125286
    AB-680

    CD73 Cancer
    AB-680 is a highly potent, reversible and selective inhibitor of CD73 (an ecto-nucleotidase), with a Ki of 4.9 pM for hCD73, displays >10,000-fold selectivity over related ecto-nucleotidases CD39. Anti-tumor activity.
  • HY-134968
    TTBK1-IN-1

    Microtubule/Tubulin Neurological Disease
    TTBK1-IN-1 is a potent, selective and brain-penetrant tau tubulin kinase 1 (TTBK1) inhibitor with an IC50 of 2.7 nM. TTBK1-IN-1 can be used for the research of alzheimer’s disease and related tauopathies.
  • HY-145604
    Vicasinabin

    Cannabinoid Receptor Neurological Disease
    Vicasinabin is the potent agonist of cannabinoid receptor 2 (CB2). Vicasinabin has the potential for the research of human diseases including chronic pain, atherosclerosis, regulation of bone mass, neuroinflammation, and other related diseases (extracted from patent US20130116236A1).
  • HY-W145497
    D-(+)-Sorbose

    Insulin Receptor Metabolic Disease
    D-(+)-Sorbose, an active enantiomer of D-Sorbose, which inhibits disaccharidase activity and demonstrates suppressive action on postprandial blood levels of glucose and insulin in the rat. D-sorbose acts as a sweetener may contribute to the prevention of lifestyle-related diseases, such as type 2 diabetes mellitus.
  • HY-N0470S
    L-Lysine-15N2 hydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-Lysine-15N2 hydrochloride is the 15N-labeled L-Lysine hydrochloride. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-101030
    MBM-17

    Apoptosis Cancer
    MBM-17 is a potent NIMA-related kinase 2 (Nek2) inhibitor with an IC50 of 3 nM. It effectively inhibits the proliferation of cancer cells by inducing cell cycle arrest and apoptosis. MBM-55 shows antitumor activities, and no obvious toxicity to mice.
  • HY-137978
    Ezurpimtrostat

    GNS561

    Others Cancer Metabolic Disease Inflammation/Immunology
    Ezurpimtrostat (compound 2-2) is a potent and orally active anti-fibrotic agent. Ezurpimtrostat can be used for the research of fibrosis, cancer, autophagy and cathepsins B (CTSB), L (CTSL) and D (CTSD) related diseases (extracted from patent WO2020048694 A1).
  • HY-P3410
    Trichomide A

    Phosphatase Inflammation/Immunology
    Trichomide A is a potent activator of SHP2. Trichomide A is a natural cyclodepsipeptide. Trichomide A displays immunosuppressive activity against activated T lymphocyte–mediated immune responses in Con A-activated T cells. Trichomide A have the potential for the research of immune-related skin diseases.
  • HY-120356A
    T-1101 tosylate

    TAI-95 tosylate

    Apoptosis Cancer
    T-1101 tosylate (TAI-95 tosylate) is a Hec1/Nek2 (Highly expressed in cancer 1 / NIMA-related kinase 2) inhibitor with antitumor activity. T-1101 tosylate is inactive toward normal cells, kinases and hERG
  • HY-N8167
    Plantanone B

    Kaempferol 3-O-rhamnosylgentiobioside

    COX Inflammation/Immunology
    Plantanone B is a moderate antioxidant-agent with an IC50 of 169.8±5.2 μM. Plantanone B shows significant ovine COX-1 and moderate COX-2 inhibitory activities. Plantanone B has the potential for inflammation-related diseases research.
  • HY-N2375
    L-Quebrachitol

    Wnt β-catenin Metabolic Disease
    L-Quebrachitol is a natural product isolated from many plants, promotes osteoblastogenesis by uppregulation of BMP-2, runt-related transcription factor-2 (Runx2), MAPK (ERK, JNK, p38α), and Wnt/β-catenin signaling pathway.
  • HY-134849
    PAPD5-IN-1

    DNA/RNA Synthesis Neurological Disease
    PAPD5-IN-1 is a PAP associated domain containing 5 (PAPD5) inhibitor, extracted from patent WO2019084271A1. PAPD5-IN-1 can be used for aging-related degenerative disorders and other diseases research.
  • HY-145600
    Tegileridine

    Opioid Receptor Neurological Disease
    Tegileridine is the potent agonist of opioid receptor (MOR). Tegileridine is an oxa spiro derivative which reduces the side effects mediated by β-arrestin. Tegileridine has the potential for the research of pains and pains-related diseases (extracted from patent WO2017063509A1).
  • HY-14853
    Darexaban

    YM150

    Factor Xa Ser/Thr Protease Cardiovascular Disease
    Darexaban (YM150) is a potent, selective and orally active factor Xa (FXa) inhibitor with an IC50 of 54.6 nM. Darexaban shows high selectivity against other related serine proteases, such as trypsin, thrombin, and kallikrein. Darexaban has anticoagulant and antithrombotic effects.
  • HY-146081
    CD22 ligand-1

    Others Cancer
    CD22 ligand-1 (compound 12) is a potent and selective CD22 ligand with KD of 0.335, 30.7 µM for hCD22 and MAG, respectively. CD22 ligand-1 has the potential for the research of B-cell related disease.
  • HY-139662
    HB007

    E1/E2/E3 Enzyme Cancer
    HB007 is a small ubiquitin-related modifier 1 (SUMO1) degrader. HB007 induces ubiquitination and degradation of SUMO1, resulting in reduced tumor growth in vivo. HB007 can be used for the research of brain, breast, colon, and lung cancers.
  • HY-125976
    ML233

    Others Cardiovascular Disease
    ML233 is a non-peptide based potent apelin receptor (APJ) agonist (EC50=3.7 μM). ML233 displays >21-fold selective over the closely related angiotensin 1 (AT1) receptor (>79 μM).
  • HY-111424A
    (R)-BDP9066

    Others Cancer
    (R)-BDP9066 is a potent inhibitor of myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK). (R)-BDP9066 blocks cancer cell invasion. (R)-BDP9066 has the potential for the research of proliferative diseases, such as cancer.
  • HY-125286A
    AB-680 ammonium

    CD73 Cancer
    AB-680 ammonium is a highly potent, reversible and selective inhibitor of CD73 (an ecto-nucleotidase), with a Ki of 4.9 pM for hCD73, displays >10,000-fold selectivity over related ecto-nucleotidases CD39. Anti-tumor activity.
  • HY-128353
    ROR agonist-1

    ROR Inflammation/Immunology
    ROR agonist-1 is a potent and orally bioavailable inverse agonist of the retinoic acid receptor-related orphan receptor C2 (RORC2), inhibition of IL-17A production from human primary TH 17 cells with a pIC50 of 7.5.
  • HY-147594
    CD73-IN-13

    CD73 Cancer
    CD73-IN-13 is a potent inhibitor of CD73. CD73 is closely associated with tumor growth, angiogenesis and metastasis. CD73-IN-13 be used for preparing a medicament for tumor-related diseases (extracted from patent CN114437039A, compound 7).
  • HY-P99019
    Fremanezumab

    TEV-48125

    CGRP Receptor Neurological Disease
    Fremanezumab (TEV-48125) is a humanized IgG2a monoclonal antibody that selectively and potently binds to calcitonin gene-related peptide (CGRP). CGRP is a 37-amino acid neuropeptide involved in central and peripheral pathophysiological events of migraine. Fremanezumab has the potential for chronic migraine research.
  • HY-139464
    Q134R

    Others Neurological Disease
    Q134R, a neuroprotective hydroxyquinoline derivative that suppresses nuclear factor of activated T cell (NFAT) signaling. Q134R can across blood-brain barrier. Q134R has the potential for Alzheimer's disease (AD) and aging-related disorders research.
  • HY-113673
    A-935142

    Potassium Channel Cardiovascular Disease
    A-935142 is a human ether-a-go-go-related gene (hERG, Kv 11.1) channel activator. A-935142 enhances hERG current in a complex manner by facilitation of activation, reduction of inactivation, and slowing of deactivation, and abbreviates atrial and ventricular repolarization.
  • HY-13204
    Biperiden hydrochloride

    KL 373 hydrochloride

    mAChR Neurological Disease
    Biperiden (KL 373) hydrochloride is a non-selective muscarinic receptor antagonist that competitively binds to M1 muscarinic receptors, thereby inhibiting acetylcholine and enhancing dopamine signaling in the central nervous system. Biperiden hydrochloride has the potential for the research of Parkinson's disease and other related psychiatric disorders.
  • HY-15951
    ML167

    CID44968231; NCGC00188654

    CDK Cancer
    ML167 is a highly selective Cdc2-like kinase 4 (Clk4) inhibitor with IC50 of 136 nM, >10-fold selectivity for closely related kinases Clk1, Clk2, Clk3 and Dyrk1A/1B.
  • HY-143878
    MRGPRX1 agonist 2

    Others Neurological Disease
    MRGPRX1 agonist 2 (compound 1a) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.48 μM. MRGPRX1 agonist 2 can be used for researching neuropathic pain.
  • HY-137563
    A2793

    Potassium Channel Neurological Disease
    A2793 is an efficient dual TWIK-related acid-sensitive K + channel (TASK)-1/TRESK inhibitor, with an IC50 of 6.8 μM for mTRESK. A2764 is more selective for TRESK, and it only moderately influences TREK-1 and TALK-1.
  • HY-76915
    24, 25-Dihydroxy VD3

    VD/VDR Endogenous Metabolite Metabolic Disease
    24, 25-Dihydroxy VD3 is a compound which is closely related to 1,25-dihydroxyvitamin D3, the active form of vitamin D3, but like vitamin D3 itself and 25-hydroxyvitamin D3 is inactive as a hormone both in vitro and in vivo.
  • HY-128849
    Eprodisate

    Others Inflammation/Immunology
    Eprodisate is a new compound designed to interfere with interactions between amyloidogenic proteins and glycosaminoglycans and thereby inhibit polymerization of amyloid fibrils and deposition of the fibrils in tissues. Eprodisate slow the progression of AA amyloidosis-related renal disease and has possible applicability to other types of amyloidosis.
  • HY-N1231
    Sophoraflavanone G

    Kushenol F

    Apoptosis Cancer
    Sophoraflavanone G (Kushenol F) is iaolated from Sophora flavescens and shows anti-tumor and anti-inflammatory properties.  Sophoraflavanone G (Kushenol F) induces MDA-MB-231 and HL-60 cells apoptosis through suppression of MAPK-related pathways.
  • HY-147593
    CD73-IN-12

    CD73 Cancer
    CD73-IN-12 is a potent inhibitor of CD73. CD73 is closely associated with tumor growth, angiogenesis and metastasis. CD73-IN-12 be used for preparing a medicament for tumor-related diseases (extracted from patent CN114437038A, compound 9).
  • HY-13204A
    Biperiden

    KL 373

    mAChR Neurological Disease
    Biperiden (KL 373) is a non-selective muscarinic receptor antagonist that competitively binds to M1 muscarinic receptors, thereby inhibiting acetylcholine and enhancing dopamine signaling in the central nervous system. Biperiden has the potential for the research of Parkinson's disease and other related psychiatric disorders.
  • HY-107339
    Deserpidine

    Harmonyl

    Angiotensin-converting Enzyme (ACE) Metabolic Disease Neurological Disease
    Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex.
  • HY-A0298
    EZH2-IN-2

    Histone Methyltransferase Cancer
    EZH2-IN-2 is a EZH2 inhibitor extracted from patent WO2018133795A1, Compound Example 69, with an IC50 of 64 nM. EZH2-IN-2 can be used for the research of cancer or precancerous condition related to EZH2 activity.
  • HY-17504
    Rosuvastatin Calcium

    Rosuvastatin hemicalcium; ZD 4522 Calcium

    HMG-CoA Reductase (HMGCR) Autophagy Potassium Channel Metabolic Disease Cardiovascular Disease
    Rosuvastatin Calcium is a competitive HMG-CoA reductase (HMGCR) inhibitor, with an IC50 of 11 nM. Rosuvastatin Calcium potently blocks hERG current with an IC50 of 195 nM. Rosuvastatin Calcium reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin Calcium effectively lowers low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-17504A
    Rosuvastatin

    ZD 4522

    HMG-CoA Reductase (HMGCR) Autophagy Potassium Channel Metabolic Disease Cardiovascular Disease
    Rosuvastatin (ZD 4522) is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks hERG current with an IC50 of 195 nM, delayed cardiac repolarization, and thereby prolonged action potential durations (APDs) and corrected QT interval (QTc) intervals. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin effectively lowers low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-N1830
    3-Epiwilsonine

    Others Cancer
    3-Epiwilsonine is an alkaloid from Cephalotaxus wilsoniana, exhibits effect on acute and chronic myeloid leukemia and malignant lymphoma.
  • HY-114338A
    Dalpiciclib hydrochloride

    SHR-6390 hydrochloride

    CDK Cancer
    Dalpiciclib (SHR-6390) hydrochloride is an orally active and highly selective inhibitor of CDK4 and 6 with IC50 values of 12.4 nM and 9.9 nM, respectively. Dalpiciclib hydrochloride shows antitumor activity against breast cancer and esophageal squamous cell carcinoma.
  • HY-114338
    Dalpiciclib

    SHR-6390

    CDK Cancer
    Dalpiciclib (SHR-6390) is an orally active and highly selective inhibitor of CDK4 and 6 with IC50 values of 12.4 nM and 9.9 nM, respectively. Dalpiciclib shows antitumor activity against breast cancer and esophageal squamous cell carcinoma.
  • HY-108683
    ACT-335827

    Orexin Receptor (OX Receptor)
    ACT-335827 is a selective, orally active, brain-penetrating orexin type 1 receptor antagonist. ACT-33582 acts on OXR1 and OXR2 with IC50 values of 6 nM and 417 nM, respectively. ACT-33582 can be used in studies related to neurological disorders.
  • HY-137978A
    Ezurpimtrostat hydrochloride

    GNS561 hydrochloride

    Others Cancer Metabolic Disease Inflammation/Immunology
    Ezurpimtrostat hydrochloride (compound 2-3) is a potent and orally active anti-fibrotic agent. Ezurpimtrostat hydrochloride reduces significantly the liver fibrosis in DEN (diethyl nitrosamine) cirrhotic rat model. Ezurpimtrostat hydrochloride can be used for the research of fibrosis, cancer, autophagy and cathepsins B (CTSB), L (CTSL) and D (CTSD) related diseases .
  • HY-107944
    Chlorphenesin carbamate

    Maolate; U 19646

    Others Neurological Disease
    Chlorphenesin carbamate is a centrally acting skeletal muscle relaxant. Chlorphenesin carbamate can be used for the research of pain and discomfort related to skeletal muscle trauma and inflammation. Chlorphenesin carbamate is a selective blocker of polysynaptic pathways at the spinal and supra-spinal levels. Antinociceptive effect.
  • HY-133128
    FM26

    ROR Cancer
    FM26 (compound 25) is a potent and allosteric retinoic acid receptor-related orphan receptor γt (RORγt) inverse agonists with an IC50 of 264 nM. FM26 has a distinct isoxazole chemotype and effectively reduces IL-17a mRNA production in EL4 cells.
  • HY-124581
    DS-6930

    PPAR Metabolic Disease
    DS-6930 is a potent and selective agonist of PPARγ, with an EC50 of 41 nM. DS-6930 could robust reduce plasma glucose (PG), and with fewer PPARγ-related adverse effects than Rosiglitazone. DS-6930 can be used for the research of diabetes.
  • HY-147538
    Antitumor agent-64

    Apoptosis Cancer
    Antitumor agent-64 (Compound 8d) is a diosgenin derivative. Antitumor agent-64 exhibits potent cytotoxic activity against A549 cell line. Antitumor agent-64 induces A549 cells apoptosis via the mitochondria-related pathway.
  • HY-P99014
    Cusatuzumab

    Apoptosis Inflammation/Immunology
    Cusatuzumab is a human αCD70 monoclonal antibody. Cusatuzumab shows cytotoxicity activity with enhanced antibody-dependent cellular. Cusatuzumab reduces leukemia stem cells (LSCs) and triggers gene signatures related to myeloid differentiation and apoptosis. Cusatuzumab has the potential for the research of Acute myeloid leukemia (AML).
  • HY-19702
    PKR-IN-2

    Pyruvate Kinase Cancer Metabolic Disease Inflammation/Immunology
    PKR-IN-2 is a pyruvate kinase isoform PKR activator extracted from patent WO2014139144A1, compound 160. PKR-IN-2 can be used for the research of PKR function related diseases, including cancer, diabetes, obesity, autoimmune disorders, and benign prostatic hyperplasia.
  • HY-N7121
    Erythromycin estolate

    Bacterial Infection
    Erythromycin estolate, erythromycin derivative, is a macrolide antibiotic used in the treatment of a wide variety of bacterial infections. Erythromycin estolate causes several cases of liver injury which mostly include cholestatic hepatitis. Erythromycin estolate toxicity is related to its inhibitory effect on bile acid transport.
  • HY-123943
    STING agonist-4

    STING Cancer
    STING agonist-4 is an stimulator of Interferon Genes (STING) receptor agonist with an apparent inhibitory constant (IC50) of 20 nM. STING agonist-4 is a two symmetry-related amidobenzimidazole (ABZI)-based compound to create linked ABZIs (diABZIs) with enhanced binding to STING and cellular function.
  • HY-143879
    MRGPRX1 agonist 3

    Others Neurological Disease
    MRGPRX1 agonist 3 (compound 1f) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.22 μM. MRGPRX1 agonist 3 can be used for researching neuropathic pain.
  • HY-W015782
    4-Ethylresorcinol

    Others Metabolic Disease
    4-Ethylresorcinol, a derivative of resorcinol, can act as substrates of tyrosinase. 4-Ethylresorcinol possess hypopigmentary effects. 4-Ethylresorcinol attenuates mRNA and protein expression of tyrosinase-related protein (TRP)-2, and possessed antioxidative effect by inhibiting lipid peroxidation.
  • HY-P1126
    Dolastatin 15

    DLS 15

    Microtubule/Tubulin ADC Cytotoxin Apoptosis Cancer
    Dolastatin 15 (DLS 15), a depsipeptide derived from Dolabella auricularia, is a potent antimitotic agent structurally related to the antitubulin agent Dolastatin 10. Dolastatin 15 induces cell cycle arrest and apoptosis in multiple myeloma cells. Dolastatin 15 can be used as an ADC cytotoxin.
  • HY-145159
    SHP2 protein degrader-1

    PROTACs Phosphatase Apoptosis Cancer
    SHP2 protein degrader-1 is a potent allosteric inhibitor of SHP2. SHP2 protein degrader-1 induces SHP2 degradation and cell apoptosis. SHP2 protein degrader-1 has the potential for researching SHP2 related diseases.
  • HY-147574
    Axl-IN-7

    TAM Receptor Cancer Inflammation/Immunology Cardiovascular Disease
    Axl-IN-7 (Chemie 22) is a potent AXL inhibitor. Axl-IN-7 can be used for Axl-related diseases research, for example cancers (such as acute myeloid leukemia, melanoma, breast cancer, pancreatic cancer, and glial tumors), renal disease, immune system disorders, and cardiovascular disease.
  • HY-B1085
    Cinoxacin

    Compound 64716

    Bacterial Antibiotic DNA/RNA Synthesis Infection
    Cinoxacin (Compound 64716), a synthetic antimicrobial related to the quinolone class of orally active antibacterial agent. Cinoxacin has antibacterial activity against many gram-negative aerobic bacteria and inhibits bacterial DNA synthesis. Cinoxacin can be used for the research of urinary tract infections and bacterial prostatitis.
  • HY-117825
    RU-TRAAK-2

    Potassium Channel Neurological Disease
    RU-TRAAK-2 is a completely reversible TRAAK (TWIK-related arachidonic acid-stimulated K + channel) inhibitor. RU-TRAAK-2 exerts no activity for non-K2P channels (Kv1.2, Slo1 and GIRK2).
  • HY-N0781
    Linderalactone

