Search Result

Results for "

Ace 3 Inhibitors

" in MCE Product Catalog:

By Targets:	Angiotensin-converting Enzyme (ACE) (122) 11β-HSD (2) Akt (1) Angiotensin Receptor (10) Apoptosis (14) Autophagy (8) Bacterial (1) Biochemical Assay Reagents (1) Bradykinin Receptor (1) Casein Kinase (2) Caspase (1) CDK (1) Drug Metabolite (5) Endogenous Metabolite (13) FXR (1) Glucocorticoid Receptor (6) HDAC (1) IKK (1) Influenza Virus (1) Interleukin Related (1) Isotope-Labeled Compounds (2) mAChR (2) MMP (4) Neprilysin (5) NF-κB (1) Opioid Receptor (1) Parasite (1) PKC (1) Reactive Oxygen Species (1) SARS-CoV (14) TGF-beta/Smad (1) TGF-β Receptor (1) TNF Receptor (1) Toll-like Receptor (TLR) (1) VEGFR (1) Xanthine Oxidase (1)
By Research Areas:	Cancer (24) Cardiovascular Disease (102) Endocrinology (13) Infection (14) Inflammation/Immunology (27) Metabolic Disease (13) Neurological Disease (4)

By Targets:

Angiotensin-converting Enzyme (ACE) (122)

11β-HSD (2)

Akt (1)

Angiotensin Receptor (10)

Apoptosis (14)

Autophagy (8)

Bacterial (1)

Biochemical Assay Reagents (1)

Bradykinin Receptor (1)

Casein Kinase (2)

Caspase (1)

CDK (1)

Drug Metabolite (5)

Endogenous Metabolite (13)

FXR (1)

Glucocorticoid Receptor (6)

HDAC (1)

IKK (1)

Influenza Virus (1)

Interleukin Related (1)

Isotope-Labeled Compounds (2)

mAChR (2)

MMP (4)

Neprilysin (5)

NF-κB (1)

Opioid Receptor (1)

Parasite (1)

PKC (1)

Reactive Oxygen Species (1)

SARS-CoV (14)

TGF-beta/Smad (1)

TGF-β Receptor (1)

TNF Receptor (1)

Toll-like Receptor (TLR) (1)

VEGFR (1)

Xanthine Oxidase (1)

By Research Areas:

Cancer (24)

Cardiovascular Disease (102)

Endocrinology (13)

Infection (14)

Inflammation/Immunology (27)

Metabolic Disease (13)

Neurological Disease (4)

158

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Targets Recommended: Angiotensin-converting Enzyme (ACE)

Cat. No.	Product Name	Target	Research Areas

HY-P99590

Sotatercept Ace-011	TGF-β Receptor	Cancer Inflammation/Immunology
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions.

HY-P99720

Luspatercept Ace-536; luspatercept–aamt	TGF-beta/Smad	Metabolic Disease
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits *Smad2/3* signaling. Luspatercept can be used for the research of anemia.

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide.

HY-N10860

5-O-beta-D-Glucopyranosylmyricanol	Others	Others
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE).

HY-107337

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases.

HY-A0116S

Trandolaprilate D5 Trandolaprilat d₅; RU 44403 d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-B0331

Enalapril MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research.

HY-B0331B

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril (MK-421) sodium is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research.

HY-121232

Delapril CV-3317	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril (CV-3317) is an orally active angiotensin I converting enzyme (ACE) inhibitor. Delapril has antihypertensive activity.

HY-N9314

Camellianin B	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.

HY-B0690

Fosinopril SQ28555 free acid	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril (SQ28555 free acid) is the ester proagent of angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on *ACE* activity with an K_i value of 1.675 μM.

HY-A0230A

Spirapril hydrochloride SCH 33844 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Spirapril (SCH 33844) hydrochloride is a potent angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure.

HY-19414A

(R)-MLN-4760	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
(R)-MLN-4760, the R-enantiomer of MLN-4760, is an *ACE2* inhibitor, with an IC₅₀ of 8.4 μM. (R)-MLN-4760 is the less active isomer.

HY-P2983

Angiotensin-converting enzyme Ace; kininase II; CD143	Endogenous Metabolite	Cardiovascular Disease
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies.

HY-B0382

Fosinopril sodium SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Endocrinology Metabolic Disease
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca²⁺ levels. Angiotensin II also acts at the Na⁺/H⁺ exchanger in the proximal tubules of the kidney.

HY-B1433

Perindoprilat S 9780	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research.

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme (ACE, HY-P2983).

HY-137875

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

HY-P3424

NH2-AKK-COOH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NH2-AKK-COOH, a synthetic tripeptide, is an *ACE* inhibitor, with IC₅₀s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively.

HY-127026A

Quinaprilat hydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat hydrate is a non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat hydrate specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat hydrate acts as anti-hypertensive agent and vasodilator.

HY-127026

Quinaprilat	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat is an orally active non-mercapto Angiotensin Converting Enzyme (ACE) inhibitor, the active metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits the degradation of bradykinin. Quinaprilat acts as anti-hypertensive agent and vasodilator.

HY-143886

AD011	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
AD011 is a dual inhibitor of cACE/NEP. AD011 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD011 has the potential for providing the potent antihypertensive and cardioprotective benefits.

HY-143888

AD013	Angiotensin-converting Enzyme (ACE)	Others
AD013 is a dual inhibitor of cACE/NEP. AD013 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD013 has the potential for providing the potent antihypertensive and cardioprotective benefits.

HY-143887

AD012	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
AD012 is a dual inhibitor of cACE/NEP. AD012 is synthesized based on the previously reported C-domain selective ACE inhibitor lisinopril-tryptophan. AD012 has the potential for providing the potent antihypertensive and cardioprotective benefits.

HY-A0115

Ramiprilat HOE 498 diacid; Ramipril diacid	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research.

HY-P2222

DX600 TFA
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.

DX600 TFA	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
DX600 TFA is an *ACE2* specific inhibitor, and do not cross-react with ACE.

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Cancer Inflammation/Immunology Cardiovascular Disease
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research.

HY-N0214

Peimisine Ebeiensine	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Cancer Inflammation/Immunology Cardiovascular Disease
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research.

HY-122445

Resorcinolnaphthalein	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cardiovascular Disease
Resorcinolnaphthalein is a specific angiotensin-converting enzyme 2 (ACE2) enhancer and activates ACE2 activity with an EC₅₀ value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis.

HY-N3470

Isomartynoside	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens. IC₅₀: 505.9 µM (ACE)

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-125112

Vicenin-1	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM).

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH
Caspase Angiotensin-converting Enzyme (ACE) Others

Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2).

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2).

HY-D0866

ACES N-(2-Acetamido)-2-aminoethanesulfonic acid	Biochemical Assay Reagents	Others
ACES (N-(2-Acetamido)-2-aminoethanesulfonic acid) is a zwitterionic buffer. The working pH range of ACES buffer is 6.8-7.2.

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE).

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM. Antihypertensive tripeptides.

HY-18205

RXPA 380	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a K_i of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC₅₀ of 2.5 nM.

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM. Antihypertensive tripeptides.

HY-P2536

Mca-Ala-Pro-Lys(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung. Storage: protect from light.

HY-101681

Utibapril
FPL 63547
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

Utibapril is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities.
HY-108321

Zofenopril
Angiotensin-converting Enzyme (ACE) Neurological Disease

Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 81 μM.
HY-U00041

Pivalopril
Pivopril; RHC 3659(S)
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities.

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 81 μM.

Pivalopril Pivopril; RHC 3659(S)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.

HY-19414

MLN-4760	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
MLN-4760 is a potent and selective human *ACE2* inhibitor (IC₅₀, 0.44 nM), with excellent selectivity (>5000-fold) versus related enzymes including human testicular ACE (IC₅₀, >100 μM) and bovine carboxypeptidase A (CPDA; IC₅₀, 27 μM).

HY-P0143

Leucylarginylproline
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.
HY-B0279

Ramipril
HOE-498
Angiotensin-converting Enzyme (ACE) Apoptosis Cardiovascular Disease Cancer

Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

HY-U00074

Rentiapril racemate SA-446 rAcemate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an angiotensin converting enzyme (ACE) inhibitor.

HY-18208

Omapatrilat BMS-186716	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Omapatrilat is a dual inhibitor of the metalloproteases *ACE* and NEP with K_i values of 0.64 and 0.45 nM, respectively.

HY-B0331A

Enalapril maleate MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

HY-A0043A

Cilazapril monohydrate Ro 31-2848 monohydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043

Cilazapril Ro 31-2848	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-114412A

TD-0212 TFA	Angiotensin Receptor Neprilysin	Inflammation/Immunology
TD-0212 TFA is an orally active dual pharmacology angiotensin II type 1 receptor (AT₁) antagonist and neprilysin (NEP) inhibitor, with a pK_i of 8.9 for AT₁ and a pIC₅₀ of 9.2 for NEP.

HY-114412

TD-0212	Angiotensin Receptor Neprilysin	Inflammation/Immunology Endocrinology
TD-0212 (compound 35) is an orally active dual pharmacology angiotensin II type 1 receptor (AT₁) antagonist and neprilysin (NEP) inhibitor, with a pK_i of 8.9 for AT₁ and a pIC₅₀ of 9.2 for NEP.

HY-106446

Rentiapril SA-446	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity.

HY-B0331AS

Enalapril D5 maleate MK-421-d₅(maleate)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0477

Quinapril hydrochloride CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

HY-A0230

Spirapril SCH 33844	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Spirapril is a potent and cross the blood-brain barrier angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity. Spirapril competitively binds to ACE and prevents the conversion of angiotensin I to angiotensin II. Spirapril is an orally active proagent of Spiraprilat and can be used for the research of hypertension, congestive heart failure.

HY-100450

BML-111	Angiotensin-converting Enzyme (ACE)	Cancer Inflammation/Immunology Cardiovascular Disease
BML-111, a lipoxin A₄ analog, is a lipoxin A₄ receptor agonist. BML-111 represses the activity of angiotensin converting enzyme (ACE) and increases the activity of angiotensinconverting enzyme 2 (ACE2). BML-111 has antiangiogenic, antitumor and anti-inflammatory properties.

HY-116023

Moveltipril Moveltipril calcium; MC-838	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor.

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P4420

H-Lys-Trp-OH
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

H-Lys-Trp-OH (KW) is an ACE inhibitory peptide with an IC₅₀ of 7.8 μM.

HY-P0095

Acetyl tetrapeptide-5	Angiotensin-converting Enzyme (ACE)	Others
Acetyl tetrapeptide-5 inhibits glycosylation and *ACE-1* activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care.

HY-18207

Fasidotril Alatriopril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).

HY-P1032

Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-107318

Alacepril Cetapril; DU-1219	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect.

HY-101577

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity.

HY-106816

Ceronapril Ceranapril; SQ 29852	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ceronapril (SQ 29852) is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ of 36 nM.

HY-B0231AS

Enalaprilat-d5 MK-422 d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0231BS

Enalaprilat-d5 sodium MK-422-d₅ sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-P0266

N-Acetyl-Ser-Asp-Lys-Pro Ac-SDKP	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cardiovascular Disease
N-Acetyl-Ser-Asp-Lys-Pro, an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr
Angiotensin-converting Enzyme (ACE) Others

Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2).

HY-107337S

Delapril-d3 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S

Ramipril-d5	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-P0266A

N-Acetyl-Ser-Asp-Lys-Pro TFA Ac-SDKP TFA	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cardiovascular Disease
N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-123348

Sampatrilat UK-81252	Angiotensin-converting Enzyme (ACE) Neprilysin	Inflammation/Immunology Cardiovascular Disease
Sampatrilat (UK-81252) is a potent and orally active vasopeptidase inhibitor of *ACE* and neutral endopeptidase (NEP). Sampatrilat inhibits C-domain ACE (K_i=13.8 nM) 12.4-fold more potent than that for the N-domain (K_i=171.9 nM). Sampatrilat (UK-81252) can be used for the study of chronic heart failure and blood pressure regulation.

HY-114161

H-Val-Pro-Pro-OH	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-N5063

Plantainoside D	Angiotensin-converting Enzyme (ACE) IKK	Cardiovascular Disease
Plantainoside D shows *ACE* inhibitory activity with IC₅₀ 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.