    Apoptosis Cancer
    Linderalactone is an important sesquiterpene lactone isolated from Radix linderae. Linderalactone inhibits cancer growth by modulating the expression of apoptosis-related proteins and inhibition of JAK/STAT signalling pathway. Linderalactone also inhibits the proliferation of the lung cancer A-549 cells with an IC50 of 15 µM.
  • HY-D1352
    Sulfo-Cyanine7 NHS ester potassium

    Others Others
    Sulfo-Cyanine7 NHS ester potassium is an amine-reactive succinimide ester. Sulfo-Cyanine7 NHS ester reagent allows to prepare sulfo-Cyanine7-labeled biomolecules, such as proteins, with ease. Dye labeled molecules can be subsequently used for various research and drug design related experiments.
  • HY-139331
    20S Proteasome-IN-1

    Proteasome Cancer Inflammation/Immunology Neurological Disease
    20S Proteasome-IN-1 is a 26S proteasome inhibitor extracted from patent WO2006128196A2 compound 2. 20S Proteasome-IN-1 has the potential for cancer, immune-related disorders, inflammation, ischemic conditions, neurodegenerative disorders and other diseases research.
  • HY-118119
    CAY10526

    PGE synthase Cancer
    CAY10526 is a specific microsomal PGE2 synthase-1 (mPGES1) inhibitor. CAY10526 inhibits PGE2 production through the selective modulation of mPGES1 expression but does not affect COX-2. CAY10526 significantly suppresses tumor growth and increases apoptosis in melanoma xenografts. CAY10526 reduces BCL-2 and BCL-XL (anti-apoptotic) protein levels and increases BAX and BAK (pro-apoptotic) as well as cleaved caspase 3 levels. CAY10526 inhibits cell viability (IC50<5 μM) in three melanoma cell lines expressing mPGES1.
  • HY-136788
    ALK4290

    AKST4290

    CCR Inflammation/Immunology Neurological Disease
    ALK4290 (AKST4290) is a potent and orally actively CCR3 inhibitor extracted from patent US20130261153A1, compound Example 2, with a Ki of 3.2 nM for hCCR3. ALK4290 can be used for the research of neovascular age-related macular degeneration and Parkinsonism.
  • HY-19037
    SM-2470

    Adrenergic Receptor Metabolic Disease Neurological Disease
    SM-2470 is a potent α1-adrenoceptor antagonist, has sympathetic nerve activity in anesthetized rats. SM-2470 is an antihypertensive agent. SM-2470 exhibits hypocholesterolaemic effect by the inhibition of cholesterol absorption related to the reduction of cholesterol solubilization.
  • HY-144029
    RET-IN-13

    RET Cancer
    RET-IN-13 (compound 1), a quinoline compound, is a potent RET inhibitor with IC50s of 0.5 nM, 0.9 nM for RET (WT) and RET (V804M), respectively. RET-IN-13 has the potential for tumors or intestinal diseases related to abnormal activation of RET research.
  • HY-P9951
    Ranibizumab

    RG-6321

    VEGFR Cardiovascular Disease
    Ranibizumab (RG-6321) is a humanized anti-VEGF monoclonal antibody fragment and can recognize all VEGF-A isoforms (VEGF110, VEGF121, and VEGF165). Ranibizumab slows vision loss in vivo and is used for wet age-related macular degeneration (AMD) research.
  • HY-B0362A
    Phentolamine mesylate

    Phentolamine methanesulfonate

    Adrenergic Receptor Cardiovascular Disease Endocrinology
    Phentolamine mesylate (Phentolamine methanesulfonate) is a reversible, non-selective, and orally active blocker of α1 and α2 adrenergic receptor that expands blood vessels to reduce peripheral vascular resistance. Phentolamine mesylate can be used for the research of pheochromocytoma-related hypertension, heart failure and erectile dysfunction.
  • HY-123875A
    Ralaniten triacetate

    EPI-506

    Androgen Receptor Cancer
    Ralaniten triacetate (EPI-506), the pro-drug of Ralaniten, is a first-in-class, orally active androgen receptor (AR) N-terminal domain (NTD) inhibitor. Ralaniten triacetate shows activity against both full length and resistance-related AR species, including AR-v7.
  • HY-147747
    HSP90-IN-12

    HSP Cancer
    Among vibsanin a analogues, vibsanin a analog C (VAC) showed anti proliferative effect on various cancer cell lines, and the anti proliferative activity was the strongest among vibsanin a analogues. In addition, VAC fluctuated the amount of hsp90 related proteins in cells and inhibited hsp90 mediated protein refolding of luciferase in vitro.
  • HY-134313
    8-NH2-ATP

    8-Aminoadenosine-5'-O-triphosphate

    DNA/RNA Synthesis Endogenous Metabolite Metabolic Disease
    8-NH2-ATP, an inactive form of ATP, is produced by 8-NH2-Ado. 8-NH2-Ado is reported to be potent as shown by induction of apoptosis-related cleavage of poly (ADP-ribose) polymerase.
  • HY-109785A
    (R)-Gyramide A hydrochloride

    Infection
    (R)-Gyramide A hydrochloride is a bacterial DNA gyrase inhibitor that disrupts supercoiling activity with an IC50 value of 3.3 µM. (R)-Gyramide A hydrochloride demonstrates antibacterial activity against E. coli, P. aeruginosa, and S. enterica (MICs of 10-80 µM). (R)-Gyramide A hydrochloride does not affect the closely related enzyme topoisomerase IV.
  • HY-N0470S3
    L-Lysine-13C6,15N2 hydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-Lysine-13C6,15N2 hydrochloride is the 13C- and 15N-labeled L-Lysine hydrochloride. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-B1176S
    Equilin-d4

    7-Dehydroestrone-d4

    Estrogen Receptor/ERR Endocrinology
    Equilin-d4 (7-Dehydroestrone-d4) is the deuterium labeled Equilin. Equilin (7-Dehydroestrone) is an important member of the large group of oestrogenic substances and is chemically related to menformon (oestrone). Equilin increases the growth of cortical neurons via an NMDA receptor-dependent mechanism.
  • HY-N2098
    Obtusifolin

    NF-κB Cancer
    Obtusifolin, isolated from the seeds of Cassia obtusifolia, regulates the gene expression and production of MUC5AC mucin in airway epithelial cells via inhibiting NF-kB pathway. Obtusifolin suppresses phthalate esters-induced breast cancer bone metastasis by targeting parathyroid hormone-related protein.
  • HY-14759
    Aleplasinin

    PAZ-417

    PAI-1 Amyloid-β Neurological Disease
    Aleplasinin is an orally active, potent, BBB-penetrated and selectiveSERPINE1 (PAI-1, Plasminogen activator inhibitor-1) inhibitor. Aleplasinin increases amyloid-β (Aβ) catabolism and ameliorates amyloid-related pathology. Aleplasinin improves memory deficiency. Aleplasinin can be used for Alzheimer's disease research.
  • HY-19149
    Ro24-7429

    HIV Apoptosis Cancer Infection Inflammation/Immunology
    Ro24-7429 is a potent and orally active HIV-1 transactivator protein Tat antagonist. Ro24-7429 is also a runt-related transcription factor 1 (RUNX1) inhibitor. Ro24-7429 has anti-HIV, antifibrotic and anti-inflammatory effects.
  • HY-12866S
    Larotrectinib-d7

    LOXO-101-d7; ARRY-470-d7

    Trk Receptor Apoptosis Cancer
    Larotrectinib-d7 (LOXO-101-d7) is the deuterium labeled Larotrectinib. Larotrectinib (LOXO-101) is an ATP-competitive oral, selective inhibitor of the tropomyosin-related kinase (TRK) family receptors, with low nanomolar 50% inhibitory concentrations against all three isoforms (TRKA, B, and C).
  • HY-N1485
    Cycloastragenol

    Astramembrangenin; Cyclosieversigenin

    Telomerase Inflammation/Immunology Neurological Disease
    Cycloastragenol (Astramembrangenin), the active form of astragaloside IV, has anti-oxidant, anti-inflammatory, anti-aging, anti-apoptotic, and cardiovascular protective effects. Cycloastragenol is a potent telomerase activator and can lengthen telomeres. Cycloastragenol alleviates age-related bone loss and improves bone microstructure and biomechanical properties.
  • HY-142936
    RORγt modulator 3

    ROR Inflammation/Immunology Cancer Neurological Disease
    RORγt modulator 3 (Compound 23) is a modulator of retinoid-related orphan receptor γt (RORγt). RORγt modulator 3 can be used for the research of RORyt mediated diseases such as, e.g., pain, inflammation, COPD, asthma, rheumatoid arthritis, colitis, multiple sclerosis, psoriasis, neurodegenerative diseases and cancer.
  • HY-110184
    PK-THPP

    Potassium Channel Neurological Disease
    PK-THPP is a potent TWIK-related acid-sensitive K(+) ion channel (TASK-3 ion channel) blocker (IC50s are 35 nM and 300 nM for TASK-3 and TASK-1, respectively). PK-THPP increases breathing rate and induces respiratory alkalosis in rats.
  • HY-142699
    SSTR4 agonist 2

    Others Inflammation/Immunology
    SSTR4 agonist 2 is a potent agonist of somatostatin receptor subtype 4 (SSTR4). SSTR4 pathway inhibits nociceptive and inflammatory processes. SSTR4 agonist 2 has the potential for the research of medical disorders related to SSTR4 (extracted from patent WO2014184275A1, compound 107).
  • HY-112436A
    (3S,4R)-PF-6683324

    Trk Receptor Cancer Neurological Disease
    (3S,4R)-PF-6683324 is a tropomyosin-related kinase (Trk) inhibitor extracted from patent WO2015092610A1 example 9. (3S,4R)-PF-6683324 has the potential for the research of pain and cancer.
  • HY-101402
    Cyclo(his-pro)

    Cyclo(histidyl-proline); Histidylproline diketopiperazine

    NF-κB Endogenous Metabolite Inflammation/Immunology Neurological Disease
    Cyclo(his-pro) (Cyclo(histidyl-proline)) is an orally active cyclic dipeptide structurally related to tyreotropin-releasing hormone. Cyclo(his-pro) could inhibit NF-κB nuclear accumulation. Cyclo(his-pro) can cross the brain-blood-barrier and affect diverse inflammatory and stress responses.
  • HY-137605
    WSF1-IN-1

    Others Cancer
    WSF1-IN-1 (compound 136), an orally active WSF1 inhibitor, can be used in the study for WSF1 (Wolfram syndrome) related tumors, with IC50 values of 0.33 μM and >27 μM in HepG2 parental and HepG2 WFS1 KO cell lines, respectively.
  • HY-B0762S
    Acetyl-L-carnitine-d3 hydrochloride

    O-Acetyl-L-carnitine-d3 hydrochloride

    Endogenous Metabolite Neurological Disease
    Acetyl-L-carnitine-d3 (O-Acetyl-L-carnitine-d3) hydrochloride is the deuterium labeled Acetyl-L-carnitine hydrochloride. Acetyl-L-carnitine hydrochloride is a blood-brain permeable acetyl ester of the amino acid L-carnitine found in the body. Acetyl-L-carnitine hydrochloride is often used as a dietary supplement, and exibits anti-stress-related psychiatric disorders.
  • HY-16100
    BI 99179

    Fatty Acid Synthase (FASN) Cancer Metabolic Disease
    BI 99179 is a potent and selective type I fatty acid synthase (FAS) inhibitor with an IC50 of 79 nM. BI 99179 is a tool compound suitable for the in vivo validation of FAS as a target for lipid metabolism related diseases. BI 99179 exhibits significant exposure (both peripheral and central) upon oral administration in rats.
  • HY-128777
    WEHI-9625

    VDAC Apoptosis Cancer
    WEHI-9625 is a tricyclic sulfone, first-in-class inhibitor of apoptosis with an EC50 of 69 nM. WEHI-9625 binds to VDAC2 and promotes its ability to inhibit apoptosis driven by mouse BAK. WEHI-9625 is completely inactive against both human BAK and the closely related apoptosis effector BAX.
  • HY-B1558A
    Bifemelane hydrochloride

    MCI-2016

    Monoamine Oxidase Neurological Disease
    Bifemelane hydrochloride (MCI-2016) is a potent, selective and competitive inhibitor of monoamine oxidase A (MAO-A), with a Ki of 4.20 μM. Bifemelane hydrochloride also inhibits MAO-B noncompetitively with a Ki of 46.0 μM. Bifemelane hydrochloride has a potent antidepressant activity and can be used for the research of cognitive and emotional disturbances related to cerebrovascular disease.
  • HY-134494
    MS48107

    Others Neurological Disease
    MS48107 is a potent and selective positive allosteric modulator of G protein-coupled receptor 68 (GPR68). MS48107 is selective for GPR68 over the closely related proton GPCRs, neurotransmitter transporters, and hERG ion channels. MS48107 can readily cross the blood-brain barrier (BBB) in mice.
  • HY-11091
    Razaxaban hydrochloride

    BMS 561389 hydrochloride; DPC 906 hydrochloride

    Factor Xa Thrombin Cardiovascular Disease
    Razaxaban hydrochloride (BMS 561389 hydrochloride) is a highly potent, selective and orally active factor Xa inhibitor with a Ki of 0.19 nM. Razaxaban hydrochloride exhibits excellent selectivity (>5000-fold) for factor Xa over other related serine proteases. Razaxaban hydrochloride is also a potent thrombin inhibitor with a Ki of 540 nM. Razaxaban hydrochloride has strongly antithrombotic activity.
  • HY-15615A
    TIC10

    ONC-201

    TNF Receptor Apoptosis Cancer
    TIC10 (ONC-201) is a potent, orally active, and stable tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) inducer which acts by inhibiting Akt and ERK, consequently activating Foxo3a and significantly inducing cell surface TRAIL. TIC10 can cross the blood-brain barrier.
  • HY-19820A
    NSC45586 sodium

    Others Neurological Disease
    NSC45586 sodium is an inhibitor of pleckstrin homology domain and leucine-rich repeat protein phosphatase (PHLPP). NSC45586 sodium targets the PP2C phosphatase domain in PHLPP1 and PHLPP2. NSC45586 sodium can activate AKT in neurons.
  • HY-N10378
    Rubrofusarin 6-O-β-D-glucopyranoside

    Phosphatase Metabolic Disease Neurological Disease
    Rubrofusarin 6-O-β-D-glucopyranoside, the glycoside of Rubrofusarin, is a protein tyrosine phosphatase 1B (PTP1B) inhibitor with the IC50 of 87.36 μM. Rubrofusarin 6-O-β-D-glucopyranoside can be used for the research of comorbid diabetes and depression.
  • HY-B0305
    Roxatidine acetate

    Histamine Receptor Cancer Metabolic Disease Inflammation/Immunology
    Roxatidine acetate is a potent, selective, competitive and orally active histamine H2-receptor antagonist. Roxatidine acetate has antisecretory potency against gastric acid secretion. Roxatidine acetate can also suppress inflammatory responses and can be used for gastric and duodenal ulcers research. Roxatidine acetate has antitumor activity.
  • HY-143614
    THR-β agonist 3

    Others Metabolic Disease
    THR-β agonist 3 is a potent agonist of THR-β. THR-β agonist 3 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021129827A1, compound 6).
  • HY-136186
    (S,R,S)-AHPC-C7-amine

    VH032-C7-amine

    E3 Ligase Ligand-Linker Conjugates Cancer
    (S,R,S)-AHPC-C7-amine (VH032-C7-amine) is a synthesized E3 ligase ligand-linker conjugate that incorporates the VH032 based VHL ligand and a linker used for estrogen-related receptor α (ERRα) PROTAC degrader.
  • HY-126351
    PROTAC ERRα ligand 2

    Estrogen Receptor/ERR Cancer
    PROTAC ERRα ligand 2 is an estrogen-related receptor α (ERRα) inverse agonist with an IC50 of 5.67 nM. PROTAC ERRα ligand 2 (IC50=5.67 nM) displays a ~11-fold improved potency than XCT790 (IC50=61.3 nM).
  • HY-147663
    hCAIX-IN-6

    Carbonic Anhydrase Cancer
    Compounds 6B and 14g showed significant inhibitory effect on tumor related subtype HCA IX with low nanomolar potency, while 6K was effective on HCA XII. Compounds 6B, 14g and 6K can be considered as the leading molecules for the development of future cancer therapeutic drugs based on new mechanisms of action.
  • HY-143613
    THR-β agonist 2

    Others Metabolic Disease
    THR-β agonist 2 is a potent agonist of THR-β. THR-β agonist 2 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021121210A1, compound 3).
  • HY-B0146
    Verteporfin

    CL 318952

    YAP Apoptosis Autophagy Cancer
    Verteporfin (CL 318952) is a photosensitizer for photodynamic therapy to eliminate the abnormal blood vessels in the eye associated with conditions such as age-related macular degeneration. Verteporfin is a YAP inhibitor which disrupts YAP-TEAD interactions. Verteporfin induces cell apoptosis. Verteporfinis an autophagy inhibitor that blocks autophagy at an early stage by inhibiting autophagosome formation.
  • HY-139308
    T0467

    Mitochondrial Metabolism Neurological Disease
    T0467 activates parkin mitochondrial translocation in a PINK1-dependent manner in vitro. T0467 do not induce mitochondrial accumulation of PINK1in dopaminergic neurons. T0467 is a potential compound for PINK1-Parkin signaling activation, and can be used for parkinson's disease and related disorders research.
  • HY-N0728
    α-Linolenic acid

    PI3K Akt Cancer Cardiovascular Disease
    α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
  • HY-142935
    RORγt modulator 2

    ROR Inflammation/Immunology Cancer Neurological Disease
    RORγt modulator 2 (Compound 21) is a modulator of retinoid-related orphan receptor γt (RORγt) with the IC50 of <50 nM. RORγt modulator 2 can be used for the research of RORyt mediated diseases such as, e.g., pain, inflammation, COPD, asthma, rheumatoid arthritis, colitis, multiple sclerosis, psoriasis, neurodegenerative diseases and cancer.
  • HY-133556
    IQZ23

    AMPK Metabolic Disease
    IQZ23 inhibits adipocyte differentiation via AMPK pathway activation. IQZ23 exerts a high efficacy in decreasing the triglyceride level (EC50=0.033 μM) in 3T3-L1 adipocytes. IQZ23 could be used for the research of obesity and related metabolic disorders.
  • HY-125919
    Vulpinic acid

    Reactive Oxygen Species Bacterial Endogenous Metabolite Infection Inflammation/Immunology
    Vulpinic acid, a lichen metabolite, decreases H2O2-induced ROS production, oxidative stress and oxidative stress-related damages in human umbilical vein endothelial cells (HUVEC). Vulpinic acid is active against staphylococci, enterococci, and anaerobic bacteria.Vulpinic acid has the potential for atherosclerosis research.
  • HY-146521
    TRK-IN-15

    Trk Receptor Cancer
    TRK-IN-15 is a potent inhibitor of TRK. Protein kinases play a critical role in the control of cell growth and differentiation and are responsible for the control of a wide variety of cellular signal transduction processes. TRK-IN-15 has the potential for the research of TRK-related diseases (extracted from patent WO2012034091A1, compound X-55).
  • HY-114043
    NCGC00092410

    Glucosidase Metabolic Disease
    NCGC00092410 is a potent, selective, and nonsugar glucocerebrosidase (GC) inhibitor, with an IC50 of 31 nM. NCGC00092410 shows no activity against the related hydrolases at concentrations up to 77 μM. NCGC00092410, a GC chaperone, and increases the activity and lysosomal localization of glucocerebrosidase in mutant cell lines. NCGC00092410 can be used for the research of Gaucher disease.
  • HY-150555
    P-CAB agent 1

    Potassium Channel Others
    P-CAB agent 1 (compound B19) is a highly potent potassium-competitive acid blocker agent with an IC50 value of 60.50 nM for H +/K +-ATPase. P-CAB agent 1 has acceptable oral absorption in rats. P-CAB agent 1 can be used for researching acid-related disorders (ARDs).
  • HY-121750
    CCG-222740