HY-B0130A

Perindopril erbumine Perindopril tert-butylamine salt; S-9490 erbumine	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Perindopril erbumine (Perindopril tert-butylamine salt) is a potent ACE inhibitor of which is used to treat high blood pressure, heart failure or stable coronary artery disease.

HY-109592

Imidaprilate 6366A; Imidaprilat	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC₅₀ of 2.6 nM, and is used in the research of hypertensive disease.

HY-W016393

Dihydroconiferyl alcohol	Others	Others
Dihydroconiferyl alcohol is a cell division factor that can be found in pring sap of Acer pseudoplatanus L. Dihydroconiferyl alcohol can stimulate growth of soybean callus.

HY-B0279S1

Ramipril-d3	Apoptosis Angiotensin-converting Enzyme (ACE)
Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0130

Perindopril S-9490	Angiotensin-converting Enzyme (ACE)	Cancer Cardiovascular Disease
Perindopril (S-9490) is a long-acting ACE inhibitor of which is used to treat high blood pressure, heart failure or stable coronary artery disease.

HY-114161A

H-Val-Pro-Pro-OH TFA	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-N2165

Vicenin 2	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=43.83 μM) from the aerial parts of Desmodium styracifolium.

HY-N4090

Vicenin 3	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium.

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination.

HY-117281

Moexipril	Angiotensin-converting Enzyme (ACE) Apoptosis	Neurological Disease Cardiovascular Disease
Moexipril is an orally active inhibitor of angiotensin-converting enzyme (ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril exhibits antihypertensive and neuroprotective effects^-.

HY-P1853

Abz-FR-K(Dnp)-P-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

HY-B0592S

Trandolapril D5 RU44570 d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-B0378A

Moexipril hydrochloride RS-10085	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Moexipril hydrochloride (RS-10085) is an orally active inhibitor of angiotensin-converting enzyme (ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril hydrochloride exhibits antihypertensive and neuroprotective effects^-.

HY-B0260

Methylprednisolone U 7532	Glucocorticoid Receptor Autophagy SARS-CoV Bacterial	Cancer Infection Endocrinology Inflammation/Immunology
Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating *ACE2* and reducing IL-6 levels.

HY-B0384

Temocapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocapril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases.

HY-P3985

Bradykinin potentiator B Bradykinin potentiating peptide B	Angiotensin-converting Enzyme (ACE)	Others
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent *ACE* inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.

HY-100713

Temocapril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocapril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Temocapril can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases.

HY-121460

Spiraprilat	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Spiraprilat is a potent angiotensin-converting enzyme (ACE) inhibitor. Spiraprilat has ability to improve left ventricular (LV) function and metabolism in anesthetized open-chest dogs with acute ventricular failure (ALVF).

HY-107352

Fosfenopril Fosinoprilat; Fosinoprilic acid; SQ 27519	Angiotensin-converting Enzyme (ACE) Toll-like Receptor (TLR) NF-κB TNF Receptor Interleukin Related	Inflammation/Immunology Cardiovascular Disease
Fosfenopril (Fosinoprilat) is a potent angiotensin converting enzyme (ACE) inhibitor. Fosfenopril alleviates lipopolysaccharide (LPS)-induced inflammation by inhibiting TLR4/NF-κB signaling in monocytes.

HY-109592S

Imidaprilate-d5 6366A-d₅; Imidaprilat-d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-A0116A

Trandolaprilate hydrate Trandolaprilat hydrate; RU 44403 hydrate	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate hydrate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.

HY-A0116

Trandolaprilate Trandolaprilat; RU 44403	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity.

HY-B1451S

Imidapril-d3 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-A0117

Temocaprilat Temocapril diacid; Temocaprilate; RS 5139	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocaprilat (Temocapril diacid) is an inhibitor of angiotensin-converting enzyme (ACE). Temocaprilat alleviates the inhibitory effect of high glucose on the proliferation of aortic endothelial cells. Temocaprilat has potential applications in hypertension and vascular inflammation.

HY-138067

SSAA09E2	SARS-CoV	Inflammation/Immunology
SSAA09E2 is an inhibitor of SARS-CoV (Severe acute respiratory syndrome-Coronavirus) replication, acting by blocking early interactions of SARS-S with the receptor for SARS-CoV, Angiotensin Converting Enzyme-2 (ACE2) .

HY-B0260S1

Methylprednisolone-d5 U 7532-d₅	Glucocorticoid Receptor Autophagy SARS-CoV	Cancer Infection Endocrinology Inflammation/Immunology
Methylprednisolone-d₅ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0231A

Enalaprilat MK-422 anhydrous	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat (MK-422 anhydrous), the active metabolite of the oral proagent Enalapril, is a potent, competitive and long-acting angiotensin-converting enzyme (ACE) inhibitor, with an IC₅₀ of 1.94 nM. Enalaprilat can be used for the research of hypertension.

HY-100713S

Temocapril-d5	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-B0260S

Methylprednisolone-d3 U 7532-d₃	Glucocorticoid Receptor Autophagy SARS-CoV	Cancer Infection Endocrinology Inflammation/Immunology
Methylprednisolone-d₃ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S2

Methylprednisolone-d4 U 7532-d₄	Glucocorticoid Receptor Autophagy SARS-CoV	Cancer Infection Endocrinology Inflammation/Immunology
Methylprednisolone-d₄ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S3

Methylprednisolone-d7 U 7532-d₇	Glucocorticoid Receptor Autophagy SARS-CoV	Cancer Infection Endocrinology Inflammation/Immunology
Methylprednisolone-d₇ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-12403A

Angiotensin (1-7) (acetate) Ang-(1-7) (Acetate)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Endocrinology Inflammation/Immunology Cardiovascular Disease
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium.

HY-W015332

Captopril EP Impurity D 3-Bromoisobutyric acid	Drug Metabolite	Others
Captopril EP Impurity D is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM).

HY-B0260S4

Methylprednisolone-d2 U 7532-d₂	Glucocorticoid Receptor Autophagy SARS-CoV	Others
Methylprednisolone-d₂ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3][4].

HY-137768

Captopril EP Impurity B	Drug Metabolite	Others
Captopril EP Impurity B is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM).

HY-W013886

Captopril EP Impurity J S-Acetylcaptopril	Drug Metabolite	Others
Captopril EP Impurity J is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM).

HY-137769

Captopril EP Impurity C 3-Mercaptoisobutyric acid	Drug Metabolite	Others
Captopril EP Impurity C is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM).

HY-B0592

Trandolapril RU44570	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).

HY-P99346

Regdanvimab CT-P59	SARS-CoV Angiotensin-converting Enzyme (ACE)	Infection
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with *ACE2* for viral entry. Regdanvimab can be used for the research of COVID-19.

HY-B0231

Enalaprilat dihydrate MK-422	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat dihydrate (MK-422), the active metabolite of the oral proagent Enalapril, is a potent, competitive and long-acting angiotensin-converting enzyme (ACE) inhibitor, with an IC₅₀ of 1.94 nM. Enalaprilat dihydrate can be used for the research of hypertension.

HY-137772

Captopril EP Impurity E	Drug Metabolite	Others
Captopril EP Impurity E is an impurity of Captopril. Captopril (SQ-14534), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM).

HY-P9801

Anti-Spike-RBD mAb SARS-CoV-2 (2019-nCoV) Spike RBD Antibody	SARS-CoV	Infection
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment.

HY-B0592A

Trandolapril hydrochloride RU44570 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolapril (RU44570) hydrochloride is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolapril hydrochlorideat. Trandolapril hydrochloride is an orally active angiotensin converting enzyme *(ACE)* inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI).

HY-12403

Angiotensin (1-7) Ang-(1-7)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Inflammation/Immunology Cardiovascular Disease Endocrinology
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity ^[1].

HY-A0115S1

Ramiprilat-d5	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-D1270

Direct Violet 1	SARS-CoV	Infection
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and *ACE2* inhibitor with IC₅₀s of 1.47-2.63 µM.

HY-107339

Deserpidine Harmonyl	Angiotensin-converting Enzyme (ACE)	Metabolic Disease Neurological Disease
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex.

HY-A0116S1

Trandolaprilate-d6	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Cardiovascular Disease
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-114782

H-Tyr-Tyr-OH L-Tyrosyl-L-tyrosine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Tyr-Tyr-OH (L-Tyrosyl-L-tyrosine) is an antihypertensive peptide. H-Tyr-Tyr-OH inhibits angiotensin I-converting enzyme (ACE) with an IC₅₀ value of 0.028 mg/mL. H-Tyr-Tyr-OH can be used for the research of high blood pressure.

HY-N2021

Phosphoramidon	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite	Cancer Inflammation/Immunology Cardiovascular Disease
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively.

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP Acetate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties.

HY-W012159

Methionylserine H-MET-SER-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a K_m value of 0.2 mM. Methionylserine inhibits *ACE* enzyme activity. Methionylserine can be used in the research of hypension.

HY-127026S

Quinaprilat-d5	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinaprilat-d₅ is a deuterium-labeled Quinaprilat. Quinaprilat is a nonsulfhydryl ACE inhibitor, the active diacid metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits bradykinin degradation. Quinaprilat primarily acts as a vasodilator, decreasing total peripheral and renal vascular resistance[1].

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research.

HY-N2298

Camellianin A	Apoptosis	Cancer
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population.

HY-N2021A

Phosphoramidon Disodium	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite	Inflammation/Immunology Cardiovascular Disease Cancer
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively.

HY-B1451

Imidapril hydrochloride TA-6366	Angiotensin-converting Enzyme (ACE) MMP	Metabolic Disease Cardiovascular Disease
Imidapril hydrochloride (TA-6366) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril hydrochloride suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril hydrochloride can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research.

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure.

HY-118472

Benazeprilat CGS 14831	Endogenous Metabolite Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Benazeprilat is an orally active and the active metabolite of benazepril, a carboxyl-containing *ACE* inhibitor with antihypertensive activity. Benazepril is a well-established antihypertensive agent, both in monoresearch and in combination with other classes of drugs including thiazide diuretics and calcium channel blockers. Benazepril is a first-line research in reducing various pathologies associated with CV risk and secondary end-organ damage.

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca²⁺ levels. Angiotensin II also acts at the Na⁺/H⁺ exchanger in the proximal tubules of the kidney.

HY-B1451A

Imidapril TA-6366 free base	Angiotensin-converting Enzyme (ACE) MMP	Metabolic Disease Cardiovascular Disease
Imidapril (TA-6366 free base) is an orally active angiotensin-converting enzyme (ACE) and MMP-9 inhibitor. Imidapril suppresses the conversion of angiotensin I to angiotensin II and thereby reduces total peripheral resistance and systemic blood pressure. Imidapril can be used for hypertension, type 1 diabetic, nephropathy and chronic heart failure research.

HY-126419

Kobophenol A	SARS-CoV PKC	Infection
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC₅₀ of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC₅₀ of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC₅₀ of 52 µM.

HY-B0368A

Captopril hydrochloride SQ 14225 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Captopril (SQ 14225) hydrochloride, antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme *(ACE)* inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril hydrochloride is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM.

HY-B0368

Captopril SQ 14225	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme *(ACE)* inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM.

HY-N2533

Cyanidin 3-sambubioside chloride Cyanidin-3-O-sambubioside chloride	Influenza Virus Angiotensin-converting Enzyme (ACE)	Cancer Infection Inflammation/Immunology
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC₅₀ of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties.

HY-12404

Diminazene aceturate Diminazene diAceturate	Parasite Angiotensin-converting Enzyme (ACE)	Infection Inflammation/Immunology
Diminazene aceturate (Diminazene diaceturate) is an anti-trypanosome agent for livestock. The main biochemical mechanism of the trypanocidal actions of Diminazene aceturate is by binding to trypanosomal kinetoplast DNA (kDNA) in a non-intercalative manner through specific interaction with sites rich in adenine-thymine base pairs. Diminazene aceturate is also an angiotensin-converting enzyme 2 (ACE2) activator and has strong and potent anti-inflammatory properties.

HY-110066

(Z)-Guggulsterone	Apoptosis VEGFR Akt Angiotensin-converting Enzyme (ACE) SARS-CoV FXR	Cancer
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis. (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces *ACE2* expression and SARS-CoV-2 infection.

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice.