    Ras ROCK Cancer
    CCG-222740 is an orally active and selective Rho/myocardin-related transcription factor (MRTF) pathway inhibitor. CCG-222740 is also a potent inhibitor of alpha-smooth muscle actin protein expression. CCG-222740 effectively reduces fibrosis in skin and blocks melanoma metastasis.
  • HY-135111
    4-Desmethoxy Omeprazole

    Drug Metabolite Cancer Infection Metabolic Disease
    4-Desmethoxy Omeprazole is the active metabolite of Omeprazole. Omeprazole, a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.
  • HY-146522
    TRK-IN-16

    Trk Receptor Cancer
    TRK-IN-16 is a potent inhibitor of TRK. Protein kinases play a critical role in the control of cell growth and differentiation and are responsible for the control of a wide variety of cellular signal transduction processes. TRK-IN-16 has the potential for the research of TRK-related diseases (extracted from patent WO2012034091A1, compound X-21).
  • HY-13302
    CP-547632

    VEGFR FGFR Cancer
    CP-547632 is an orally active, ATP-competitive and potent VEGFR-2 and FGF kinases inhibitor with IC50s of 11 nM and 9 nM, respectively. CP-547632 is selective for VEGFR2 and bFGF over EGFR, PDGFRβ, and related tyrosine kinases (TKs). CP-547632 has antitumor efficacy.
  • HY-146519
    TRK-IN-14

    Trk Receptor Cancer
    TRK-IN-14 is a potent inhibitor of TRK. Protein kinases play a critical role in the control of cell growth and differentiation and are responsible for the control of a wide variety of cellular signal transduction processes. TRK-IN-14 has the potential for the research of TRK-related diseases (extracted from patent WO2012034091A1, compound X-47).
  • HY-114657A
    Benproperine phosphate

    Arp2/3 Complex Cancer Inflammation/Immunology
    Benproperine phosphate is an orally active, potent actin-related protein 2/3 complex subunit 2 (ARPC2) inhibitor. Benproperine phosphate attenuates the actin polymerization rate of action polymerization nucleation by impairing Arp2/3 function. Benproperine phosphate has the potential for a cough suppressant and suppresses cancer cell migration and tumor metastasis.
  • HY-P1305A
    CART(55-102)(rat) TFA

    Neuropeptide Y Receptor Neurological Disease
    CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior.
  • HY-13302B
    CP-547632 hydrochloride

    VEGFR FGFR Cancer
    CP-547632 hydrochloride is an orally active, ATP-competitive and potent VEGFR-2 and FGF kinases inhibitor with IC50s of 11 nM and 9 nM, respectively. CP-547632 hydrochloride is selective for VEGFR2 and bFGF over EGFR, PDGFRβ, and related tyrosine kinases (TKs). CP-547632 hydrochloride has antitumor efficacy.
  • HY-108586
    NS3623

    Potassium Channel Neurological Disease
    NS3623 is an activator of human ether-a-go-go-related gene (hERG1/KV11.1) potassium channels. NS3623 activates the IKr and Ito currents and has antiarrhythmic effect. NS3623 has a dual mode of action, being an inhibitor of hERG1 channels.
  • HY-145086
    R-PSOP

    Others Metabolic Disease
    R-PSOP is highly potent and selective nonpeptidic NMUR2 antagonist. R-PSOP binds to NMUR2 with the Kis of 52 and 32 nM for the human and rat NMUR2, respectively. R-PSOP shows moderate CNS penetration. R-PSOP can be used for the research of the eating disorders, obesity, pain, and stress-related disorders.
  • HY-147108
    Mitochondria degrader-1

    Mitochondrial Metabolism Cancer Metabolic Disease Inflammation/Immunology Neurological Disease
    Mitochondria degrader-1 (example 5) is a potent mitochondria degrader. Mitochondria degrader-1 induces the degradation of the injured mitochondria by the autophagy mechanism. Mitochondria degrader-1 can be used for the research of neurodegenerative disease, cancer, inflammatory disease, age-related disease, metabolic disease, mitochondrial disease or Down's disease.
  • HY-146518
    TRK-IN-13

    Trk Receptor Cancer
    TRK-IN-13 is a potent inhibitor of TRK. Protein kinases play a critical role in the control of cell growth and differentiation and are responsible for the control of a wide variety of cellular signal transduction processes. TRK-IN-13 has the potential for the research of TRK-related diseases (extracted from patent WO2012034091A1, compound X-24).
  • HY-B0762S1
    Acetyl-L-carnitine-d3-1 hydrochloride

    O-Acetyl-L-carnitine-d3-1 hydrochloride

    Endogenous Metabolite Neurological Disease
    Acetyl-L-carnitine-d3-1 (O-Acetyl-L-carnitine-d3-1) hydrochloride is the deuterium labeled Acetyl-L-carnitine hydrochloride. Acetyl-L-carnitine hydrochloride is a blood-brain permeable acetyl ester of the amino acid L-carnitine found in the body. Acetyl-L-carnitine hydrochloride is often used as a dietary supplement, and exibits anti-stress-related psychiatric disorders.
  • HY-142917
    THR-β agonist 4

    Others Metabolic Disease
    THR-β agonist 4 is a potent agonist of THR-β. THR-β agonist 4 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021143706A1, compound 72).
  • HY-P1858
    Urocortin III, mouse

    CRFR Neurological Disease Cardiovascular Disease Endocrinology
    Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.
  • HY-101030A
    MBM-17S

    Apoptosis Cancer
    MBM-17S is a potent NIMA-related kinase 2 (Nek2) inhibitor, with an IC50 of 3 nM. MBM-17S effectively inhibits the proliferation of cancer cells by inducing cell cycle arrest and apoptosis. MBM-17S shows antitumor activities, and no obvious toxicity to mice.
  • HY-147564
    RET-IN-18

    RET Cancer Neurological Disease
    RET-IN-18 is a pyridone compound. is a potent inhibitor of RET. RET-IN-18 is a potent inhibitor of RET. RET-IN-18 has the potential for the research of diseases related to irritable bowel syndrome (IBS) and other gastrointestinal disorders, as well as cancers, and neurodegenerative diseases (extracted from patent WO2022017524A1, compound 1).
  • HY-123940
    SGC-AAK1-1

    Others Cancer
    SGC-AAK1-1 is a potent and selective AAK1 (AP2 associated kinase 1) inhibitor with an IC50 of 270 nM and a Ki of 9 nM. SGC-AAK1-1 also potently inhibits BMP2K. SGC-AAK1-1 is used to study Wnt pathway related to AAK1.
  • HY-143714
    Cathepsin K inhibitor 2

    Cathepsin Inflammation/Immunology
    Cathepsin K inhibitor 2 is a potent inhibitor of cathepsin K. Cathepsin K, Cat K is a cysteine protease expressed under the control of CTSK gene and closely related to osteoporosis, whose main function is to hydrolyze collagen. Cathepsin K inhibitor 2 has the potential for the research of osteoarthfitis (extracted from patent WO2021147882A1, compound 78).
  • HY-143583
    ATX inhibitor 10

    Others Cancer Neurological Disease
    ATX inhibitor 10 is a potent inhibitor of ATX. ATX inhibitor 10 is s nitrogen-containing heterocyclic compound. ATX plays a role in causing pathological conditions including fibrosis, arthritis, neurodegeneration, neuropathic pain, and cancer. ATX inhibitor 10 has the potential for the research of ATX related diseases (extracted from patent WO2021115375A1, compound 35).
  • HY-145997
    MRGPRX4 modulator-1

    Others Inflammation/Immunology
    MRGPRX4 modulator-1 (compound 31-2) is a potent mas-related g-protein receptor X4 (MRGPR X4) modulator, with antagonist activity of IC50 < 100 nM for MRGPR4. MRGPRX4 modulator-1 can be used for researching MRGPR X4 dependent diseases such as itch, pain, and autoimmune disorders.
  • HY-14422
    SR1078

    ROR Cancer
    SR1078 is a selective agonist of retinoic acid receptor-related orphan receptor α/γ (RORα/RORγ). SR1078 directly binds to the ligand binding domain of RORα and RORγ and increases the transcriptional activity of these receptors, leading to stimulation of RORα/γ target gene transcription.
  • HY-139973
    OAB-14

    Others Neurological Disease
    OAB-14, is a Bexarotene (HY-14171) derivative, improves Alzheimer's disease-related pathologies and cognitive impairments by increasing β-amyloid clearance in APP/PS1 mice. OAB-14 effectively ameliorates the dysfunction of the endosomal-autophagic-lysosomal pathway in APP/PS1 transgenic mice.
  • HY-111226
    GSK5182

    Estrogen Receptor/ERR Reactive Oxygen Species Cancer Cardiovascular Disease
    GSK5182 is a highly selective and orally active inverse agonist of estrogen-related receptor γ (ERRγ) with an IC50 of 79 nM. GSK5182 does not interact with other nuclear receptors, including ERRα or ERα. GSK5182 also induces reactive oxyen species (ROS) generation in hepatocellular carcinoma (HCC).
  • HY-144425
    BSc5367

    Others Inflammation/Immunology
    BSc5367 is a potent Nek1 inhibitor with an IC50 of 11.5 nM. NIMA-related protein kinase Nek1 is crucially involved in cell cycle regulation, DNA repair and microtubule regulation and dysfunctions of Nek1 play key roles in amyotrophic lateral sclerosis (ALS), polycystic kidney disease (PKD) and several types of radiotherapy resistant cancer.
  • HY-101402A
    Cyclo(his-pro) TFA

    Cyclo(histidyl-proline) TFA; Histidylproline diketopiperazine TFA

    NF-κB Endogenous Metabolite Inflammation/Immunology Neurological Disease
    Cyclo(his-pro) TFA (Cyclo(histidyl-proline) TFA) is an orally active cyclic dipeptide structurally related to tyreotropin-releasing hormone. Cyclo(his-pro) TFA could inhibit NF-κB nuclear accumulation. Cyclo(his-pro) TFA can cross the brain-blood-barrier and affect diverse inflammatory and stress responses.
  • HY-13204B
    Biperiden lactate

    KL 373 lactate

    mAChR Neurological Disease
    Biperiden (KL 373) lactate is an orally active non-selective muscarinic receptor antagonist that competitively binds to M1 muscarinic receptors. Biperiden (KL 373) lactate inhibits acetylcholine and enhances dopamine signaling in the central nervous system. Biperiden (KL 373) lactate has the potential for the research of Parkinson's disease and other related psychiatric disorders.
  • HY-P1858A
    Urocortin III, mouse TFA

    CRFR Neurological Disease Cardiovascular Disease Endocrinology
    Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics.
  • HY-107529
    TC-G 24

    GSK-3 Metabolic Disease Neurological Disease
    TC-G 24 (Compound 24) is a potent, selective glycogen synthase kinase-3β (GSK-3β) inhibitor with an IC50 of 17.1 nM. TC-G 24 can cross the BBB and can be used for studying many diseases such as type 2 diabetes mellitus, stroke, Alzheimer, and other related diseases.
  • HY-111424
    BDP9066

    Ras Cancer
    BDP9066 is a potent and selective myotonic dystrophy-related Cdc42-binding kinase MRCK inhibitor with an IC50 of 64 nM for MRCKβ in SCC12 cells, Ki values of 0.0136 nM and 0.0233 nM for MRCKα/β in house determinations, respectively. BDP9066 has therapeutic effect on skin cancer by reducing substrate phosphorylation.
  • HY-12828A
    KH-CB20

    CDK DYRK Infection Neurological Disease
    KH-CB20, an E/Z mixture, is a potent and selective inhibitor of CLK1 and the closely related isoform CLK4, with an IC50 of 16.5 nM for CLK1. KH-CB20 can also inhibit DYRK1A (IC50=57.8 nM) and CLK3 (IC50=488 nM).
  • HY-77048
    IRAK-4 protein kinase inhibitor 2

    IRAK Inflammation/Immunology
    IRAK-4 protein kinase inhibitor 2 (compound 1) is a potent inhibitor of interleukin-1 (IL-1) receptor-associated kinase-4 (IRAK-4), with an IC50 of 4 μM. IRAK-4 protein kinase inhibitor 2 can be used for the research of inflammatory and immune-related conditions or disorders.
  • HY-114302
    CCB02

    Microtubule/Tubulin Cancer
    CCB02 is a selective CPAP-tubulin interaction inhibitor, binding to tubulin and competing for the CPAP binding site of β-tubulin, with an IC50 of 689 nM, and shows potent anti-tumor activity. CCB02 shows no inhibition on the cell cycle- and centrosome-related kinases, or the phosphorylation status of Aurora A, Plk1, Plk2, CDK2, and CHK1.
  • HY-16918
    Heptamidine

    SBi4211

    Others Cancer Inflammation/Immunology
    Heptamidine (SBi4211) is a potent Pentamidine-related inhibitor of the calcium-binding protein S100B (Kd=6.9 μM), selectively kills melanoma cells with S100B over those without S100B. Heptamidine is a useful tool for the investigation of Myotonic dystrophy (DM).
  • HY-124822
    COH-SR4

    AMPK Cancer Metabolic Disease
    COH-SR4 is an AMPK activator. COH-SR4 shows potent anti-proliferative activities against leukemia, melanoma, breast and lung cancers. COH-SR4 inhibits adipocyte differentiation via AMPK activation. COH-SR4 can be used for the research of obesity and related metabolic disorders.
  • HY-150606
    ERK5-IN-4

    ERK Cancer
    ERK5-IN-4 (compound 34b) is a potent and selective inhibitor of extracellular signal-related kinase 5 (ERK5). ERK5-IN-4 inhibits ERK5 (full-length) and truncated ERK5 (ERK5 ΔTAD) kinase activity in HEK293 cells with an IC50 of 77 nM and 300 nM, respectively.
  • HY-N6716
    Filipin complex

    Fungal Antibiotic Others
    Filipin, produced as a mixture of related compounds known as the filipin complex (filipins I-IV) in nature, is a 28-membered ring pentaene macrolide antifungal antibiotic produced by S. filipinensis, S. avermitilis and S. miharaensis. Filipin interacts with membrane sterols causing the alteration of membrane structure. Filipin III is the major component of Filipin.
  • HY-N0470S1
    L-Lysine-13C6,15N2,d9 dihydrochloride

    Virus Protease Endogenous Metabolite Infection Endocrinology Inflammation/Immunology Cardiovascular Disease
    L-Lysine-13C6,15N2,d9 dihydrochloride is the deuterium, 13C-, and 15-labeled L-Lysine hydrochloride. L-lysine hydrochloride is an essential amino acid for humans with various benefits including treating herpes, increasing calcium absorption, reducing diabetes-related illnesses and improving gut health.
  • HY-D0961
    Gallocyanine chloride

    Wnt Neurological Disease
    Gallocyanine chloride, a synthetic blue dyestuff, blocks DKK1 inhibitory activity by disrupting DKK1/LRP6 interaction. Its association with LRP6 is weak (IC50 of about 3 μM in the inhibition of DKK1 binding). Gallocyanine dye acts as a potential agent for the research of Alzheimer's disease and related neurodegenerative tauopathies.
  • HY-145438
    Antitumor agent-38

    Cancer
    Antitumor agent-38 is a potent antitumor agents. Antitumor agent-38 shows antiproliferative activity for cancer cells. Antitumor agent-38 induces cell cycle arrest at the late S and G2/M phase without interfering with microtubule formation or cell morphology.
  • HY-115929
    DENV-IN-4

    DNA/RNA Synthesis Infection
    DENV-IN-4 is a potent DENV inhibitor (DENV EC50=4.79 μM, Vero CC50>100 μM, SI>20.9). DENV-IN-4 can inhibit the expression level of DENV2 with concentration-dependence and reduce RNA-dependent RNA polymerase (RdRp) enzymatic activity. DENV-IN-4 has antiviral effect.
  • HY-108307
    Micronomicin sulfate

    Gentamicin C2b sulfate; Antibiotic XK-62-2 sulfate; Sagamicin sulfate

    Antibiotic Bacterial Infection
    Micronomicin sulfate (Gentamicin C2b sulfate) is an aminoglycoside antibiotic isolated from Micromonospora. Micronomicin sulfate is a broad-spectrum antibiotic close to the gentamicin-type antibiotics, exhibits a high activity against Pseudomonas, Proteus, Klebsiella pneumoniae, Serratia, etc (MIC=0.001-8.3 μg/ml).
  • HY-131448
    A3334

    Others Metabolic Disease
    A3051 is a potent and orally active inhibtor of CXXC5-DVL extracted from patent WO2020079569, has an IC50 of 63.06 nM. A3334 can be used for the research of high fat diet (HFD)-induced and methionine-choline deficient diet (MCD)-induced phenotypes such as obesity, diabetes, and NASH.
  • HY-120159
    GS-493

    Phosphatase Cancer
    GS-493 is a selective protein tyrosine phosphatase SHP2 (PTPN11) inhibitor with an IC50 of 71 nM. GS-493 is 29- and 45-fold more active toward SHP2 than related SHP1 and PTP1B. GS-493 blocks cellular motility and growth of cancer cells. Antitumor activity.
  • HY-116423A
    JH295 hydrate

    Others Cancer
    JH295 hydrate is a potent, irreversible and selective NIMA-related kinase 2 (Nek2) inhibitor with an IC50 of 770 nM. JH295 hydrate inhibits cellular Nek2 via alkylation of Cys22. JH295 hydrate is inactive against the mitotic kinases, Cdk1, Aurora B or Plk1, and does not perturb bipolar spindle assembly or the spindle assembly checkpoint.
  • HY-110019
    Indatraline hydrochloride

    Lu 19-005

    Serotonin Transporter Dopamine Transporter Neurological Disease
    Indatraline hydrochloride (Lu 19-005) is a non-selective monoamine transporter inhibitor that blocks the reuptake of neurotransmitters (dopamine, serotonin, and norepinephrine) with efficacy similar to cocaine. Indatraline hydrochloride can be used for the research of antidepressive. Indatraline hydrochloride induces autophagy while simultaneously inhibiting cell proliferation. Indatraline hydrochloride may also serve to direct the development of new agents for autophagy-related diseases such as atherosclerosis or restenosis.
  • HY-136187
    (S,R,S)-AHPC-C5-NH2

    VH032-C5-NH2

    E3 Ligase Ligand-Linker Conjugates Cancer
    (S,R,S)-AHPC-C5-NH2 (VH032-C5-NH2) is a synthesized E3 ligase ligand-linker conjugate that incorporates the VH032 based VHL ligand and a linker used for estrogen-related receptor α (ERRα) PROTAC degrader.
  • HY-15847
    HS38

    DAPK Cardiovascular Disease
    HS38 is a potent, selective, and ATP-competitive inhibitor of death-associated protein kinase 1 (DAPK1) and zipper-interacting protein kinase (ZIPK, also called DAPK3), with Kds of 300 nM and 280 nM, respectively. HS38 is also a PIM3 inhibitor with an IC50 of 200 nM. HS38 can be used for the research of smooth muscle related disorders.
  • HY-14892
    Gemigliptin

    LC15-0444

    Dipeptidyl Peptidase Metabolic Disease
    Gemigliptin (LC15-0444 ) is a highly selective, reversible and competitive dipeptidyl peptidase-4 (DPP-4) inhibitor, with an IC50 of 10.3 nM for human recombinant DPP-4. Gemigliptin exhibits potent anti-glycation properties. Gemigliptin can be used for the research of advanced glycation end products (AGE)-related diabetic complications.
  • HY-16918A
    Heptamidine dimethanesulfonate

    SBi4211 dimethanesulfonate

    Others Cancer Inflammation/Immunology
    Heptamidine dimethanesulfonate (SBi4211 dimethanesulfonate) is a potent Pentamidine-related inhibitor of the calcium-binding protein S100B (Kd=6.9 μM), selectively kills melanoma cells with S100B over those without S100B. Heptamidine is a useful tool for the investigation of Myotonic dystrophy (DM).
  • HY-117833
    PXS-4681A