HY-B0368S

Captopril-d3 SQ 14225-d₃	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.

HY-W011258

H-Tyr-Phe-OH L-Tyrosyl-L-phenylalanine	Xanthine Oxidase Angiotensin-converting Enzyme (ACE)	Cancer Inflammation/Immunology
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of Angiotensin converting enzyme (ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells.

HY-15275

BMS-265246	CDK Angiotensin-converting Enzyme (ACE)	Cancer Infection
BMS-265246 is a potent and selective cyclin-dependent kinase CDK1 and CDK2 inhibitor, with IC₅₀ values of 6 and 9 nM, respectively. BMS-265246 inhibits *CHI3L1* (chitinase 3-like-1) stimulation of *ACE2* (angiotensin converting enzyme 2) and SPP (viral spike protein priming proteases). BMS-265246 can be used for ovarian cancer and COVID-19 research.

HY-W009732

Sinapinic acid Sinapic acid	HDAC Angiotensin-converting Enzyme (ACE) Reactive Oxygen Species Apoptosis	Cancer Metabolic Disease
Sinapinic acid (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Rhizome, acts as an inhibitor of HDAC, with an IC₅₀ of 2.27 mM, and also inhibits *ACE-I* activity. Sinapinic acid posssess potent anti-tumor activity, induces apoptosis of tumor cells. Sinapinic acid shows antioxidant and antidiabetic activities. Sinapinic acid reduces total cholesterol, triglyceride, and HOMA-IR index, and also normalizes some serum parameters of antioxidative abilities and oxidative damage in ovariectomized rats.

HY-14393

Emodin Frangula emodin	SARS-CoV Casein Kinase Autophagy 11β-HSD	Cancer
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.

HY-14393S

Emodin-d4 Frangula emodin-d₄	Isotope-Labeled Compounds SARS-CoV Casein Kinase Autophagy 11β-HSD	Cancer
Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

HY-113478S

Ursodeoxycholic acid-2,2,4,4-d4	Isotope-Labeled Compounds	Infection Metabolic Disease
Ursodeoxycholic acid-2,2,4,4-d₄ is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1502 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1502 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH
Chromogenic Substrates

Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2).

HY-P2536

Mca-Ala-Pro-Lys(Dnp)-OH	Fluorescent Dyes/Probes
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung. Storage: protect from light.

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Chromogenic Substrates Amino acids and Derivatives
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination.

HY-D1270

Direct Violet 1	Dyes
Direct Violet 1, an azo dye, is a textile dye. Direct Violet 1 is also the protein-protein interaction (PPI) between the SARS-CoV-2 spike protein and *ACE2* inhibitor with IC₅₀s of 1.47-2.63 µM.

Cat. No.	Product Name	Type

HY-P2983

Angiotensin-converting enzyme Ace; kininase II; CD143	Enzyme
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies.

Cat. No.	Product Name	Target	Research Area

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide.

HY-P2983

Angiotensin-converting enzyme Ace; kininase II; CD143	Endogenous Metabolite	Cardiovascular Disease
Angiotensin-converting enzyme (ACE) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies.

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Endocrinology Metabolic Disease
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca²⁺ levels. Angiotensin II also acts at the Na⁺/H⁺ exchanger in the proximal tubules of the kidney.

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of Angiotensin-converting enzyme (ACE, HY-P2983).

HY-137875

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

HY-P3424

NH2-AKK-COOH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NH2-AKK-COOH, a synthetic tripeptide, is an *ACE* inhibitor, with IC₅₀s of 0.090 μM, 0.178 μM, and 420.89 μM when FAPGG, HHL, and angiotensin-I are used as substrate respectively.

HY-P2222

DX600 TFA
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

DX600 TFA is an ACE2 specific inhibitor, and do not cross-react with ACE.

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2.

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH
Caspase Angiotensin-converting Enzyme (ACE) Others

Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2).

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE).

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM. Antihypertensive tripeptides.

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide, inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM. Antihypertensive tripeptides.

HY-P2536

Mca-Ala-Pro-Lys(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Mca-Ala-Pro-Lys(Dnp)-OH, a specific ACE2 quenched fluorogenic substrate, can be used to detect ACE2 activity, such as urinary, heart and lung. Storage: protect from light.

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P4420

H-Lys-Trp-OH
Angiotensin-converting Enzyme (ACE) Cardiovascular Disease

H-Lys-Trp-OH (KW) is an ACE inhibitory peptide with an IC₅₀ of 7.8 μM.

HY-P0095

Acetyl tetrapeptide-5	Angiotensin-converting Enzyme (ACE)	Others
Acetyl tetrapeptide-5 inhibits glycosylation and *ACE-1* activity. Acetyl tetrapeptide-5 reduces edema and relieves vascular pressure by improving the vascular system and strengthening the skin under the eyes. Acetyl tetrapeptide-5 can be used in the research of Antioxidant, anti-aging skin care.

HY-P1032

Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P0266

N-Acetyl-Ser-Asp-Lys-Pro Ac-SDKP	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cardiovascular Disease
N-Acetyl-Ser-Asp-Lys-Pro, an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr
Angiotensin-converting Enzyme (ACE) Others

Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2).

HY-P0266A

N-Acetyl-Ser-Asp-Lys-Pro TFA Ac-SDKP TFA	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cardiovascular Disease
N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-114161

H-Val-Pro-Pro-OH	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-114161A

H-Val-Pro-Pro-OH TFA	Angiotensin Receptor	Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme *(ACE), with an IC₅₀* of 9 μM.

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination.

HY-P1853

Abz-FR-K(Dnp)-P-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Abz-FR-K(Dnp)-P-OH is an angiotensin I-converting enzyme (ACE) substrate and an internally quenched fluorogenic substrate for real time fluorescent assay.

HY-P4545

Abz-Gly-p-nitro-Phe-Pro-OH	Peptides	Others
Abz-Gly-p-nitro-Phe-Pro-OH is the fluorescent substrate angiotensin I converting enzyme (ACE-I) with 355 nm excitation and 405 nm emission wavelengths.

HY-P3985

Bradykinin potentiator B Bradykinin potentiating peptide B	Angiotensin-converting Enzyme (ACE)	Others
Bradykinin potentiator B (Bradykinin potentiating peptide B) is venom of Agkistrodon halys blomhoffi. Bradykinin potentiator B is a potent *ACE* inhibitor. Bradykinin potentiator inhibits the activity of bradykinin inhibitory peptidase.