    Monoamine Oxidase Inflammation/Immunology
    PXS-4681A is a potent, selective, irreversible and orally active semicarbazide-sensitive amine oxidase (SSAO; VAP-1) inhibitor with a Ki of 37 nM. PXS-4681A shows highly selectivity over related amine oxidases, ion channels, and seven-transmembrane domain receptors. PXS-4681A has anti-inflammatory effects.
  • HY-12649
    Y16

    Ras Cancer
    Y16 is a specific inhibitor of Leukemia-associated Rho guanine nucleotide exchange factor (LARG) with a Kd value of 76 nM. Y16 is active in blocking the interaction of LARG and related G-protein-coupled Rho GEFs with RhoA. Y16 shows no detectable effect on other diffuse B-cell lymphoma (Dbl) family Rho GEFs, Rho effectors, or a RhoGAP.
  • HY-P1376A
    G-Protein antagonist peptide TFA

    mAChR Adrenergic Receptor Endocrinology
    G-Protein antagonist peptide TFA is a truncated substance P-related peptide, competes with receptor for G protein binding. G-Protein antagonist peptide TFA inhibits the activation of Gi or Go by M2 muscarinic cholinergic receptor (M2 mAChR) or of Gs by beta-adrenergic receptor in the reconstituted phospholipid vesicles, assayed by receptor-promoted GTP hydrolysis.
  • HY-B0113S
    Omeprazole-d3

    H 16868-d3

    Proton Pump Bacterial Autophagy Cancer Infection Metabolic Disease
    Omeprazole D3 (H 16868 D3) is deuterium labeled Omeprazole. Omeprazole, a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.
  • HY-13302C
    CP-547632 TFA

    VEGFR FGFR Cancer
    CP-547632 TFA is an orally active, ATP-competitive and potent VEGFR-2 and FGF kinases inhibitor with IC50s of 11 nM and 9 nM, respectively. CP-547632 TFA is selective for VEGFR2 and bFGF over EGFR, PDGFRβ, and related tyrosine kinases (TKs). CP-547632 TFA has antitumor efficacy.
  • HY-N6246
    Asperulosidic Acid

    NF-κB ERK Cancer Inflammation/Immunology
    Asperulosidic Acid (ASPA), a bioactive iridoid glycoside, is extracted from the herbs of Hedyotis diffusa Willd. Asperulosidic Acid (ASPA) has anti-tumor, anti-oxidant, and anti-inflammatory activities. ASPA is related to the inhibition of inflammatory cytokines (TNF-α, IL-6) and mediators via suppression of the NF-κB and mitogen-activated protein kinase (MAPK) signaling pathways.
  • HY-15295
    Vonoprazan Fumarate

    TAK-438

    Proton Pump Metabolic Disease
    Vonoprazan Fumarate (TAK-438), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan Fumarate inhibits H +,K +-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan Fumarate is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease.
  • HY-103377
    Antalarmin hydrochloride

    Others Endocrinology Inflammation/Immunology
    Antalarmin (hydrochloride) is a non-peptide corticotropin-releasing hormone receptor 1 (CRHR1) antagonist with a Ki of 1 nM. Antalarmin hydrochloride suppresses CRH-induced ACTH secretion and blocks CRH and novelty induced anxiety-like behavior in animal models. Antalarmin hydrochloride produces anti-inflammatory effects in arthritis models, and suppresses stress-induced gastric ulceration related to irritable bowel syndrome.
  • HY-143656
    SH379

    Autophagy Endocrinology
    SH379 is the derivative of 2-methylpyrimidine-fused tricyclic diterpene. SH379 is a potent and orally active anti-late-onset hypogonadism agent. SH379 significantly promotes the expression of the key testosterone synthesis-related enzymes StAR and 3β-HSD. SH379 stimulates autophagy through regulating AMPK/mTOR signaling pathway.
  • HY-12959A
    Repinotan hydrochloride

    BAY x 3702

    5-HT Receptor Neurological Disease
    Repinotan hydrochloride (BAY x 3702) is a potent, selective, brain-penetrant and orally active 5-HT1A receptor agonist, with Ki values of 0.19 nM (calf hippocampus), 0.25 nM (rat and human cortex), and 0.59 nM (rat hippocampus Repinotan hydrochloride has a weak affinity for other related receptors. Repinotan hydrochloride has pronounced neuroprotective effects.
  • HY-116423
    JH295

    Others Cancer
    JH295 is a potent, irreversible and selective NIMA-related kinase 2 (Nek2) inhibitor with an IC50 of 770 nM. JH295 inhibits cellular Nek2 via alkylation of Cys22. JH295 is inactive against the mitotic kinases, Cdk1, Aurora B or Plk1, and does not perturb bipolar spindle assembly or the spindle assembly checkpoint.
  • HY-B0389A
    D-Glucose-13C6

    Glucose-13C6; D-(+)-Glucose-13C6; Dextrose-13C6

    Endogenous Metabolite Metabolic Disease
    D-Glucose-13C6 (Glucose-13C6) is a tracer used to trace glucose-related synthetic catabolism, is a low-cost alternative with the significant advantage that the sixth isotope of natural glucose has virtually zero natural abundance, which facilitates isotopomer analysis with <1% labeled glucose in the infusate.
  • HY-147584
    BTK-IN-14

    Btk Cancer Inflammation/Immunology
    BTK-IN-14 is a potent inhibitor of BTK. BTK plays an important role in signaling mediated by B cell antigen receptor (BCR) and Fcγreceptor (FcγR) in B cells and myeloid cells, respectively. BTK-IN-14 has the potential for the research of related diseases, especially autoimmune diseases, inflammatory diseases or cancer (extracted from patent WO2022057894A1, compound 1).
  • HY-13814
    PR-619

    Deubiquitinase Autophagy Apoptosis Cancer
    PR-619 is a broad-range and reversible DUB inhibitor with EC50s of 3.93, 4.9, 6.86, 7.2, and 8.61 μM for USP4, USP8, USP7, USP2, and USP5, respectively. PR-619 induces ER Stress and ER-Stress related apoptosis.
  • HY-16926
    CK-666

    Arp2/3 Complex HIV Cancer Infection
    CK-666 is a cell-permeable actin-related protein Arp2/3 complex inhibitor (IC50=12 μM). CK-666 binds to Arp2/3 complex, stabilizes the inactive state of the complex, blocking movement of the Arp2 and Arp3 subunits into the activated filament-like (short pitch) conformation.
  • HY-50895B
    Gefitinib dihydrochloride

    ZD 1839 dihydrochloride

    EGFR Autophagy Apoptosis Cancer
    Gefitinib (ZD 1839) dihydrochloride is a potent, selective and orally active EGFR tyrosine kinase inhibitor with an IC50 of 33 nM. Gefitinib dihydrochloride selectively inhibits EGF-stimulated tumor cell growth (IC50 of 54 nM) and blocks EGF-stimulated EGFR autophosphorylation in tumor cells. Gefitinib dihydrochloride also induces autophagy and cell apoptosis, which can be used for cancer related research, such as Lung cancer and breast cancer .
  • HY-120785
    SR1555

    ROR Inflammation/Immunology
    SR1555 is a specific retinoic acid receptor-related orphan nuclear receptor γ (RORγ) inverse agonist with an IC50 value of 1 μM. SR1555 not only inhibits TH17 cell development and function but also increases the frequency of T regulatory cells, as well as inhibits the expression of IL-17. SR1555 can be used for researching autoimmune diseases.
  • HY-142441
    THR-β agonist 1

    Others Endocrinology
    THRβ Agonist 1 is a potent and selective agonist of THRβ. Thyroid hormone receptor mediates the physiological activity of thyroid hormones which plays a key role in normal growth and development of the body and in maintaining metabolic balance. THRβ Agonist 1 has the potential for the research of thyroid hormone receptor-related diseases (extracted from patent WO2021104288A1, compound 2).
  • HY-114491A
    Rineterkib hydrochloride

    ERK Raf Cancer
    Rineterkib hydrochloride (compound B) is an orally available ERK1 and ERK2 inhibitor in the treatment of a proliferative disease characterized by activating mutations in the MAPK pathway. The activity is particularly related to the treatment of KRAS-mutant NSCLC, BRAF-mutant NSCLC, KRAS-mutant pancreatic cancer, KRAS-mutant colorectal cancer (CRC) and KRAS-mutant ovarian cancer. Rineterkib hydrochloride can also inhibit RAF.
  • HY-12959
    Repinotan

    BAY x 3702 free base

    5-HT Receptor Neurological Disease
    Repinotan (BAY x 3702 free base) is a potent, selective, brain-penetrant and orally active 5-HT1A receptor agonist, with Ki values of 0.19 nM (calf hippocampus), 0.25 nM (rat and human cortex), and 0.59 nM (rat hippocampus). Repinotan has a weak affinity for other related receptors. Repinotan has pronounced neuroprotective effects.
  • HY-B0528A
    Octopamine hydrochloride

    (±)-p-Octopamine hydrochloride

    Adrenergic Receptor Endogenous Metabolite Neurological Disease Endocrinology
    Octopamine ((±)-p-Octopamine) hydrochloride, a biogenic monoamine structurally related to noradrenaline, acts as a neurohormone, a neuromodulator and a neurotransmitter in invertebrates. Octopamine hydrochloride can stimulate alpha2-adrenoceptors (ARs) in Chinese hamster ovary cells transfected with human alpha2-ARs. Octopamine hydrochloride increased glycogenolysis, glycolysis, oxygen uptake, gluconeogenesis and the portal perfusion pressure.
  • HY-18054
    BVT 2733

    Others Inflammation/Immunology
    BVT 2733 is a potent, selective, and orally active non-steroidal 11β-hydroxydehydrogenase 1 (11β-HSD1) inhibitor. BVT 2733 is potently against the mouse enzyme (IC50=96 nM) over the human enzyme (IC50=3341 nM). BVT 2733 has the potential for the study of arthritis and obesity related disease.
  • HY-114491
    Rineterkib

    ERK Raf Cancer
    Rineterkib (compound B) is an orally available ERK1 and ERK2 inhibitor in the treatment of a proliferative disease characterized by activating mutations in the MAPK pathway. The activity is particularly related to the treatment of KRAS-mutant NSCLC, BRAF-mutant NSCLC, KRAS-mutant pancreatic cancer, KRAS-mutant colorectal cancer (CRC) and KRAS-mutant ovarian cancer. Rineterkib hydrochloride can also inhibit RAF.
  • HY-50895
    Gefitinib

    ZD1839

    EGFR Autophagy Apoptosis Cancer
    Gefitinib (ZD1839) is a potent, selective and orally active EGFR tyrosine kinase inhibitor with an IC50 of 33 nM. Gefitinib selectively inhibits EGF-stimulated tumor cell growth (IC50 of 54 nM) and that blocks EGF-stimulated EGFR autophosphorylation in tumor cells. Gefitinib also induces autophagy and cell apoptosis, which can be used for cancer related research, such as Lung cancer and breast cancer .
  • HY-144699
    ERRα antagonist-2

    Estrogen Receptor/ERR Cancer
    ERRα antagonist-2 (Compound 11) is a potential ERRα (estrogen related receptor α) inverse agonist with an IC50 of 0.80 μM. ERRα antagonist-2 suppresses the migration and invasion of the ER-negative MDA-MB-231 cell line. ERRα antagonist-2 inhibits breast cancer growth in vivo.
  • HY-12717AS
    Phentolamine-d4 hydrochloride

    Adrenergic Receptor Cardiovascular Disease Endocrinology
    Phentolamine-d4 (Phentolamine-d4) hydrochloride is the deuterium labeled Phentolamine hydrochloride. Phentolamine hydrochloride is a reversible, non-selective, and orally active blocker of α1 and α2 adrenergic receptor that expands blood vessels to reduce peripheral vascular resistance. Phentolamine hydrochloride can be used for the research of pheochromocytoma-related hypertension, heart failure and erectile dysfunction.
  • HY-P1812
    AUNP-12

    NP-12

    PD-1/PD-L1 Cancer
    AUNP-12 (NP-12) is a peptide antagonist of the PD-1 signaling pathway, displays equipotent antagonism toward PD-L1 and PD-L2 in rescue of lymphocyte proliferation and effector functions. AUNP-12 exhibits immune activation, excellent antitumor activity, and potential for better management of immune-related adverse events (irAEs).
  • HY-147224
    OBX02-011

    EGFR Cancer
    OBX02-011 is a potent and reversible fourth-generation EGFR (epidermal growth factor receptor) tyrosine kinase inhibitor. OBX02-011 shows potent anticancer effects and inhibits EGFR-related signaling. OBX02-011 overcomes C797S-mediated resistance in NSCLC (non-small cell lung cancer).
  • HY-10322
    Falnidamol

    BIBX 1382

    EGFR Cancer
    Falnidamol (BIBX 1382) is an orally active, selective EGFR tyrosine kinase inhibitor with an IC50 of 3 nM. Falnidamol displays > 1000-fold lower potency against ErbB2 (IC50=3.4 μM) and a range of other related tyrosine kinases (IC50>10 μM). Falnidamol is a pyrimido-pyrimidine compound and has anti-cancer activity.
  • HY-147518
    p38-α MAPK-IN-5

    p38 MAPK Inflammation/Immunology
    p38-α MAPK-IN-5 (compound 4e) is a potent p38α inhibitor with IC50s of 0.1 nM, 0.2 nM, 944 nM, 4100 nM for p38α, p38 β, p38γ, p38δ, respectively. p38-α MAPK-IN-5 has anti-inflammatory effect. p38-α MAPK-IN-5 has the potential for asthma and chronic obstructive pulmonary disease (COPD) research.
  • HY-B0113A
    Omeprazole sodium

    H 16868 sodium

    Proton Pump Autophagy Bacterial Phospholipase Cancer Infection Metabolic Disease
    Omeprazole sodium (H 16868 sodium), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole sodium shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole sodium also inhibits growth of Gram-positive and Gram-negative bacteria. Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor).
  • HY-147581
    BTK-IN-11

    Btk Cancer Inflammation/Immunology
    BTK-IN-11 is a potent inhibitor of BTK. BTK plays an important role in signaling mediated by B cell antigen receptor (BCR) and Fcγreceptor (FcγR) in B cells and myeloid cells, respectively. BTK-IN-11 has the potential for the research of related diseases, especially autoimmune diseases, inflammatory diseases or cancer (extracted from patent WO2022063101A1, compound Z2).
  • HY-111226A
    (E/Z)-GSK5182

    Estrogen Receptor/ERR Reactive Oxygen Species Cancer Cardiovascular Disease
    (E/Z)-GSK5182 is a racemic compound of (E)-GSK5182 and (Z)-GSK5182 isomers. GSK5182 is a highly selective and orally active inverse agonist of estrogen-related receptor γ (ERRγ) with an IC50 of 79 nM. GSK5182 also induces reactive oxyen species (ROS) generation in hepatocellular carcinoma.
  • HY-135593
    LY88074 analog 1

    Others Endocrinology
    LY88074 analog 1 is a benzothiophene compound with nitrogen-containing non-basic side chains, Compound 26, extracted from patent EP0747380A1. LY88074 analog 1 is an agent for alleviating the symptoms of post-menopausal symptoms, such as osteoporosis, cardiovascular related pathological conditions, and estrogen-dependent cancer. LY88074 analog 1 can be used alone or in combination with estrogen or progestin.
  • HY-100719
    BRD-6929

    HDAC HIV Infection Cardiovascular Disease
    BRD-6929 is a potent, selective brain-penetrant inhibitor of class I histone deacetylase HDAC1 and HDAC2 inhibitor with IC50 of 1 nM and 8 nM, respectively. BRD-6929 shows high-affinity to HDAC1 and HDAC2 with Ki of 0.2 and 1.5 nM, respectively. BRD-6929 can be used for mood-related behavioral model research.
  • HY-115926
    BRD4 Inhibitor-16

    Epigenetic Reader Domain Cancer
    BRD4 Inhibitor-16 (Compound 4) is a potent inhibitor of bromodomain 4 (BRD4). Overexpression of bromodomain 4 (BRD4) is closely correlated with a variety of human cancers by regulating the histone post-translational modifications. BRD4 Inhibitor-16 represents a useful tool for explorative studies of BRD4 inhibition, such as an improved understanding of BRD4 inhibitor release-related information.
  • HY-13894
    Tyrphostin AG1296

    AG1296

    PDGFR c-Kit FLT3 Apoptosis Cancer Inflammation/Immunology Cardiovascular Disease
    Tyrphostin AG1296 is a potent and selective inhibitor of platelet-derived growth factor receptor (PDGFR), with an IC50 of 0.8 μM. Tyrphostin AG1296 inhibits signaling of human PDGF α- and β-receptors as well as of the related stem cell factor receptor (c-Kit). Tyrphostin AG1296 is also a potent inhibitor of FLT3, with an IC50 in the micromolar range.
  • HY-101446
    HIOC

    Trk Receptor ERK Apoptosis Neurological Disease
    HIOC is a potent and selective activator of TrkB (tropomyosin related kinase B) receptor. HIOC can pass the blood-brain and blood-retinal barriers.HIOC activates TrkB/ERK pathway and decreases neuronal cell apoptosis. HIOC attenuates early brain injury after SAH (subarachnoid hemorrhage). HIOC shows protective activity in an animal model for light-induced retinal degeneration.
  • HY-13856
    (R)-PS210

    PDK-1 Cancer
    (R)-PS210, the R enantiomer of PS210 (compound 4h-eutomer), is a substrate-selective allosteric activator of PDK1 with an AC50 value of 1.8 μM. (R)-PS210 targets to the PIF-binding pocket of PDK1. PIF: The protein kinase C-related kinase 2 (PRK2)-interacting fragment.
  • HY-100007A
    Vonoprazan hydrochloride

    TAK-438 hydrochloride

    Proton Pump Bacterial Infection Endocrinology
    Vonoprazan hydrochloride, a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan hydrochloride inhibits H +,K +-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan hydrochloride is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease. Vonoprazan hydrochloride can be used for eradication of Helicobacter pylori.
  • HY-145390
    Nrf2 activator-1

    Keap1-Nrf2 Inflammation/Immunology
    Nrf2 activator-1 is a potent activator of NF-E2 related factor 2 (Nrf2). Nrf2 activator-1 has the potential for the treatment of COPD and other respiratory diseases, including asthma, Acute Lung Injury (ALI), Acute Respiratory Distress Syndrome (ARDS) and pulmonary fibrosis (extracted from patent WO2018109647A1).
  • HY-N0322
    Cholesterol

    Estrogen Receptor/ERR Endogenous Metabolite Metabolic Disease
    Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-14892A
    Gemigliptin tartrate

    LC15-0444 tartrate

    Dipeptidyl Peptidase Metabolic Disease
    Gemigliptin tartrate (LC15-0444 tartrate) is a highly selective, reversible and competitive dipeptidyl peptidase-4 (DPP-4) inhibitor, with an IC50 of 10.3 nM for human recombinant DPP-4. Gemigliptin tartrate exhibits potent anti-glycation properties. Gemigliptin tartrate can be used for the research of advanced glycation end products (AGE)-related diabetic complications.
  • HY-124352
    2-Nonyl-3-hydroxy-4-quinolone

    Others Others
    2-nonyl-3-hydroxy-4-Quinolone (C9-PQS) is a quinolone compound produced by P. aeruginosa and other related bacterias. 2-nonyl-3-hydroxy-4-Quinolone is a quorum sensing (QS) signal molecule that controls the expression of many virulence genes as a function of cell population density.
  • HY-P0203
    α-CGRP, rat

    CGRP Receptor Metabolic Disease Inflammation/Immunology Cardiovascular Disease
    α-CGRP, rat, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP, rat can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP, rat has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies.
  • HY-80002
    BMX-IN-1

    BMX kinase inhibitor

    Btk BMX Kinase Cancer
    BMX-IN-1 is a selective, irreversible inhibitor of bone marrow tyrosine kinase on chromosome X (BMX) that targets Cys 496 in the BMX ATP binding domain with an IC50 of 8 nM, also targets the related Bruton’s tyrosine kinase (BTK) with an IC50 value of 10.4 nM, but is more than 47-656-fold less potent against Blk, JAK3, EGFR, Itk, or Tec activity.
  • HY-147592
    CD73-IN-11

    CD73 Cancer Inflammation/Immunology
    CD73-IN-11 is a potent inhibitor of CD73. CD73 can catalyze the production of adenosine from extracellular 5'-phosphate adenosine (5'-AMP), and adenosine can induce immunosuppressive effects and promote tumor proliferation and/or metastasis. CD73-IN-11 be used for preparing a medicament for tumor-related diseases (extracted from patent WO2022068929A1, compound 24).
  • HY-134495
    N-Acetyl-L-cysteine ethyl ester

    N-Acetylcysteine ethyl ester; NACET

    Reactive Oxygen Species Metabolic Disease
    N-Acetyl-L-cysteine ethyl ester is an esterified form of N-acetyl-L-cysteine (NAC). N-Acetyl-L-cysteine ethyl ester exhibits enhanced cell permeability, and produce NAC and cysteine. N-Acetyl-L-cysteine ethyl ester increases circulating hydrogen sulfide (H2S) and can be used as an H2S producer. N-Acetyl-L-cysteine ethyl ester has the potential to substitute NAC as a mucolytic agent, and as a GSH-related antioxidant.
  • HY-130499
    ERRα Ligand-Linker Conjugates 1

    Target Protein Ligand-Linker Conjugates Cancer
    ERRα Ligand-Linker Conjugates 1 incorporates a ligand for estrogen-related receptor alpha (ERRα), and a PROTAC linker, which recruit E3 ligases MDM2. ERRα Ligand-Linker Conjugates 1 can be used in the synthesis of a series of PROTACs, such as PROTAC ERRalpha Degrader-1 (HY-128838). PROTAC ERRalpha Degrader-1 is an ERRα degrader.
  • HY-147591
    CD73-IN-10

    CD73 Cancer Inflammation/Immunology
    CD73-IN-10 is a potent inhibitor of CD73. CD73 can catalyze the production of adenosine from extracellular 5'-phosphate adenosine (5'-AMP), and adenosine can induce immunosuppressive effects and promote tumor proliferation and/or metastasis. CD73-IN-10 be used for preparing a medicament for tumor-related diseases (extracted from patent WO2022068929A1, compound 4).
  • HY-147589
    CD73-IN-8

    CD73 Cancer
    CD73-IN-8 is a potent inhibitor of CD73. CD73 can catalyze the production of adenosine from extracellular 5'-phosphate adenosine (5'-AMP), and adenosine can induce immunosuppressive effects and promote tumor proliferation and/or metastasis. CD73-IN-8 be used for preparing a medicament for tumor-related diseases (extracted from patent WO2022052886A1, compound 57).
  • HY-P1812A
    AUNP-12 TFA

    NP-12 TFA

    PD-1/PD-L1 Cancer
    AUNP-12 TFA (NP-12 TFA) is a peptide antagonist of the PD-1 signaling pathway, displays equipotent antagonism toward PD-L1 and PD-L2 in rescue of lymphocyte proliferation and effector functions. AUNP-12 TFA exhibits immune activation, excellent antitumor activity, and potential for better management of immune-related adverse events (irAEs).
  • HY-147590
    CD73-IN-9

    CD73 Inflammation/Immunology
    CD73-IN-9 is a potent inhibitor of CD73. CD73 can catalyze the production of adenosine from extracellular 5'-phosphate adenosine (5'-AMP), and adenosine can induce immunosuppressive effects and promote tumor proliferation and/or metastasis. CD73-IN-9 be used for preparing a medicament for tumor-related diseases (extracted from patent WO2022068929A1, compound 2).
  • HY-100867
    TAK-659

    Syk FLT3 Cancer
    TAK-659 is a highly potent, selective, reversible and orally available dual inhibitor of spleen tyrosine kinase (SYK) and fms related tyrosine kinase 3 (FLT3), with an IC50 of 3.2 nM and 4.6 nM for SYK and FLT3, respectively. TAK-659 induces cell death in tumor cells but not in nontumor cells, and with potential for the treatment of chronic lymphocytic leukemia (CLL).
  • HY-141519
    PI-55

    Parasite Others Infection
    PI-55 is a specific cytokinin receptor inhibitor. PI-55 is structurally related to 6-benzylaminopurine (BAP) and was shown to inhibit competitively BAP binding on Arabidopsis-specific receptors CRE1/AHK4 and AHK3. PI-55 inhibits cytokinins induced haustorium formation and increased parasite aggressiveness.
  • HY-B0113
    Omeprazole

    H 16868

    Proton Pump Autophagy Bacterial Phospholipase Cancer Infection Metabolic Disease
    Omeprazole (H 16868), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor).
  • HY-110077
    API-1

    Akt Apoptosis Cancer
    API-1, a potent Akt/PKB inhibitor, binds to the PH domain and inhibits Akt membrane translocation. API-1 efficiently reduces the phosphorylation levels of Akt with an IC50 of ∼0.8 μM. API-1 is selective for PKB and does not inhibit the activation of PKC, and PKA. API-1 also induces apoptosis by synergizing with TNF-related apoptosis-inducing ligand (TRAIL).
  • HY-N0155
    Nobiletin

    ROR Reactive Oxygen Species Apoptosis Autophagy Cancer Inflammation/Immunology Neurological Disease
    Nobiletin is a poly-methoxylated flavone from the citrus peel that improves memory loss. Nobiletin is a retinoid acid receptor-related orphan receptors (RORs) agonist. Nobiletin can reduce reactive oxygen species (ROS) levels in differentiated C2C12 myotubes and has anti-inflammation and anti-cancer properties, including anti-angiogenesis, anti-proliferation, anti-metastasis and induced apoptosis.
  • HY-16673
    PSN632408

    GPR119 Metabolic Disease
    PSN632408, a selective, orally active GPR119 agonist, shows similar potency to OEA at both recombinant mouse and human GPR119 receptors (EC50=5.6 and 7.9 uM, respectively). PSN632408 can stimulate β-cell replication and improve islet graft function. PSN632408 has the potential for the research of obesity and related metabolic disorders.
  • HY-134539
    IMT1

    Mitochondrial Metabolism DNA/RNA Synthesis Cancer Metabolic Disease
    IMT1 is a first-in-class specific and noncompetitive human mitochondrial RNA polymerase (POLRMT) inhibitor. IMT1 causes a conformational change of POLRMT, which blocks substrate binding and transcription in a dose-dependent way in vitro. IMT1 reduces deoxynucleoside triphosphate levels and citric acid cycle intermediates, resulting in a marked depletion of cellular amino acid levels. IMT1 has the potential for mitochondrial transcription disorders related diseases.
  • HY-147588
    CD73-IN-7

    CD73 Cancer
    CD73-IN-7 is a potent inhibitor of CD73. CD73 can catalyze the production of adenosine from extracellular 5'-phosphate adenosine (5'-AMP), and adenosine can induce immunosuppressive effects and promote tumor proliferation and/or metastasis. CD73-IN-7 be used for preparing a medicament for tumor-related diseases (extracted from patent WO2022052886A1, compound 13).
  • HY-103255
    CFM-4

    Apoptosis Cancer
    CFM-4 is a potent small molecular antagonist of CARP-1/APC-2 binding. CFM-4 prevents CARP-1 binding with APC-2, causes G2M cell cycle arrest, and induces apoptosis with an IC50 range of 10-15 μM. CFM-4 also suppresses growth of drug-resistant human breast cancer cells.
  • HY-121035
    7BIO

    7-Bromoindirubin-3-Oxime

    CDK GSK-3 Neurological Disease
    7BIO (7-Bromoindirubin-3-Oxime) is the derivate of indirubin. 7BIO (7-Bromoindirubin-3-Oxime) has inhibitory effects against cyclin-dependent kinase-5 (CDK5) and glycogen synthase kinase-3β (GSK3β). 7BIO (7-Bromoindirubin-3-Oxime) inhibits Aβ oligomer-induced neuroinflammation, synaptic impairments, tau hyper-phosphorylation, activation of astrocytes and microglia, and attenuates Aβ oligomer-induced cognitive impairments in mice[1].
  • HY-14737A
    Ceftaroline fosamil (hydrate)(acetate)

    TAK-599 (hydrate)(acetate); PPI0903 (hydrate)(acetate)

    Antibiotic Bacterial Infection
    Ceftaroline fosamil hydrate acetate is a potent cephalosporin antibiotic. Ceftaroline fosamil hydrate acetate shows broad-spectrum activity against Gram-positive pathogens, including methicillin-resistant Staphylococcus aureus (MRSA) and multidrug-resistant Streptococcus pneumoniae, and common Gram-negative organisms. Ceftaroline fosamil hydrate acetate has anti-infective activity, and can be used for the research of complicated skin and skin structure infections (cSSSIs) and community-acquired bacterial pneumonia (CABP).
  • HY-143464
    BChE-IN-4

    Cholinesterase (ChE) Neurological Disease
    BChE-IN-4 is a potent and cross the blood-brain barrier BChE inhibitor. BChE-IN-4 attenuates learning and memory deficits caused by cholinergic deficit in mouse model. BChE-IN-4 has the potential for the research of alzheimer’s disease.
  • HY-N0728S
    α-Linolenic acid-d5

    PI3K Akt Cancer Cardiovascular Disease
    α-Linolenic acid-d5 is the deuterium labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
  • HY-W181102
    NFAT Inhibitor-2

    Others Inflammation/Immunology Neurological Disease Cardiovascular Disease
    NFAT Inhibitor-2 is a potent inhibitor of calcineurin NFAT signalling. Calcineurin is a serine/threonine protein phosphatase regulated by Ca2+ and calmodulin. NFAT Inhibitor-2 has the potential for the research of inflammatory disease, an autoimmune disorder, a cardiovascular disease, a neurodegenerative disease, a disease occurring with uncontrolled cell proliferation and/or differentiation, an angiogenesis-related disease, an allergy, anaphylaxis and alopecia (extracted from patent WO2016207212A1, compound 17).
  • HY-N0451
    Acacetin

    5,7-Dihydroxy-4'-methoxyflavone

    Apoptosis Autophagy Cancer Inflammation/Immunology Neurological Disease
    Acacetin (5,7-Dihydroxy-4'-methoxyflavone) is an orally active flavonoid derived from Tephroseris kirilowii (Turcz.) Holub. Acacetin docks in the ATP binding pocket of PI3Kγ. Acacetin causes cell cycle arrest and induces apoptosis and autophagy in cancer cells. Acacetin has potent anti-cancer and anti-inflammatory activity and has the potential for pain-related diseases research.
  • HY-N2205
    Esculentoside H

    NF-κB JNK Cancer
    Esculentoside H (EsH) is a saponin isolated from the root extract of perennial plant Phytolacca esculenta. Esculentoside H (EH) has anti-tumor activity, the mechanism is related to the capacity for TNFrelease. Esculentoside H (EsH) suppresses colon cancer cell migration through blockage of the JNK1/2 and NF-κB signaling-mediated matrix metalloproteinases-9 (MMP-9) expression.
  • HY-124704
    Chst15-IN-1

    Others Neurological Disease
    Chst15-IN-1 is a potent reversible covalent Chst15 inhibitor. Chst15-IN-1 effectively inhibits chondroitin sulfate-E (CS-E) sulfation levels and other closely related glycosaminoglycans (GAG) sulfotransferases. Chst15-IN-1, as a selective sulfotransferase inhibitor, can diminish the inhibitory effects of chondroitin sulfate proteoglycans (CSPGs), and can be used for the stimulation of neuronal repair.
  • HY-19620A
    Branaplam hydrochloride

    LMI070 hydrochloride; NVS-SM1 hydrochloride

    DNA/RNA Synthesis Potassium Channel Cancer
    Branaplam (LMI070; NVS-SM1) hydrochloride is a highly potent, selective and orally active survival motor neuron-2 (SMN2) splicing modulator with an EC50 of 20 nM for SMN. Branaplam hydrochloride inhibits human-ether-a-go-go-related gene (hERG) with an IC50 of 6.3 μM. Branaplam hydrochloride elevates full-length SMN protein and extends survival in a severe spinal muscular atrophy (SMA) mouse model.
  • HY-19620
    Branaplam

    LMI070; NVS-SM1

    DNA/RNA Synthesis Potassium Channel Cancer
    Branaplam (LMI070; NVS-SM1) is a highly potent, selective and orally active survival motor neuron-2 (SMN2) splicing modulator with an EC50 of 20 nM for SMN. Branaplam inhibits human-ether-a-go-go-related gene (hERG) with an IC50 of 6.3 μM. Branaplam elevates full-length SMN protein and extends survival in a severe spinal muscular atrophy (SMA) mouse model.
  • HY-P0203A
    α-CGRP, rat TFA

    CGRP Receptor Metabolic Disease Inflammation/Immunology Cardiovascular Disease
    α-CGRP, rat TFA, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP, rat TFA can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP, rat TFA has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies.
  • HY-N0728S2
    α-Linolenic acid-d14

    PI3K Akt Cancer Cardiovascular Disease
    α-Linolenic acid-d14 is the deuterium labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
  • HY-16749A
    Pexidartinib hydrochloride

    PLX-3397 hydrochloride

    c-Fms c-Kit Apoptosis Cancer
    Pexidartinib hydrochloride (PLX-3397 hydrochloride) is a potent, orally active, selective, and ATP-competitive colony stimulating factor 1 receptor (CSF1R or M-CSFR) and c-Kit inhibitor, with IC50s of 20 and 10 nM, respectively. Pexidartinib hydrochloride exhibits 10- to 100-fold selectivity for c-Kit and CSF1R over other related kinases. Pexidartinib hydrochloride induces cell apoptosis and has anti-cancer activity.
  • HY-N0322S7
    Cholesterol-d1

    Estrogen Receptor/ERR Endogenous Metabolite
    Cholesterol-d1 is the deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-150540
    Bcl-2-IN-10

    Bcl-2 Family Apoptosis Cancer
    Bcl-2-IN-10 is an active Bcl-2 inhibitor that can release up to four nitric oxide (NO) molecules. Bcl-2-IN-10 has cytotoxic activities against cancer cells, such as human leukemia, breast cancer and lung cancer. Bcl-2-IN-10 induces cell apopotosis and arrest cell cycle of G2/M phase, and can be used in cancer-related research.
  • HY-143718
    JAK3/BTK-IN-3

    JAK Btk Inflammation/Immunology
    JAK3/BTK-IN-3 is a potent inhibitor of JAK3/BTK. BTK and JAK3 are two important targets for autoimmune diseases. Simultaneous inhibition of the BTK/JAK3 signalling pathway exhibits synergistic effects. JAK3/BTK-IN-3 has the potential for the research of JAK3 kinase and/or BTK-related diseases (extracted from patent WO2021147952A1, compound 009)
  • HY-15893
    DMOG

    Dimethyloxallyl Glycine

    HIF/HIF Prolyl-Hydroxylase Autophagy Cancer
    DMOG (Dimethyloxallyl Glycine) is a cell permeable and competitive inhibitor of HIF-PH, which results in HIF-1α stabilisation and accmulation in vitro and in vivo. DMOG is an α-ketoglutarate analogue and inhibits α-KG-dependent hydroxylases. DMOG acts as a pro-angiogenic agent and plays a protective role in experimental model of colitis and diarrhoea via HIF-1 related signal. DMOG induces cell autophagy.
  • HY-143472
    PI3Kδ-IN-11

    PI3K Akt Apoptosis Cancer
    PI3Kδ-IN-11 is a highly potent and selective PI3 inhibitor with IC50 value of 27.5 nM. PI3Kδ-IN-11 dose-dependently blocks the activity of PI3K/Akt pathway. PI3Kδ-IN-11 can be used for researching B or T cell-related malignancies.
  • HY-N0322S
    Cholesterol-d7

    Estrogen Receptor/ERR Endogenous Metabolite Metabolic Disease
    Cholesterol-d7 is the deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-132205
    DS45500853

    Estrogen Receptor/ERR Metabolic Disease
    DS45500853 is an estrogen-related receptor α (ERRα) agonist. DS45500853 inhibits the binding between receptor-interacting protein 140 (RIP140) corepressor peptide (10 nM) and GST-ERRα ligand-binding domain (LBD; 1.2 μM) with an IC50 value of 0.80 μM. DS45500853 can be used for the research of metabolic disorders, including type 2 diabetes mellitus (T2DM).
  • HY-146332
    Collagen-IN-1

    Others Cardiovascular Disease
    Collagen-IN-1 (compound 3), an ortho-carbonyl hydroquinone derivative, is a selective inhibitor on collagen. Collagen-IN-1 inhibits agonist-induced platelet aggregation in a non-competitive manner with an IC50 value of 1.77 μM. Collagen-IN-1 reduces the expression of P-selectin, activation of glycoprotein IIb/IIIa, and release of adenosine triphosphate and CD63 from platelet. Collagen-IN-1 has the potential for platelet-related thrombosis diseases research.
  • HY-N0322S1
    Cholesterol-d6

    Estrogen Receptor/ERR Endogenous Metabolite
    Cholesterol-d6 is the deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-125820
    Sigma-1 receptor antagonist 3

    Sigma Receptor Potassium Channel Neurological Disease
    Sigma-1 receptor antagonist 3 (compound135) is a potent and selective Sigma-1 (σ1) receptor antagonist with a Ki of 1.14 nM. Sigma-1 receptor antagonist 3 inhibits Human Ether-a-go-go-Related Gene (hERG) with an IC50 of 1.54 μM. Sigma-1 receptor antagonist 3 has the potential for the neuropathic pain.
  • HY-122639
    ZINC05007751

    Others Cancer
    ZINC05007751 is a potent NIMA-related kinase NEK6 inhibitor with an IC50 of 3.4 μM. ZINC05007751 shows antiproliferative activity against a panel of human cancer cell lines, and displays a synergistic effect with Cisplatin and Paclitaxel in a BRCA2 mutated ovarian cancer cell line. ZINC05007751 is very selective against NEK1 and NEK6 with no significant activity was observed against NEK2, NEK7, and NEK9.
  • HY-143717
    JAK3/BTK-IN-2

    JAK Btk Inflammation/Immunology
    JAK3/BTK-IN-2 is a potent inhibitor of JAK3/BTK. BTK and JAK3 are two important targets for autoimmune diseases. Simultaneous inhibition of the BTK/JAK3 signalling pathway exhibits synergistic effects. JAK3/BTK-IN-2 has the potential for the research of JAK3 kinase and/or BTK-related diseases (extracted from patent WO2021147952A1, compound 004)
  • HY-105685
    SRX246

    Vasopressin Receptor Neurological Disease
    SRX246 is a potent, CNS-penetrant, highly selective, orally bioavailable vasopressin 1a (V1a) receptor antagonist (Ki=0.3 nM for human V1a). SRX246 has no interaction at V1b and V2 receptors. SRX246 also displays negligible binding at 64 others receptors classes, including 35 G-proteincoupled receptors. SRX246 can be used for treatment of stress-related disorders.
  • HY-N0728S3
    α-Linolenic acid-13C18

    PI3K Akt Cancer Cardiovascular Disease
    α-Linolenic acid-13C18 is the 13C labeled α-Linolenic acid. α-Linolenic acid, isolated from seed oils, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer.
  • HY-143546
    RET-IN-9

    RET Cancer
    RET-IN-9 is a potent inhibitor of RET. RET kinase is a single-pass transmembrane receptor tyrosine kinase that plays an important role in the development of the kidney and enteric nervous system, and the maintenance of homeostasis in the nervous, endocrine, hematopoietic, and male reproductive systems. RET-IN-9 has the potential for the research of RET-related disease including non-small cell lung cancer and medullary thyroid cancer (extracted from patent WO2021115457A1, compound 29).
  • HY-143471
    PLK1/BRD4-IN-1