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-12403A

Angiotensin (1-7) (acetate) Ang-(1-7) (Acetate)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Endocrinology Inflammation/Immunology Cardiovascular Disease
Angiotensin 1-7 (Ang-(1-7)) acetate is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 acetate inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acetate acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 acetate blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium.

HY-12403

Angiotensin (1-7) Ang-(1-7)	Angiotensin Receptor Angiotensin-converting Enzyme (ACE) Endogenous Metabolite	Inflammation/Immunology Cardiovascular Disease Endocrinology
Angiotensin 1-7 (Ang-(1-7)) is an endogenous heptapeptide from the renin-angiotensin system (RAS) with a cardioprotective role due to its anti-inflammatory and anti-fibrotic activities in cardiac cells. Angiotensin 1-7 inhibits purified canine *ACE* activity (IC₅₀=0.65 μM). Angiotensin 1-7 acts as a local synergistic modulator of kinin-induced vasodilation by inhibiting ACE and releasing nitric oxide. Angiotensin 1-7 blocks Ang II-induced smooth muscle cell proliferation and hypertrophy and shows antiangiogenic and growth-inhibitory effects on the endothelium. Angiotensin 1-7 shows anti-inflammatory activity ^[1].

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP Acetate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties.

HY-W012159

Methionylserine H-MET-SER-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a K_m value of 0.2 mM. Methionylserine inhibits *ACE* enzyme activity. Methionylserine can be used in the research of hypension.

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research.

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure.

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca²⁺ levels. Angiotensin II also acts at the Na⁺/H⁺ exchanger in the proximal tubules of the kidney.

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice.

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy.

HY-W011258

H-Tyr-Phe-OH L-Tyrosyl-L-phenylalanine	Xanthine Oxidase Angiotensin-converting Enzyme (ACE)	Cancer Inflammation/Immunology
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of Angiotensin converting enzyme (ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells.

Cat. No.	Product Name	Target	Research Area

HY-P99920

Efmitermant alfa Ace083	Inhibitory Antibodies	Others
Efmitermant alfa (ACE-083) is a locally acting, follistatin-based fusion protein. Efmitermant alfa also is a muscle-promoting agent. Efmitermant alfa can be used for the research of muscle disorders.

HY-P99590

Sotatercept Ace-011	TGF-β Receptor	Cancer Inflammation/Immunology
Sotatercept (ACE-011) is a soluble activin receptor 2A (ACVR2A) type IgG Fc fusion protein. Sotatercept combines activin and growth differentiation factor to try to restore the balance between growth promotion and growth inhibition signal pathways. Sotatercept has potential application in pulmonary arterial hypertension, anemia, bone loss, erythropoiesis, multiple myeloma (MM) osteolytic lesions.

HY-P99720

Luspatercept Ace-536; luspatercept–aamt	TGF-beta/Smad	Metabolic Disease
Luspatercept (ACE-536) is a recombinant modified ActRIIB fusion protein that binds with transforming growth factor β superfamily ligands. Luspatercept increases the erythrocyte numbers and promotes maturation of erythroid precursors. Luspatercept binds with GDF11 and inhibits *Smad2/3* signaling. Luspatercept can be used for the research of anemia.

HY-P99346

Regdanvimab CT-P59	SARS-CoV Angiotensin-converting Enzyme (ACE)	Infection
Regdanvimab (CT-P59) is a human monoclonal antibody that targets the receptor-binding domain of SARS-CoV-2 spike protein, blocking interaction with *ACE2* for viral entry. Regdanvimab can be used for the research of COVID-19.

HY-P9801

Anti-Spike-RBD mAb SARS-CoV-2 (2019-nCoV) Spike RBD Antibody	SARS-CoV	Infection
Anti-Spike-RBD mAb is a CHO cell derived human monoclonal IgG1 antibody. Blocking the interaction of Spike protein and ACE2. Anti-Spike-RBD mAb is a potential therapeutic approach for SARS-CoV-2 treatment.

Cat. No.	Product Name	Target	Category

HY-N10860

5-O-beta-D-Glucopyranosylmyricanol	Others	Structural Classification Terpenoids Other Monoterpenes Morella esculenta (Buch.-Ham. ex D. Don) I. M. Turner Plants Source classification Myricaceae
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE).

HY-B0331

Enalapril MK-421	Angiotensin-converting Enzyme (ACE)	Natural Products Classification of Application Fields Disease Research Fields Cardiovascular Disease
Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research.

HY-N9314

Camellianin B	Angiotensin-converting Enzyme (ACE)	Flavonoids Flavones Phenols Polyphenols Classification of Application Fields Disease Research Fields Metabolic Disease Source classification Plants Theaceae Adinandra nitida Merr. ex Li
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities.

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Alkaloids Piperidine Alkaloids Inflammation/Immunology Disease Research Fields Classification of Application Fields Source classification Plants Liliaceae Fritillaria ussuriensis Maxim.
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research.

HY-N0214

Peimisine Ebeiensine	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Alkaloids Piperidine Alkaloids Inflammation/Immunology Disease Research Fields Classification of Application Fields Source classification Plants Liliaceae Fritillaria cirrhosa
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research.

HY-N3470

Isomartynoside	Angiotensin-converting Enzyme (ACE)	Structural Classification Natural Products Salicaceae Populus tomentosa Plants Source classification
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens. IC₅₀: 505.9 µM (ACE)

HY-125112

Vicenin-1	Angiotensin-converting Enzyme (ACE)	Flavonoids Flavones Phenols Polyphenols Classification of Application Fields Disease Research Fields Cardiovascular Disease Source classification Plants Leguminosae Trigonella foenum-graecum Linn.
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM).

HY-P0266A

N-Acetyl-Ser-Asp-Lys-Pro TFA Ac-SDKP TFA	Angiotensin-converting Enzyme (ACE)	Natural Products Classification of Application Fields Disease Research Fields Cardiovascular Disease Source classification Animals
N-Acetyl-Ser-Asp-Lys-Pro (TFA), an endogenous tetrapeptide secreted by bone marrow, is a specific substrate for the N-terminal site of *ACE*.