    Polo-like Kinase (PLK) Epigenetic Reader Domain Apoptosis Cancer
    PLK1/BRD4-IN-1 (9b) is an orally active dual PLK1 and BRD4 inhibitor with IC50 values of 22 nM and 109 nM against PLK1 and BRD4, respectively. PLK1/BRD4-IN-1 induces cell cycle arrest and apoptosis, downregulates the transcription of several proliferation-related oncogenes, and exhibits favorable in vivo antitumor activity.
  • HY-100007
    Vonoprazan

    TAK-438 free base

    Proton Pump Bacterial Endocrinology
    Vonoprazan (TAK-438 free base), a proton pump inhibitor (PPI), is a potent and orally active potassium-competitive acid blocker (P-CAB), with antisecretory activity. Vonoprazan inhibits H +,K +-ATPase activity in porcine gastric microsomes with an IC50 of 19 nM at pH 6.5. Vonoprazan is developed for the research of acid-related diseases, such as gastroesophageal reflux disease and peptic ulcer disease. Vonoprazan can be used for eradication of Helicobacter pylori.
  • HY-N0322S6
    Cholesterol-d4

    Estrogen Receptor/ERR Endogenous Metabolite Metabolic Disease
    Cholesterol-d4 is deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-143869
    HPK1-IN-28

    MAP4K Cancer
    HPK1-IN-28 is a potent inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPK1) is a negative regulator of the activation response of dendritic cells (DCs), T cells and B cells. HPK1-IN-28 enhances the body's anti-tumor immunity. HPK1-IN-28 has the potential for the research of immune-related diseases, especially tumor (extracted from patent WO2021175270A1, compound 1).
  • HY-150538
    STAT3-IN-12

    STAT Apoptosis Cancer
    STAT3-IN-12 is a potent STAT3 signal inhibitor that can inhibit IL-6 induced JAK/STAT3 signalling pathway activation. STAT3-IN-12 inhibits cancer cell growth, migration, and induce cell apoptosis as well as cycle arrest. STAT3-IN-12 can be used in cancer-related research, such as hepatocellular carcinoma (HCC) and oesophageal carcinoma.
  • HY-145814
    HSP90-IN-9

    HSP Fungal Infection
    HSP90-IN-9 is a potent and selective HSP90 inhibitor. HSP90-IN-9 displays a fungicidal effect in a dose-dependent manner. HSP90-IN-9 inhibits fungal biofilm formation and fungal morphological changes after being combined with FLC. HSP90-IN-9 recovers FLC resistance by down-regulating the expression of related genes (ERG11, CDR1 and CDR2).
  • HY-N0322S2
    Cholesterol-d6-1

    Estrogen Receptor/ERR Endogenous Metabolite Metabolic Disease
    Cholesterol-d6-1 is the deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-121495
    BKI-1369

    Parasite Infection
    BKI-1369 is a bumped kinase inhibitor (BKI). BKI-1369 increases human Ether-a-go-go-related gene (hERG)-inhibitory activity with an IC50 of 1.52 μM. BKI-1369 reduces the parasite burden and diseases severity in the gnotobiotic pig model. BKI-1369 has been well characterized for potency, stability, metabolism, toxicity, pharmacokinetics and is potent against C. parvum in infected mice and calves.
  • HY-111509
    TAK-828F

    ROR Inflammation/Immunology
    TAK-828F is a potent, selective, and orally available retinoic acid receptor-related orphan receptor γt (RORγt) inverse agonist (binding IC50=1.9 nM, reporter gene IC50=6.1 nM). TAK-828F shows excellent RORγt isoforms selectivity (>5000-fold selectivity against human RORα and RORβ).
  • HY-143720
    JAK3/BTK-IN-5

    JAK Btk Inflammation/Immunology
    JAK3/BTK-IN-5 is a potent inhibitor of JAK3/BTK. BTK and JAK3 are two important targets for autoimmune diseases. Simultaneous inhibition of the BTK/JAK3 signalling pathway exhibits synergistic effects. JAK3/BTK-IN-5 has the potential for the research of JAK3 kinase and/or BTK-related diseases (extracted from patent WO2021147953A1, compound 35)
  • HY-143870
    HPK1-IN-29

    MAP4K Cancer
    HPK1-IN-29 is a potent inhibitor of HPK1. Hematopoietic progenitor kinase 1 (HPK1) is a negative regulator of the activation response of dendritic cells (DCs), T cells and B cells. HPK1-IN-29 enhances the body's anti-tumor immunity. HPK1-IN-29 has the potential for the research of immune-related diseases, especially tumor (extracted from patent WO2021175270A1, compound 38).
  • HY-143719
    JAK3/BTK-IN-4

    JAK Btk Inflammation/Immunology
    JAK3/BTK-IN-4 is a potent inhibitor of JAK3/BTK. BTK and JAK3 are two important targets for autoimmune diseases. Simultaneous inhibition of the BTK/JAK3 signalling pathway exhibits synergistic effects. JAK3/BTK-IN-4 has the potential for the research of JAK3 kinase and/or BTK-related diseases (extracted from patent WO2021147953A1, compound 003)
  • HY-P1349A
    Orexin B, rat, mouse TFA

    Rat orexin B TFA; Orexin B (mouse) (TFA)

    Orexin Receptor (OX Receptor) Endocrinology Neurological Disease
    Orexin B, rat, mouse (Rat orexin B) TFA is an endogenous orexin receptor agonist. Orexin B, rat, mouse TFA binds and activates two closely related orphan G protein-coupled receptors OX1-R and OX2-R. Orexin B, rat, mouse TFA stimulates food intake and energy expenditure and plays a significant role in sleep-wakefulness regulation.
  • HY-13260
    CCT128930

    Akt Autophagy Apoptosis Cancer
    CCT128930 is a ATP-competitive and selective inhibitor of AKT (IC50=6 nM for AKT2). CCT128930 has 28-fold selectivity over the closely related PKA kinase (IC50=168 nM) through the targeting of Met282 of AKT (Met173 of PKA-AKT chimera), as well as 20-fold selectivity over p70S6K (IC50=120 nM). Antitumor activity.
  • HY-135111S
    4-Desmethoxy Omeprazole-d3

    Drug Metabolite Cancer Infection Metabolic Disease
    4-Desmethoxy Omeprazole-d3 is the deuterium labeled 4-Desmethoxy Omeprazole. 4-Desmethoxy Omeprazole is the active metabolite of Omeprazole. Omeprazole, a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.
  • HY-144761
    TOPK-p38/JNK-IN-1

    JNK Cancer
    TOPK-p38/JNK-IN-1 (Compound B12) is an orally active TOPK-p38/JNK signaling pathway inhibitor with the IC50 value of 2.14 µM for NO production. TOPK-p38/JNK-IN-1 shows anti-inflammatory activities. TOPK-p38/JNK-IN-1 also inhibits phosphorylate downstream related proteins and avoids degradation of TOPK.
  • HY-143201
    DS20362725

    Estrogen Receptor/ERR Metabolic Disease
    DS20362725 is an estrogen-related receptor α (ERRα) agonist. DS20362725 inhibits the binding between receptor-interacting protein 140 (RIP140) corepressor peptide (10 nM) and GST-ERRα ligand-binding domain (LBD; 1.2 μM) with an IC50 value of 0.6 μM. DS20362725 can be used for the research of metabolic disorders, including type 2 diabetes mellitus (T2DM).
  • HY-143716
    JAK3/BTK-IN-1

    JAK Btk Inflammation/Immunology
    JAK3/BTK-IN-1 is a potent inhibitor of JAK3/BTK. BTK and JAK3 are two important targets for autoimmune diseases. Simultaneous inhibition of the BTK/JAK3 signalling pathway exhibits synergistic effects. JAK3/BTK-IN-1 has the potential for the research of JAK3 kinase and/or BTK-related diseases (extracted from patent WO2021147952A1, compound 002).
  • HY-131061
    BET bromodomain inhibitor 1

    Epigenetic Reader Domain Cancer
    BET bromodomain inhibitor 1 is an orally active, selective bromodomain and extra-terminal (BET) bromodomain inhibitor with an IC50 of 2.6 nM for BRD4. BET bromodomain inhibitor 1 binds to BRD2(2), BRD3(2), BRD4(1), BRD4(2), and BRDT(2) with high affinities (Kd values of 1.3 nM, 1.0 nM, 3.0 nM, 1.6 nM, 2.1 nM, respectively). bromodomain inhibitor 1 has anti-cancer activity.
  • HY-101029
    MBM-55

    Apoptosis Cancer
    MBM-55 is a potent NIMA-related kinase 2 (Nek2) inhibitor with an IC50 of 1 nM. MBM-55 shows a 20-fold or greater selectivity in most kinases with the exception of RSK1 (IC50=5.4 nM) and DYRK1a (IC50=6.5 nM). MBM-55 effectively inhibits the proliferation of cancer cells by inducing cell cycle arrest and apoptosis. MBM-55 shows antitumor activities, and no obvious toxicity to mice.
  • HY-146523
    TRK-IN-17

    Trk Receptor Cancer
    TRK-IN-17 is a potent inhibitor of TRK. Tropomyosin-related kinases (Trks) are a family of receptor tyrosine kinases activated by neurotrophins, a group of soluble growth factors including Nerve Growth Factor (NGF), Brain-Derived Neurotrophic Factor (BDNF) and Neurotrophin-3 (NT-3) and Neurotrophin-4/5 (NT-4/5). TRK-IN-17 has the potential for the research of cancer diseases (extracted from patent WO2021148807A1, compound 3).
  • HY-N0322S8
    Cholesterol-18O

    Estrogen Receptor/ERR Endogenous Metabolite
    Cholesterol-18O is the deuterium labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-141551
    GNE-274

    Estrogen Receptor/ERR Cancer
    GNE-274 is a non-degrader that is structurally related to GDC-0927 (ER degrader). GNE-274 does not induce ER turnover and functions as a partial ER agonist in breast cancer cell lines. GNE-274 increase chromatin accessibility at ER-DNA binding sites, while GDC-0927 do not. GNE-274 is a potent inhibitor of ER-ligand binding domain (LBD). GNE-274 can be used for cancer research.
  • HY-N1441
    Afzelin

    Kaempferol-3-O-rhamnoside

    Mitochondrial Metabolism PTEN Bacterial Autophagy Infection Inflammation/Immunology
    Afzelin (Kaempferol-3-O-rhamnoside) is is a flavonol glycoside found in Houttuynia cordata Thunberg and is widely used in the preparation of antibacterial and antipyretic agents, detoxicants and for the treatment of inflammation. Afzelin attenuates the mitochondrial damage, enhances mitochondrial biogenesis and decreases the level of mitophagy-related proteins, parkin and PTEN-induced putative kinase 1. Afzelin improves the survival rate and reduces the serum levels of alanine aminotransferase and pro-inflammatory cytokines in D-galactosamine (GalN)/LPS -treated mice.
  • HY-B0528AS
    Octopamine-d4 hydrochloride

    (±)-p-Octopamine-d4 hydrochloride

    Adrenergic Receptor Endogenous Metabolite Neurological Disease Endocrinology
    Octopamine-d4 ((±)-p-Octopamine-d4) hydrochloride is the deuterium labeled Octopamine hydrochloride. Octopamine ((±)-p-Octopamine) hydrochloride, a biogenic monoamine structurally related to noradrenaline, acts as a neurohormone, a neuromodulator and a neurotransmitter in invertebrates. Octopamine hydrochloride can stimulate alpha2-adrenoceptors (ARs) in Chinese hamster ovary cells transfected with human alpha2-ARs. Octopamine hydrochloride increased glycogenolysis, glycolysis, oxygen uptake, gluconeogenesis and the portal perfusion pressure.
  • HY-N1836
    3-Acetonyl-3-hydroxyoxindole

    3-Hydroxy-3-acetonyloxindole

    Others Infection
    3-Acetonyl-3-hydroxyoxindole (AHO) is a potent systemic acquired resistance (SAR) inducer in plants. 3-Acetonyl-3-hydroxyoxindole induces resistance in tobacco plants against infection with tobacco mosaic virus (TMV) and the fungal pathogen Erysiphe cichoracearum. 3-Acetonyl-3-hydroxyoxindole increases the level of pathogenesis-related gene 1 (PR-1) expression, salicylic acid (SA) accumulation and phenylalanine ammonia-lyase activity.
  • HY-N0322S5
    Cholesterol-13C2

    Estrogen Receptor/ERR Endogenous Metabolite Metabolic Disease
    Cholesterol-13C2 is the 13C labeled Cholesterol. Cholesterol is the major sterol in mammals and is makes up 20-25% of structural component of the plasma membrane. Plasma membranes are highly permeable to water but relatively impermeable to ions and protons. Cholesterol plays an important role in determining the fluidity and permeability characteristics of the membrane as well as the function of both the transporters and signaling proteins. Cholesterol is also an endogenous estrogen-related receptor α (ERRα) agonist.
  • HY-144765
    NF-κB-IN-4

    NF-κB Apoptosis Inflammation/Immunology Neurological Disease
    NF-κB-IN-4 (compound 17) is a potent and BBB-penetrated NF-κB pathway inhibitor with blood brain barrier (BBB) permeability. NF-κB-IN-4 exhibits potential anti-neuroinflammatory activity with low toxicity. NF-κB-IN-4 can block the activation and phosphorylation of IκBα, reduce expression of NLRP3, and thus inhibit NF-κB activation. NF-κB-IN-4 can be used for neuroinflammation related diseases research.
  • HY-111640
    3'-Azido-3'-deoxy-5-methylcytidine

    HIV Reverse Transcriptase Infection
    3'-Azido-3'-deoxy-5-methylcytidine (CS-92) is a potent xenotropic murine leukemia-related retrovirus (XMRV) inhibitor with a CC50 of 43.5 μM in MCF-7 cells. 3'-Azido-3'-deoxy-5-methylcytidine also inhibits HIV-1 reverse transcriptase with an EC50 of 0.06 μM in peripheral blood mononuclear (PBM) cells.
  • HY-145669
    DIF-3

    CDK GSK-3 Cancer
    DIF-3 reduces the expression levels of cyclin D1 and c-Myc by facilitating their degradation via activation of GSK-3β. DIF-3 inhibits Wnt/β-catenin signaling pathway-related proteins in DLD-1 cells. DIF-3 exerts a strong antiproliferative effect on the human cervical cancer cell line HeLa by inducing cyclin D1 degradation and inhibiting cyclin D1 mRNA expression.
  • HY-146524
    TRK-IN-18

    Trk Receptor Cancer
    TRK-IN-18 is a potent inhibitor of TRK. Tropomyosin-related kinases (Trks) are a family of receptor tyrosine kinases activated by neurotrophins, a group of soluble growth factors including Nerve Growth Factor (NGF), Brain-Derived Neurotrophic Factor (BDNF) and Neurotrophin-3 (NT-3) and Neurotrophin-4/5 (NT-4/5). TRK-IN-18 has the potential for the research of cancer diseases (extracted from patent WO2021148805A1, compound 7).
  • HY-119366
    S18-000003

    ROR Inflammation/Immunology
    S18-000003 is a potent, selective and orally active inhibitor of retinoic acid receptor-related orphan receptor-gamma-t (RORγt), with an IC50 of <30 nM towards human RORγt in competitive binding assays. S18-000003 shows selectivity for RORγt over other ROR family members (IC50>10 μM). S18-000003 can be used for the research of psoriasis with low risk of thymic aberrations.
  • HY-16749
    Pexidartinib

    PLX-3397

    c-Fms c-Kit Apoptosis Cancer
    Pexidartinib (PLX-3397) is a potent, orally active, selective, and ATP-competitive colony stimulating factor 1 receptor (CSF1R or M-CSFR) and c-Kit inhibitor, with IC50s of 20 and 10 nM, respectively. Pexidartinib (PLX-3397) exhibits 10- to 100-fold selectivity for c-Kit and CSF1R over other related kinases. Pexidartinib (PLX-3397) induces cell apoptosis and has anti-tumor activity.
  • HY-120124
    Samelisant

    SUVN-G3031

    Histamine Receptor Neurological Disease
    Samelisant (SUVN-G3031) is a potent and selective histamine H3 receptor (H3R) inverse agonist with good brain penetration and oral bioavailability. Samelisant has a similar binding affinity towards human (hH3R; Ki=8.7 nM) and rat (rH3R;Ki=9.8 nM) H3R indicating no inter-species differences. Samelisant can be used for the research of sleep-related disorders.
  • HY-13260A
    CCT128930 hydrochloride

    Akt Autophagy Apoptosis Cancer
    CCT128930 hydrochloride is a potent and selective inhibitor of AKT (IC50=6 nM). CCT128930 hydrochloride has 28-fold selectivity over the closely related PKA kinase (IC50=168 nM) through the targeting of Met282 of AKT (Met173 of PKA-AKT chimera), as well as 20-fold selectivity over p70S6K (IC50=120 nM). CCT128930 hydrochloride induces cell cycle arrest, DNA damage, and autophagy. Antitumor activity.
  • HY-144043
    ALK5-IN-8

    TGF-β Receptor Cancer
    ALK5-IN-8 is a potent inhibitor of TGFβRI (ALK5). ALK5-IN-8 Inhibits the phosphorylation of ALK5 on its downstream signaling proteins (Smad2 or Smad3) by blocking the binding of TGFβRI to ligands, thereby affecting or blocking TGF-β signaling. ALK5-IN-8 has the potential for the research of various ALK5-mediated related diseases (extracted from patent WO2021190425A1, compound 1).
  • HY-122608
    Samelisant free base

    SUVN-G3031 free base

    Histamine Receptor Neurological Disease
    Samelisant (SUVN-G3031) free base is a potent and selective histamine H3 receptor (H3R) inverse agonist with good brain penetration and oral bioavailability. Samelisant free base has a similar binding affinity towards human (hH3R; Ki=8.7 nM) and rat (rH3R;Ki=9.8 nM) H3R indicating no inter-species differences. Samelisant free base can be used for the research of sleep-related disorders.
  • HY-146194
    NHEJ inhibitor-1

    Reactive Oxygen Species Cancer
    NHEJ inhibitor-1 (Compound C2) is a trifunctional Pt(II) complex, alleviates the  non-homologous end connection (NHEJ)/homologous recombination (HR)-related double strand breaks (DSBs) repairs to evade Cisplatin-resistance in non-small cell lung cancer (NSCLC). NHEJ inhibitor-1 inhibits the damage repair proteins Ku70 and Rad51 to make tumors re-sensitive to Cisplatin。NHEJ inhibitor-1 also induces ROS generation and MMP deduction.
  • HY-10187
    TG 100801 Hydrochloride

    VEGFR FGFR PDGFR Src Cancer
    TG 100801 Hydrochloride is a prodrug that generates TG 100572 by de-esterification in development to treat age-related macular degeneration. TG 100572 is a multi-targeted kinase inhibitor which inhibits receptor tyrosine kinases and Src kinases; has IC50s of 2, 7, 2, 16, 13, 5, 0.5, 6, 0.1, 0.4, 1, 0.2 for VEGFR1, VEGFR2, FGFR1, FGFR2, PDGFRβ, Fgr, Fyn, Hck, Lck, Lyn, Src, Yes, respectively.
  • HY-143880
    MRGPRX1 agonist 4

    Others Neurological Disease
    MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain.
  • HY-111310
    ML351

    Lipoxygenase Metabolic Disease Neurological Disease
    ML351 is a potent and highly specific 15-LOX-1 inhibitor with an IC50 of 200 nM. ML351 shows excellent selectivity (>250-fold) versus the related isozymes, 5-LOX, platelet 12-LOX, 15-LOX-2, ovine COX-1, and human COX-2. ML351 prevents dysglycemia and reduces β-cell oxidative stress in nonobese diabetic mouse model of T1D.
  • HY-150751
    ODN TTAGGG

    ODN A151

    Toll-like Receptor (TLR) Inflammation/Immunology
    ODN TTAGGG (A151), inhibitory oligonucleotide (ODN), is a TLR9, AIM2 and cGAS antagonist. ODN TTAGGG is immunosuppressive and inhibits AIM2 inflammasome activation, as well as cGAS activation, by competing with DNA. ODN TTAGGG can be used in the study of lupus erythematosus and other related autoimmune diseases. ODN TTAGGG sequence: 5'-T-T-A-G-G-G-T-T-A-G-G-G-T-T-A-G-G-G-T-T-A-G-G-G-3'.
  • HY-B0113S1
    Omeprazole-d3-1

    H 16868-d3-1

    Proton Pump Autophagy Bacterial Phospholipase Cancer Infection Metabolic Disease
    Omeprazole-d3-1 (H 16868-d3-1) is the deuterium labeled Omeprazole. Omeprazole (H 16868), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor).
  • HY-149005
    PRMT5-IN-19

    Histone Methyltransferase Cancer
    PRMT5-IN-19 (Compound 41) is an selective orally active non-nucleoside PRMT5 inhibitor with IC50 values of 23.9 nM (radioactive biochemical assay) and 47 nM (AlphaLISA assay). PRMT5-IN-19 can occupy the SAM-binding pocket in PRMT5 and block methyltransferase activity, which displays good selectivity over other PRMTs and PKMTs. PRMT5-IN-19 inhibits cell proliferation by inducing cell apoptosis, and can be used for cancer-related research.
  • HY-142949
    ALK5-IN-7

    ALK Cancer Inflammation/Immunology
    ALK5-IN-7 is a potent inhibitor of ALK5. Transforming growth factor beta (TGF-β) is a multifunctional cytokine that is involved in regulating cell proliferation, differentiation and apoptosis through complex receptor signaling pathways on the cell surface in an autocrine, paracrine and endocrine manner. ALK5-IN-7 has the potential for the research of TGF-β-related diseases and conditions, including but not limited to tumors, fibrotic diseases, inflammatory diseases, autoimmune diseases, etc (extracted from patent WO2021129621A1, compound 4).
  • HY-126037
    (±)-ML 209

    ROR Inflammation/Immunology
    (±)-ML 209 (compound 4n), a diphenylpropanamide, is a retinoic acid-related orphan receptor RORγ antagonist with an IC50 of 1.1 μM. (±)-ML 209 inhibits RORγt transcriptional activity with an IC50 of 300 nM in HEK293t cells. (±)-ML 209 inhibits the transcriptional activity of RORγt, but not RORα in cells. (±)-ML 209 selectively inhibits murine Th17 cell differentiation without affecting the differentiation of naïve CD4 + T cells into other lineages, including Th1 and regulatory T cells.
  • HY-N0261
    Aurantio-obtusin

    Others Inflammation/Immunology Cardiovascular Disease
    Aurantio-obtusin is an anthraquinone isolated from Semen Cassiae, with anti-Inflammatory, anti-oxidative, anti-coagulating and anti-hypertension activities. Aurantio-obtusin relaxes systemic arteries through endothelial PI3K/AKT/eNOS-dependent signaling pathway in rats, thus acts as a new potential vasodilator. Aurantio-obtusin inhibits allergic responses in IgE-mediated mast cells and anaphylactic models and is potential for treatment for allergy-related diseases.
  • HY-135809
    A2764 dihydrochloride

    Potassium Channel Neurological Disease
    A2764 dihydrochloride is a highly selective inhibitor of TRESK (TWIK-related spinal cord K + channel, K2P18.1), which has moderate inhibitory effects on TREK-1 and TALK-1. A2764 dihydrochloride is more sensitive to the activated mTRESK channels (IC50=6.8 μM) than the basal current. A2764 dihydrochloride can lead to cell depolarization and increased excitability in native cells, it has the potential for probing the role of TRESK channel in migraine and nociception.
  • HY-146349
    PROTAC EGFR degrader 4

    PROTACs EGFR Autophagy Cancer
    PROTAC EGFR degrader 4 (Compound P3) is a potent PROTAC targeting mutant EGFR.PROTAC EGFR degrader 4 induces EGFR del19 and EGFR L858R/T790M degradation with DC50s of 0.51 and 126 nM, respectively. PROTAC EGFR degrader 4 significantly inhibits growth of HCC827 and H1975 cell lines with IC50s of 0.83 and 203.1 nM, respectively. Induced EGFR degradation is related to autophagy.
  • HY-10186
    TG 100801

    VEGFR FGFR PDGFR Src Cancer
    TG 100801 is a prodrug that generates TG 100572 by de-esterification in development to treat age-related macular degeneration. TG 100572 is a multi-targeted kinase inhibitor which inhibits receptor tyrosine kinases and Src kinases; has IC50s of 2, 7, 2, 16, 13, 5, 0.5, 6, 0.1, 0.4, 1, 0.2 for VEGFR1, VEGFR2, FGFR1, FGFR2, PDGFRβ, Fgr, Fyn, Hck, Lck, Lyn, Src, Yes, respectively.
  • HY-142950
    ALK5-IN-6

    ALK Cancer Inflammation/Immunology
    ALK5-IN-6 is a potent inhibitor of ALK5. Transforming growth factor beta (TGF-β) is a multifunctional cytokine that is involved in regulating cell proliferation, differentiation and apoptosis through complex receptor signaling pathways on the cell surface in an autocrine, paracrine and endocrine manner. ALK5-IN-6 has the potential for the research of TGF-β-related diseases and conditions, including but not limited to tumors, fibrotic diseases, inflammatory diseases, autoimmune diseases, etc (extracted from patent WO2021129621A1, compound 1).
  • HY-123931
    ZLDI-8

    Notch Phosphatase Apoptosis Cancer
    ZLDI-8 is a Notch activating/cleaving enzyme ADAM-17 inhibitor and inhibits the cleavage of Notch protein. ZLDI-8 decreases the expression of pro-survival/anti-apoptosis and epithelial-mesenchymal transition (EMT) related proteins. ZLDI-8 is also a competitive and irreversible tyrosine phosphatase (Lyp) inhibitor with an IC50 of 31.6 μM and a Ki of 26.22 μM. ZLDI-8 inhibits the growth of MHCC97-H cells with an IC50 of 5.32 μM.
  • HY-101029A
    MBM-55S

    Ribosomal S6 Kinase (RSK) DYRK Apoptosis Cancer
    MBM-55S is a potent NIMA-related kinase 2 (Nek2) inhibitor with an IC50 of 1 nM. MBM-55S shows a 20-fold or greater selectivity in most kinases with the exception of RSK1 (IC50=5.4 nM) and DYRK1a (IC50=6.5 nM). MBM-55S effectively inhibits the proliferation of cancer cells by inducing cell cycle arrest and apoptosis. MBM-55S shows antitumor activities, and no obvious toxicity to mice.
  • HY-N6791
    KT5823

    PKA PKC Bacterial Apoptosis Antibiotic Infection Inflammation/Immunology
    KT5823, a selective the cGMP-dependent protein kinase (PKG) inhibitor with an Ki value of 0.23 μM, it also inhibits PKA and PKC with Ki values of 10 μM and 4 μM, respectively. KT5823 is a staurosporine-related protein kinase inhibitor, increases thyroid-stimulating hormone-induced (Na +/I - symporter) NIS expression, and iodide uptake in thyroid cells. KT5823 arrests cells after the G0/G1 boundary and causes increases in the levels of apoptotic DNA fragmentation.
  • HY-19995
    GSK137647A

    GSK 137647

    Free Fatty Acid Receptor Metabolic Disease
    GSK137647A (GSK 137647) is a potent, selective free fatty acid receptor 4 (FFA4) agonist with pEC50 values of 6.3, 6.2, and 6.1 for human, mouse and rat FFA4, and pEC50 values < 4.5 for all three species for FFA1, FFA2, and FFA3, respectively. GSK137647A has anti-inflammatory activity. GSK137647A induces insulin secretion and inhibits epithelial ion transport, GSK137647A is related to regulation of glucose homeostasis and anti-inflammatory response.
  • HY-145384
    ROC-0929

    Phospholipase Inflammation/Immunology
    ROC-0929 (compound 13a) is a potent and selective inhibitor of secreted phospholipases A2 (sPLA2s) with an IC50 of 80 nM, specially targeting hGX. ROC-0929 inhibits the phosphorylation of ERK1/2 and p-38. Secreted phospholipases A2 (sPLA2s) are a family of disulfide-rich, Ca 2+-dependent enzymes that hydrolyze the sn-2 position of glycero-phospholipids to release a fatty acid and a lysophospholipid. ROC-0929 has the potential for researching inflammation related diseases.
  • HY-144637
    Autophagy inducer 2

    Apoptosis Autophagy Cancer
    Autophagy inducer 2 (Compound 11i) is a potent autophagy inducer. Autophagy inducer 2 exhibits apparent antiproliferative activity against the MCF-7 cell line with an IC50 value of 1.31 μM and remarkably inhibits the colony formation of the MCF-7 cells. Autophagy inducer 2 arrests the MCF-7 cells in the G2/M phase by regulating the cell-cycle-related proteins Cdk-1 and Cyclin B1. Autophagy inducer 2 has the potential for the research of breast cancer.
  • HY-110291
    A-971432

    Others Neurological Disease
    A-971432 is a potent, selective and orally active sphingosine-1-phosphate (S1P) receptor 5 agonist with IC50s of .362, >10, 0.006 µM for S1P1, S1P3, S1P5 respectively. A-971432 protects blood–brain barrier (BBB) homeostasis. A-971432 reverses age-related cognitive decline. A-971432 has the potential for the research of alzheimer’s disease or multiple sclerosis .
  • HY-N0171A
    Beta-Sitosterol (purity>98%)

    β-Sitosterol (purity>98%); 22,23-Dihydrostigmasterol (purity>98%)

    Apoptosis Cancer Inflammation/Immunology Cardiovascular Disease
    Beta-Sitosterol (purity>98%) is a plant sterol. Beta-Sitosterol (purity>98%) interfere with multiple cell signaling pathways, including cell cycle, apoptosis, proliferation, survival, invasion, angiogenesis, metastasis and inflammation.
  • HY-130272
    Anti-MI/R injury agent 1

    Others Cardiovascular Disease
    Anti-MI/R injury agent 1 (compound 18), a Panaxatriol derivative, is an orally active, potent anti-myocardial ischemia/reperfusion (anti-MI/R) injury agent. Anti-MI/R injury agent 1 enhances oxygen-glucose deprivation and reperfusion (OGD/R)-induced cardiomyocyte injury cell viability. Anti-MI/R injury agent 1 can markedly reduce myocardial infarction size, decrease circulating cardiac troponin I (cTnI) leakage, and alleviate cardiac tissue damage in the rats.
  • HY-N0171B
    Beta-Sitosterol (purity>75%)

    β-Sitosterol (purity>75%); 22,23-Dihydrostigmasterol (purity>75%)

    Apoptosis Cancer Inflammation/Immunology Cardiovascular Disease
    Beta-Sitosterol (purity>75%) includes 75% β-sitosterol and 10% campesterol. Beta-Sitosterol is a plant sterol. Beta-Sitosterol (purity>75%) interfere with multiple cell signaling pathways, including cell cycle, apoptosis, proliferation, survival, invasion, angiogenesis, metastasis and inflammation.
  • HY-N0171
    Beta-Sitosterol (purity>80%)

    β-Sitosterol (purity>80%); 22,23-Dihydrostigmasterol (purity>80%)

    Endogenous Metabolite Apoptosis Cancer Inflammation/Immunology Cardiovascular Disease
    Beta-Sitosterol (purity>80%) includes β-sitosterol (≥80%), stigmasterol, campesterol and brassicasterol mainly. Beta-Sitosterol is a plant sterol. Beta-Sitosterol (purity>80%) interfere with multiple cell signaling pathways, including cell cycle, apoptosis, proliferation, survival, invasion, angiogenesis, metastasis and inflammation.
  • HY-17504C
    (3R,5R)-Rosuvastatin

    HMG-CoA Reductase (HMGCR) Potassium Channel Autophagy Metabolic Disease Cardiovascular Disease
    (3R,5R)-Rosuvastatin is the (3R,5R)-enantiomer of Rosuvastatin. Rosuvastatin is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-17504D
    (3S,5R)-Rosuvastatin

    HMG-CoA Reductase (HMGCR) Potassium Channel Autophagy Metabolic Disease Cardiovascular Disease
    (3S,5R)-Rosuvastatin is the (3S,5R)-enantiomer of Rosuvastatin. Rosuvastatin is a competitive HMG-CoA reductase inhibitor with an IC50 of 11 nM. Rosuvastatin potently blocks human ether-a-go-go related gene (hERG) current with an IC50 of 195 nM. Rosuvastatin reduces the expression of the mature hERG and the interaction of heat shock protein 70 (Hsp70) with the hERG protein. Rosuvastatin is very effective in lowering low-density lipoprotein (LDL) cholesterol, triglycerides, and C-reactive protein levels.
  • HY-B0113S3
    Omeprazole-13CD3

    H 16868-13CD3

    Proton Pump Autophagy Bacterial Phospholipase Cancer Infection Metabolic Disease
    Omeprazole-13CD3 (H 16868-13CD3) is a 13C-labeled and deuterium labeled Omeprazole. Omeprazole (H 16868), a proton pump inhibitor (PPI), is available for treatment of acid-related gastrointestinal disorders. Omeprazole shows competitive inhibition of CYP2C19 activity with a Ki of 2 to 6 μM. Omeprazole also inhibits growth of Gram-positive and Gram-negative bacteria.Omeprazole is a potent brain penetrant neutral sphingomyelinase (N-SMase) inhibitor (exosome inhibitor).
  • HY-146307
    TrxR-IN-3

    Others Cancer
    TrxR-IN-3 (Compound 2c) is a potent inhibitor of TrxR. TrxR-IN-3 exhibits potent antiproliferative activities against five human cancer cell lines, especially against breast tumor cells. TrxR-IN-3 increases ROS levels and resulted in marked apoptosis by regulating apoptosis-related proteins expressed in the breast cancer cells. TrxR-IN-3 also triggers the formation of autophagosomes and autolysosomes by promoting the expression of LC3-II and Beclin-1 and diminishing the expression of LC3-I and p62 proteins.
  • HY-120213
    YH-306

    FAK Src PI3K MMP Apoptosis Cancer
    YH-306 is an antitumor agent. YH-306 suppresses colorectal tumour growth and metastasis via FAK pathway. YH-306 significantly inhibits the migration and invasion of colorectal cancer cells. YH-306 potently suppresses uninhibited proliferation and induces cell apoptosis. YH-306 suppresses the activation of FAK, c-Src, paxillin, and PI3K, Rac1 and the expression of MMP2 and MMP9. YH-306 also inhibita actin-related protein (Arp2/3) complex-mediated actin polymerization.
  • HY-44809A
    Izilendustat hydrochloride

    HIF/HIF Prolyl-Hydroxylase Cancer Inflammation/Immunology
    Izilendustat (hydrochloride) is a potent inhibitor of prolyl hydroxylase which stabilizes hypoxia inducible factor- 1 alpha (HIF- lα), as well as hypoxia inducible factor-2 (HIF-2). Izilendustat (hydrochloride) has the potential for the research of HIF- lα related diseases including Peripheral Vascular Disease (PVD), Coronary Artery Disease (CAD), heart failure, ischemia, anemia, colitis, and other inflammatory bowel diseases (extracted from patent WO2011057115A1/WO2011057112A1/WO2011057121A1).
  • HY-124322
    NB-360

    Beta-secretase Inflammation/Immunology Neurological Disease
    NB-360 is a potent, brain penetrable, and orally bioavailable dual BACE1/BACE2 inhibitor (IC50: mouse and human BACE1=5 nM; BACE2=6 nM). NB-360 shows a superior pharmacological profile and robust reduction of amyloid-β and neuroinflammation in amyloid precursor protein(APP) transgenic mice. NB-360 can completely block the progression of Aβ deposition in the brains of APP transgenic mice. NB-360 shows excellent selectivity over the related aspartyl proteases pepsin, cathepsin D and cathepsin E.
  • HY-147086
    CAY10789

    Leukotriene Receptor Bile Acid Receptor TNF Receptor Metabolic Disease Inflammation/Immunology
    CAY10789 (compound 6) is a potent CysLT1R (cysteinyl leukotriene receptor 1) antagonist (IC50=2.80 μM) and GPBAR1 (G-protein-coupled bile acid receptor 1) agonist (EC50=3 μM). CAY10789 significantly reduces the adhesion of U937 cells to HAEC, reduces the expression of TNF-α. CAY10789 shows very promising metabolic stability and excellent pharmacokinetics. CAY10789 can be used for the research of colitis, metabolic syndromes, and other GPBAR1/CysLT1R-related diseases.
  • HY-105285
    Piromelatine

    Neu-P11

    Melatonin Receptor 5-HT Receptor P2X Receptor TRP Channel Sodium Channel Neurological Disease
    Piromelatine (Neu-P11) is a melatonin MT1/MT2 receptor agonist, serotonin 5-HT1A/5-HT1D agonist, and serotonin 5-HT2B antagonist. Piromelatine (Neu-P11) possesses sleep promoting, analgesic, anti-neurodegenerative, anxiolytic and antidepressant potentials. Piromelatine (Neu-P11) also possesses pain-related P2X3, TRPV1, and Nav1.7 channel-inhibition capacities.
  • HY-107353
    Gadopentetic acid

    Gd-DTPA; gadolinium complex

    Others Others
    Gadopentetic acid (Gd-DTPA) is an paramagnetic contrast agent commonly implemented by a bolus intravenous injection (i.v.) in Dynamic contrast-enhanced MRI (DCE-MRI) studies. The initial concentration of Gadopentetic acid (Gd-DTPA) in the plasma ([Gd-DTPA0]) is an important parameter for DCE-MRI. [Gd-DTPA0] is related to the administered bolus dose and varies with subjects. A bolus of 0.025 mmol/kg Gd-DTPA offers shorter acquisition time and less exposure of subjects, with a half-life of 37.3 mins, a mean residence time of 53.8 mins, and an AUC of 3.37 ± 0.47 mmol/min/L.
  • HY-109041
    Razuprotafib

    AKB-9778

    Phosphatase Inflammation/Immunology
    Razuprotafib (AKB-9778) is a potent and selective inhibitor of the catalytic activity of VE-PTP (vascular endothelial protein tyrosine phosphatase) with an IC50of 17 pM. Razuprotafib promotes TIE2 activation, enhances ANG1-induced TIE2 activation, and stimulates phosphorylation of signaling molecules in the TIE2 pathway, including AKT, eNOS, and ERK. Razuprotafib inhibits the structurally related phosphatase PTP1B with an IC50 of 780 nM. Razuprotafib shows excellent selectivity for VE-PTP versus a variety of phosphatases, with the exception of HPTPη (IC50=36 pM) and HPTPγ (100 pM).
  • HY-16561
    Resveratrol

    trans-Resveratrol; SRT501

    IKK Autophagy Mitophagy Sirtuin Apoptosis Bacterial Fungal Antibiotic Keap1-Nrf2 Cancer Infection Inflammation/Immunology
    Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator. Resveratrol is a potent pregnane X receptor (PXR) inhibitor. Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model. Resveratrol increases production of NO in endothelial cells.
  • HY-P9978
    Toripalimab

    PD-1/PD-L1 Cancer
    Toripalimab is the first domestic anti-tumor PD-1 antibody in China. Toripalimab is a selective, recombinant, humanized monoclonal antibody against PD-1. Toripalimab is able to bind to PD-1 and block the interaction with its ligands. Toripalimab has exhibited primary anti-tumor effects in tumors such as melanoma, lung cancer, digestive tract tumors, hepatobiliary and pancreatic tumors, neuroendocrine neoplasms, nasopharyngeal carcinoma and urothelial carcinoma.
  • HY-150579
    Keap1-Nrf2-IN-13

    Keap1-Nrf2 Cancer Inflammation/Immunology
    Keap1-Nrf2-IN-13 is a Keap1-Nrf2 protein–protein interaction (PPI) inhibitor with an IC50 value of 0.15 μM. Keap1-Nrf2-IN-13 has strong binding affinities to the Keap1 protein by forming hydrogen bond with the key polar residues (Asn414, Arg415, Arg483, Gln530). Keap1-Nrf2-IN-13 can be used in the research of oxidative stress-related and inflammatory diseases, including pulmonary fibrosis, chronic obstructive pulmonary disorder (COPD) and cancers.
  • HY-N3584
    Paris saponin VII