HY-N5063

Plantainoside D	Angiotensin-converting Enzyme (ACE) IKK	Phenylpropanoids Simple Phenylpropanols Phenols Polyphenols Classification of Application Fields Disease Research Fields Cardiovascular Disease Source classification Plants Scrophulariaceae Picrorhiza scrophulariiflora Pennell
Plantainoside D shows *ACE* inhibitory activity with IC₅₀ 2.17 mM. And plantainoside D is a promising IKK-β inhibitor.

HY-W016393

Dihydroconiferyl alcohol	Others	Monophenols Phenols other families Plants Source classification Other Diseases Disease Research Fields Classification of Application Fields
Dihydroconiferyl alcohol is a cell division factor that can be found in pring sap of Acer pseudoplatanus L. Dihydroconiferyl alcohol can stimulate growth of soybean callus.

HY-B0130

Perindopril S-9490	Angiotensin-converting Enzyme (ACE)	Classification of Application Fields Disease Research Fields Cardiovascular Disease
Perindopril (S-9490) is a long-acting ACE inhibitor of which is used to treat high blood pressure, heart failure or stable coronary artery disease.

HY-N2165

Vicenin 2	Angiotensin-converting Enzyme (ACE)	Phenols Polyphenols Flavones Flavonoids Disease Research Fields Classification of Application Fields Cardiovascular Disease Plants Leguminosae Desmodium styracifolium (Osbeck.) Merr.
Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=43.83 μM) from the aerial parts of Desmodium styracifolium.

HY-N4090

Vicenin 3	Angiotensin-converting Enzyme (ACE)	Phenols Polyphenols Flavones Flavonoids Disease Research Fields Classification of Application Fields Cardiovascular Disease Source classification Plants Leguminosae Desmodium styracifolium (Osbeck.) Merr. other families
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium.

HY-107339

Deserpidine Harmonyl	Angiotensin-converting Enzyme (ACE)	Indole Alkaloids Alkaloids Piperidine Alkaloids Structural Classification Apocynaceae Plants Rauwolfia canescens
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex.

HY-N2021

Phosphoramidon	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite	Ketones, Aldehydes, Acids Microorganisms
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively.

HY-N2298

Camellianin A	Apoptosis	Flavonoids Flavones Phenols Polyphenols Classification of Application Fields Disease Research Fields Cancer Source classification Plants Theaceae Adinandra nitida Merr. ex Li
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population.

HY-N2021A

Phosphoramidon Disodium	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite	Indole Alkaloids Alkaloids Structural Classification Microorganisms Source classification Disease Research Fields Cancer Classification of Application Fields Cardiovascular Disease
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively.

HY-126419

Kobophenol A	SARS-CoV PKC	Phenols Polyphenols Classification of Application Fields Disease Research Fields Infection Source classification Plants Cyperaceae Carex kobomugi Ohwi
Kobophenol A, an oligomeric stilbene, blocks the interaction between the ACE2 receptor and S1-RBD with an IC₅₀ of 1.81 μM and inhibits SARS-CoV-2 viral infection in cells with an EC₅₀ of 71.6 μM. Kobophenol A inhibits the activity of partially purified rat brain protein kinase C (PKC) with an IC₅₀ of 52 µM.

HY-N2533

Cyanidin 3-sambubioside chloride Cyanidin-3-O-sambubioside chloride	Influenza Virus Angiotensin-converting Enzyme (ACE)	Flavonoids Anthocyans Phenols Polyphenols Classification of Application Fields Disease Research Fields Infection Inflammation/Immunology Source classification Plants other families
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC₅₀ of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties.

HY-110066

(Z)-Guggulsterone	Apoptosis VEGFR Akt Angiotensin-converting Enzyme (ACE) SARS-CoV FXR	Steroids Disease Research Fields Cancer Classification of Application Fields Source classification Plants Burseraceae Commiphora myrrha (Nees) Engl.
(Z)-Guggulsterone, a constituent of Indian Ayurvedic medicinal plant Commiphora mukul, inhibits the growth of human prostate cancer cells by causing apoptosis. (Z)-Guggulsterone inhibits angiogenesis by suppressing the VEGF–VEGF-R2–Akt signaling axis. (Z)-Guggulsterone is also a potent FXR antagonist. (Z)-Guggulsterone reduces *ACE2* expression and SARS-CoV-2 infection.

HY-W009732

Sinapinic acid Sinapic acid	HDAC Angiotensin-converting Enzyme (ACE) Reactive Oxygen Species Apoptosis	Phenylpropanoids Simple Phenylpropanols Phenols Monophenols Classification of Application Fields Disease Research Fields Metabolic Disease Source classification Plants other families
Sinapinic acid (Sinapic acid) is a phenolic compound isolated from Hydnophytum formicarum Jack. Rhizome, acts as an inhibitor of HDAC, with an IC₅₀ of 2.27 mM, and also inhibits *ACE-I* activity. Sinapinic acid posssess potent anti-tumor activity, induces apoptosis of tumor cells. Sinapinic acid shows antioxidant and antidiabetic activities. Sinapinic acid reduces total cholesterol, triglyceride, and HOMA-IR index, and also normalizes some serum parameters of antioxidative abilities and oxidative damage in ovariectomized rats.

HY-14393

Emodin Frangula emodin	SARS-CoV Casein Kinase Autophagy 11β-HSD	Quinones Anthraquinones Phenols Polyphenols Disease Research Fields Cancer Classification of Application Fields Source classification Plants Polygonaceae Rheum palmatum L.
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.

Species:	Human (10) Virus (4) Rhesus Macaque (2) Rat (1) Mouse (3) Cynomolgus (3)
Tag:	His (17) Avi (6) Fc (8)
Source:	HEK293 (20) Sf9 insect cells (3) E. coli (1)

Cat. No.	Product Name	Species	Source

HY-P78233

ACE2 Protein, Cynomolgus (HEK293, His-Avi)
Ace-2; AceH; Ace2
Cynomolgus HEK293
HY-P78054

ACE2 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Ace-2; AceH; Ace2
Cynomolgus HEK293
HY-P78055

ACE2 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Ace-2; AceH; Ace2
Human HEK293
HY-P72808

ACE2 Protein, Human (sf9, His)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Human Sf9 insect cells
HY-P72809

ACE2 Protein, Rat (HEK293, His)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Rat HEK293
HY-P72810

ACE2 Protein, Rhesus Macaque (HEK293, Fc)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Rhesus Macaque HEK293
HY-P74433

ACE2 Protein, Mouse (HEK293, His-Fc)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Mouse HEK293

HY-P7992

ACE/CD143 Protein, Human (His) Ace, CD143, DCP, DCP1	Human	E. coli
ACE/CD143 Protein, Human (His) is a recombinant human Angiotensin-converting enzyme/CD143 a His tag at the C-terminus. Angiotensin I-converting enzyme (ACE, CD143) hydrolyzes small peptides such as angiotensin I, bradykinin, substance P, LH-RH and several others and thus plays a key role in blood pressure regulation and vascular remodeling. ACE plays a crucial role in blood pressure regulation, vascular remodeling, and immunity.

HY-P72807

ACE2 Protein, Human (Biotinylated, sf9, His-Avi)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Human Sf9 insect cells

HY-P72029

ACE2 Protein, Macaca fascicularis (HEK293, hFc) Ace2; Angiotensin-converting enzyme	Cynomolgus	HEK293
ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

ACE2 Protein, Human (740a.a, HEK293, His)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Human HEK293
HY-P74434

ACE2 Protein, Mouse (740a.a, HEK293, His)
Angiotensin-converting enzyme 2; Ace-2; AceH; Ace-related carboxypeptidase
Mouse HEK293

HY-P7828

ACE2 Protein, Rhesus macaque (HEK293, His) rRhAngiotensin-converting enzyme/Ace-2, His; Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Rhesus Macaque	HEK293
ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P70084

ACE2 Protein, Mouse (723a.a, HEK293, His) rMuAngiotensin-converting enzyme 2/Ace-2, His; Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Mouse	HEK293
ACE2 Protein, Mouse (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS-CoV protein. ACE2 Protein, Mouse is also an essential regulator of cardiac function and blood pressure control.

HY-P7443

ACE2 Protein, Human (HEK293, mFc) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Human	HEK293
ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

ACE2 Protein, Human (HEK293, hFc, solution) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Human	HEK293
ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P700445

ACE2 Protein, Paguma larvata (HEK293, hFc) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Others	HEK293

HY-P70769

ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Human	HEK293
ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P700455

ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Human	HEK293

HY-P7441

ACE2 Protein, Human (723a.a, HEK293, His) Angiotensin-Converting Enzyme 2; Ace-Related Carboxypeptidase; Angiotensin-Converting Enzyme Homolog; AceH; Metalloprotease MPROT15; Ace2	Human	HEK293
ACE2 Protein, Human (HEK293, His) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P75876

HA1/Hemagglutinin Protein, H3N8 (ACE81938, HEK293, His)
Influenza A H3N8 (A/equine/Gansu/7/2008) Hemagglutinin Protein (HA1 Subunit) (His)
Virus HEK293
HY-P75877

HA1/Hemagglutinin Protein, H3N8 (ACE81938, sf9, His)
Influenza A H3N8 (A/equine/Gansu/7/2008) Hemagglutinin Protein (HA1 Subunit) (His)
Virus Sf9 insect cells
HY-P75882

HA/Hemagglutinin Protein, H6N1 (529a.a, ACE81692, HEK293, His)
Influenza A H6N1 (A/northern shoveler/California/HKWF115/2007) Hemagglutinin / HA Protein (His)
Virus HEK293
HY-P75023

HA/Hemagglutinin Protein, H6N1 (344a.a, ACE81692, HEK293, His)
Influenza A H6N1 (A/northern shoveler/California/HKWF115/2007) Hemagglutinin Protein (HA1 Subunit) (HEK293, His)
Virus HEK293

Cat. No.	Product Name

HY-A0116S

Trandolaprilate D5

Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].
HY-B0331AS

Enalapril D5 maleate

Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.
HY-B0231AS

Enalaprilat-d5

Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.
HY-108321S

Zofenopril-d5

Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.
HY-B0231BS

Enalaprilat-d5 sodium

Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S

Ramipril-d5

Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.
HY-B0279S1

Ramipril-d3

Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0592S

Trandolapril D5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-B0260S1

Methylprednisolone-d5
Methylprednisolone-d₅ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-B0260S

Methylprednisolone-d3
Methylprednisolone-d₃ is the deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S2

Methylprednisolone-d4
Methylprednisolone-d₄ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-B0260S3

Methylprednisolone-d7
Methylprednisolone-d₇ is deuterium labeled Methylprednisolone. Methylprednisolone is a synthetic corticosteroid with anti-inflammatory and immunomodulating properties. Methylprednisolone improve severe or critical COVID-19 by activating ACE2 and reducing IL-6 levels[3].

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-127026S

Quinaprilat-d5
Quinaprilat-d₅ is a deuterium-labeled Quinaprilat. Quinaprilat is a nonsulfhydryl ACE inhibitor, the active diacid metabolite of Quinapril. Quinaprilat specifically blocks the conversion of angiotensin I to the vasoconstrictor angiotensin II and inhibits bradykinin degradation. Quinaprilat primarily acts as a vasodilator, decreasing total peripheral and renal vascular resistance[1].

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

HY-113478S

Ursodeoxycholic acid-2,2,4,4-d4

Ursodeoxycholic acid-2,2,4,4-d₄ is the deuterium labeled Ursodeoxycholic acid (HY-13771). Ursodeoxycholic acid is a secondary bile acid issued from the transformation of (cheno)deoxycholic acid by intestinal bacteria, acting as a key regulator of the intestinal barrier integrity and essential for lipid metabolism. Ursodeoxycholic acid acts as signaling molecule, exerting its effects by interacting with bile acid activated receptors, including G-protein coupled bile acid receptor 5 (TGR5, GPCR19) and the farnesoid X receptor (FXR). Ursodeoxycholic acid can be used for the research of a variety of hepatic and gastrointestinal diseases. Ursodeoxycholic acid also reduces ACE2 expression and is beneficial for reducing SARS-CoV-2 infection[1][2][3][4][5].

Cat. No.	Product Name	Application	Reactivity

HY-P80003

ACE2 Antibody	WB, ICC, IHC-P, IP	Human, Mouse