    Chonglou Saponin VII

    Akt p38 MAPK P-glycoprotein Bcl-2 Family Caspase PARP Autophagy Apoptosis Cancer
    Paris saponin VII (Chonglou Saponin VII) is a steroidal saponin isolated from the roots and rhizomes of Trillium tschonoskii Maxim. Paris saponin VII-induced apoptosis in K562/ADR cells is associated with Akt/MAPK and the inhibition of P-gp. Paris saponin VII attenuates mitochondrial membrane potential, increases the expression of apoptosis-related proteins, such as Bax and cytochrome c, and decreases the protein expression levels of Bcl-2, caspase-9, caspase-3, PARP-1, and p-Akt. Paris saponin VII induces a robust autophagy in K562/ADR cells and provides a biochemical basis in the treatment of leukemia.
  • HY-136265
    BC-LI-0186

    Aminoacyl-tRNA Synthetase Cancer
    BC-LI-0186 is a potent and selective inhibitor of Leucyl-tRNA synthetase (LRS; LeuRS) and Ras-related GTP-binding protein D (RagD) interaction (IC50=46.11 nM). BC-LI-0186 competitively binds to the RagD interacting site of LRS (Kd=42.1 nM) and has on effects on LRS-Vps34, LRS-EPRS, RagB-RagD association, mTORC1 complex formation or the activities of 12 kinases. BC-LI-0186 can effectively suppress the activity of cancer-associated MTOR mutants and the growth of rapamycin-resistant cancer cells. BC-LI-0186 is a promising agent for lung cancer research.
  • HY-143885
    JAK1/TYK2-IN-3

    JAK Inflammation/Immunology
    JAK1/TYK2-IN-3 is a potent, selective and orally active dual TYK2/JAK1 inhibitor with IC50 values of 6 and 37 nM, respectively. JAK1/TYK2-IN-3 also shows selectively relative to JAK2 (IC50=140 nM) and JAK3 (IC50=362 nM). JAK1/TYK2-IN-3 shows anti-inflammatory effect by regulating the expression of related TYK2/JAK1-regulated genes, as well as the formation of Th1, Th2, and Th17 cells.
  • HY-15648B
    GSK-J4

    Histone Demethylase Apoptosis Cancer
    GSK-J4 is a potent dual inhibitor of H3K27me3/me2-demethylases JMJD3/KDM6B and UTX/KDM6A with IC50s of 8.6 and 6.6 μM, respectively. GSK-J4 inhibits LPS-induced TNF-α production in human primary macrophages with an IC50 of 9 μM. GSK J4 is a cell permeable prodrug of GSK-J1. GSK-J4 induces endoplasmic reticulum stress-related apoptosis.
  • HY-113960
    ERRα antagonist-1

    Estrogen Receptor/ERR Cancer
    ERRα antagonist-1 (Compound A) is a selective and high affinity estrogen-related receptor α (ERRα) antagonist. ERRα antagonist-1 inhibits interaction of ERRα with Proliferator-activated Receptor γ Coactivator-1α (PGC-1α) and PGC-1β, the IC50 values are 170 nM and 180 nM, respectively. ERRα antagonist-1 does not inhibit the interaction of either ERRβ or ERRγ with PGC-1α and PGC-1β coactivator, and also does not inhibit interaction of ERα or ERβ with PGC-1α or SRC-1.
  • HY-16561S
    Resveratrol-d4

    trans-Resveratrol-d4; SRT501-d4

    IKK Autophagy Mitophagy Sirtuin Apoptosis Bacterial Fungal Antibiotic Keap1-Nrf2 Cancer Infection Inflammation/Immunology
    Resveratrol-d4 (trans-Resveratrol-d4) is the deuterium labeled Resveratrol. Resveratrol (trans-Resveratrol; SRT501), a natural polyphenolic phytoalexin that possesses anti-oxidant, anti-inflammatory, cardioprotective, and anti-cancer properties. Resveratrol (SRT 501) has a wide spectrum of targets including mTOR, JAK, β-amyloid, Adenylyl cyclase, IKKβ, DNA polymerase. Resveratrol also is a specific SIRT1 activator. Resveratrol is a potent pregnane X receptor (PXR) inhibitor. Resveratrol is an Nrf2 activator, ameliorates aging-related progressive renal injury in mice model. Resveratrol increases production of NO in endothelial cells.
  • HY-103211
    L748337

    Adrenergic Receptor Cancer Metabolic Disease Cardiovascular Disease
    L748337 is a potent β3-adrenergic receptor antagonist and displays selectivity over β1 and β2 receptors. The Ki values of L748337 for β3-, β2- and β1-adrenoceptors are 4.0 nM, 204 nM and 390 nM, respectively. L748337 couples predominantly to Gi to activate MAPK signaling and increases phosphorylation of Erk1/2 with pEC50 value of 11.6. L748337 can be used for the research of cancer, nonalcoholic fatty liver disease (NAFLD), and cardiovascular related diseases.
  • HY-112363
    Aloisine A

    RP107

    CDK GSK-3 ERK JNK CFTR Cancer Inflammation/Immunology
    Aloisine A (RP107) is a a potent cyclin-dependent kinase (CDK) inhibitor with IC50s of 0.15 μM, 0.12 μM, 0.4 μM, 0.16 μM for CDK1/cyclin B, CDK2/cyclin A, CDK2/cyclin E, CDK5/p35, respectively. Aloisine A ininhibits GSK-3α (IC50=0.5 µM) and GSK-3β (IC50=1.5 µM). Aloisine A stimulates wild-type CFTR and mutated CFTR, with submicromolar affinity by a cAMP-independent mechanism. Aloisine A has the potential for CFTR-related diseases, including cystic fibrosis research.
  • HY-P99032
    Monalizumab

    Checkpoint Kinase (Chk) IFNAR Cancer Inflammation/Immunology
    Monalizumab is a first-in-class immune checkpoint inhibitor targeting Natural Killer Group 2A (NKG2A). Monalizumab, a humanized anti-NKG2A blocking mAb, increases IFN-γ production, thereby promoting NK cell effector functions. Monalizumab can be used for the research of head and neck squamous cell carcinoma (HNSCC).
  • HY-B1890
    (±)-Catechin

    rel-Cianidanol; rel-Catechuic acid

    COX Cancer Infection Inflammation/Immunology Neurological Disease Cardiovascular Disease
    (±)-Catechin (rel-Cianidanol) is the racemate of Catechin. (±)-Catechin has two steric forms of (+)-Catechin and its enantiomer (-)-Catechin. (+)-Catechin inhibits cyclooxygenase-1 (COX-1) with an IC50 of 1.4 μM. Anticancer, anti-obesity, antidiabetic, anticardiovascular, anti-infectious, hepatoprotective, and neuroprotective effects.
  • HY-P3434
    Ac-FEID-CMK

    Pyroptosis Inflammation/Immunology
    Ac-FEID-CMK is a potent zebrafish-specific GSDMEb-derived peptide inhibitor. Ac-FEID-CMK can attenuate the mortality and kidney injury during septic shock. Ac-FEID-CMK inhibits pyroptosis and attenuates septic AKI (acute kidney injury) in vivo. Ac-FEID-CMK can suppress the caspy2-mediated noncanonical inflammasome pathway.
  • HY-14614C
    S-Adenosyl-L-methionine (p-toluenesulfonate)

    Endogenous Metabolite Endocrinology Metabolic Disease Neurological Disease
    S-Adenosyl-L-methionine (p-toluenesulfonate) is a naturally occurring molecule distributed to virtually all body tissues and fluids. S-Adenosyl-L-methionine takes parts in biochemical reactions involving enzymatic transmethylation, acting as a methyl group donor. S-Adenosyl-L-methionine can prevent mortality induced by Acetaminophen and acute and chronic lead poisoning in animals model. S-Adenosyl-L-methionine also possess antidepressant property.
  • HY-20167A
    H-Glu(OtBu)-OtBu hydrochloride

    Neurokinin Receptor Neurological Disease
    H-Glu(OtBu)-OtBu hydrochloride is a glutamate derivative that can be used for substance P antagonist synthesis.
  • HY-Y1091
    D-Lysine

    Endogenous Metabolite Others
    D-Lysine is a useful raw material employed as an analog of lutenizing-hormone-releasing hormone and as a drug carrier in the form of polylysine. D-Lysine decreases renal uptake of radioactivity during scintigraphy and PRRT with low toxicity. D-Lysine not interferes with the natural amino acid metabolic balance.
  • HY-W104304
    2-(3-Trifluoromethylphenyl)glycine hydrochloride

    Vasopressin Receptor Cardiovascular Disease
    2-(3-Trifluoromethylphenyl)glycine hydrochloride is a precursor of substituted 2-acetamido-5-aryl-l, 2,4-triazolones. Substituted 2-acetamido-5-aryl-l, 2,4-triazolones are dual V1a/V2 receptor antagonists and can be used in cardiovascular disease research.
  • HY-W141810
    4-Amino-L-phenylalanine hydrochloride

    H-Phe(4-NH2)-OH hydrochloride

    Endogenous Metabolite Others
    4-Amino-L-phenylalanine (H-Phe(4-NH2)-OH) hydrochloride is an endogenous metabolite.
  • HY-W000665
    2,6-Dimethyl-L-tyrosine

    Dmt

    Opioid Receptor Neurological Disease
    2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides.
  • HY-100838
    cis-α-(Carboxycyclopropyl)glycine

    L-CCG III

    EAAT2 Neurological Disease
    cis-α-(Carboxycyclopropyl)glycine (L-CCG III) is a potent, competitive glutamate uptake inhibitor. cis-α-(Carboxycyclopropyl)glycine is a substrate of glutamate transporters (GluT) (EC50: 13 μM, 2 μM for EAAT 1 and EAAT 2, respectively). cis-α-(Carboxycyclopropyl)glycine inhibits a Na +-dependent high-affinity L-glutamate uptake in glial plasmalemmal vesicles (GPV) and synaptosomes.
  • HY-138903
    L-Homocysteic acid

    L-HCA

    iGluR Neurological Disease
    L-Homocysteic acid (L-HCA) is an endogenous excitatory amino acid that acts as a NMDA receptor agonist (EC50: 14 μM). L-Homocysteic acid is neurotoxic, and can be used in the research of neurological disorders.
  • HY-W141880
    N-Lauroylglycine

    N-Dodecanoyl-glycine; NSC 404235

    Others
    N-Lauroylglycine (N-Dodecanoyl-glycine) is a glycine derivative.
  • HY-P3434A
    Ac-FEID-CMK TFA

    Pyroptosis Inflammation/Immunology
    Ac-FEID-CMK TFA is a potent zebrafish-specific GSDMEb-derived peptide inhibitor. Ac-FEID-CMK TFA can attenuate the mortality and kidney injury during septic shock. Ac-FEID-CMK TFA inhibits pyroptosis and attenuates septic AKI (acute kidney injury) in vivo. Ac-FEID-CMK TFA can suppress the caspy2-mediated noncanonical inflammasome pathway.
  • HY-W048479
    7-Iodo-2',3'-dideoxy-7-deaza-guanosine

    Nucleoside Antimetabolite/Analog DNA/RNA Synthesis Others
    7-Iodo-2',3'-dideoxy-7-deaza-guanosine is a dideoxynucleoside that can be used in DNA synthesis and sequencing reactions.
  • HY-132137
    5-Propargylamino-3'-azidomethyl-dUTP

    DNA/RNA Synthesis Others
    5-Propargylamino-3'-azidomethyl-dUTP is a nucleoside molecule extracted from patent WO2004018497A2, compound 5. 5-Propargylamino-3'-azidomethyl-dUTP can be used in DNA synthesis and DNA sequencing.
  • HY-W013715A
    Deoxythymidine-5'-triphosphate trisodium

    dTTP trisodium

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Endogenous Metabolite Others
    Deoxythymidine-5'-triphosphate (dTTP) trisodium is one of the four nucleoside triphosphates used in the synthesis of DNA.
  • HY-W048490
    7-Deaza-2'-deoxy-7-iodoadenosine

    DNA/RNA Synthesis Others
    7-Deaza-2'-deoxy-7-iodoadenosine is a modified oligonucleotide containing 7-Deazaadenine.
  • HY-W006103
    I-bu-rG Phosphoramidite

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    I-bu-rG Phosphoramidite is a phosphinamide monomer which can be used in the synthesis of nucleotides and nucleic acids.
  • HY-137697
    ddCTP

    DNA/RNA Synthesis HIV Protease Infection
    ddCTP is one of 2',3'-dideoxyribonucleoside 5'-triphosphates (ddNTPs) that acts as chain-elongating inhibitor of DNA polymerase for DNA sequencing. ddCTP is a nucleoside analog that targets the reverse transcriptase of human immunodeficiency virus (HIV). ddCTP can be used for AIDS research.
  • HY-W013059
    DMT-dA(bz) Phosphoramidite

    DA-CE phosphoramidite

    DNA/RNA Synthesis Others
    DMT-dA(bz) Phosphoramidite is typically used in the synthesis of DNA.
  • HY-128036
    ddATP

    2',3'-Dideoxyadenosine 5'-triphosphate

    DNA/RNA Synthesis Infection
    ddATP is a dideoxynucleotide, acts as a chain-elongating inhibitor of DNA polymerase, used for Sanger method for DNA sequencing.
  • HY-W048478
    2',3'-Dideoxy-5-iodocytidine

    Bacterial Antibiotic Others
    2',3'-Dideoxy-5-iodocytidine is used for gene sequencing can be used as an antibiotic. 2',3'-Dideoxy-5-iodocytidine is particular effective against Mycobacterium.
  • HY-101400A
    Deoxycytidine triphosphate trisodium salt

    dCTP trisodium salt; 2′-Deoxycytidine-5′-triphosphate trisodium salt

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Endogenous Metabolite Metabolic Disease
    Deoxycytidine triphosphate trisodium salt (dCTP trisodium salt) is a nucleoside triphosphate that can be used for DNA synthesis. Deoxycytidine triphosphate trisodium salt has many applications, such as real-time PCR, cDNA synthesis, and DNA sequencing.
  • HY-W048492
    7-Iodo-7-deaza-2'-deoxyguanosine

    7-Deaza-7-Iodo-2'-deoxyguanosine

    DNA/RNA Synthesis Others
    7-Iodo-7-deaza-2'-deoxyguanosine (7-Deaza-7-Iodo-2'-deoxyguanosine) is a deoxyguanosine derivative that can be used in DNA synthesis and sequencing reactions.
  • HY-132145
    5-Propargylamino-ddUTP

    DNA/RNA Synthesis Others
    5-Propargylamino-ddUTP, a nucleoside molecule that can be used to synthesis of cyanine dye-nucleotide conjugate which is used in nucleic acid labeling or sequence analysis.
  • HY-W013068
    DMT-dT Phosphoramidite

    DNA/RNA Synthesis Others
    DMT-dT Phosphoramidite is typically used in the synthesis of DNA.
  • HY-132142
    5-Propargylamino-dCTP

    DNA/RNA Synthesis Others
    5-Propargylamino-dCTP is a nucleoside molecule extracted from patent US9035035B2, compound dCTP-PA. 5-Propargylamino-dCTP can conjugate to molecular markers for use in nucleic acid labeling or sequence analysis.
  • HY-137694
    ddTTP

    DNA/RNA Synthesis Others
    ddTTP is one of 2',3'-dideoxyribonucleoside 5'-triphosphates (ddNTPs) that acts as chain-elongating inhibitor of DNA polymerase for DNA sequencing.
  • HY-132141
    5-PA-dUTP

    5-Propargylamino-dUTP

    DNA/RNA Synthesis Others
    5-PA-dUTP (5-Propargylamino-dUTP) is a C5-modified nucleotide and can be incorporated into DNA nanoparticles (DNPs) for photosensitizer delivery.
  • HY-134103
    ddGTP

    2′,3′-Dideoxyguanosine 5′-triphosphate

    DNA/RNA Synthesis Others
    ddGTP (2′,3′-Dideoxyguanosine 5′-triphosphate) is one of 2',3'-dideoxyribonucleoside 5'-triphosphates (ddNTPs) that acts as chain-elongating inhibitor of DNA polymerase for DNA sequencing.
  • HY-W077279
    5'-O-DMT-N4-Ac-dC

    N4-Acetyl-2'-deoxy-5'-O-DMT-cytidine

    DNA/RNA Synthesis Others
    5'-O-DMT-N4-Ac-dC (N4-Acetyl-2'-deoxy-5'-O-DMT-cytidine, compound 7), a deoxynucleoside, can be used to synthesize of dodecyl phosphoramidite which is the raw material for dod‐DNA (amphiphilic DNA containing an internal hydrophobic region consisting of dodecyl phosphotriester linkages) synthesis.
  • HY-W048480
    7-Iodo-2',3'-dideoxy-7-deazaadenosine

    Nucleoside Antimetabolite/Analog DNA/RNA Synthesis Others
    7-Iodo-2',3'-dideoxy-7-deazaadenosine is a dideoxynucleoside that can be used in DNA synthesis and sequencing reactions.
  • HY-W008661
    Deoxyguanosine triphosphate trisodium salt

    dGTP trisodium salt; 2'-Deoxyguanosine-5'-triphosphate trisodium salt

    DNA/RNA Synthesis Others
    Deoxyguanosine triphosphate (dGTP) trisodium salt is a nucleotide precursor in cells for DNA synthesis. Deoxyguanosine triphosphate trisodium salt is used in reverse transcription-polymerase chain reaction (RT-PCR) for DNA amplification.
  • HY-132138
    5-Propargylamino-3'-azidomethyl-dCTP

    DNA/RNA Synthesis Others
    5-Propargylamino-3'-azidomethyl-dCTP is a nucleoside molecule extracted from patent WO2004018497A2, compound 17. 5-Propargylamino-3'-azidomethyl-dCTP can be used in DNA synthesis and DNA sequencing.
  • HY-132146
    5-Propargylamino-ddCTP

    DNA/RNA Synthesis Others
    5-Propargylamino-ddCTP, a nucleoside molecule that can be used to synthesis of cyanine dye-nucleotide conjugate which is used in nucleic acid labeling or sequence analysis.
  • HY-W008849
    DMT-dC(bz) Phosphoramidite

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    DMT-dC(bz) Phosphoramidite is typically used in the synthesis of DNA.
  • HY-W008848
    DMT-dG(ib) Phosphoramidite

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    DMT-dG(ib) Phosphoramidite is typically used in the synthesis of DNA.
  • HY-21997
    Dmt-2'fluoro-da(bz) amidite

    DNA/RNA Synthesis Others
    Dmt-2'fluoro-da(bz) amidite, an uniformly modified 2'-deoxy-2'-fluoro phosphorothioate oligonucleotide, is a nuclease-resistant antisense compound with high affinity and specificity for RNA targets. Dmt-2'fluoro-da(bz) amidite is also an intermediate for 5’-DMT-3’-phosphoramidite synthesis.
  • HY-136648A
    2'-Deoxyadenosine-5'-triphosphate trisodium

    dATP trisodium

    Endogenous Metabolite DNA/RNA Synthesis Others
    2'-Deoxyadenosine-5'-triphosphate trisodium (dATP trisodium) is a nucleotide used in cells for DNA synthesis (or replication), as a substrate of DNA polymerase.
  • HY-132136
    DMT-dU-CE Phosphoramidite

    DNA/RNA Synthesis Others
    DMT-dU-CE Phosphoramidite is a nucleoside molecule that can be used in DNA synthesis and DNA sequencing.
  • HY-W093086
    DMT-2'-F-Bz-dA

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    DMT-2'-F-Bz-dA can be used in the synthesis of nucleotides and nucleic acids.
  • HY-W010991
    N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly

    FAPGG

    Angiotensin-converting Enzyme (ACE) Others
    N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination.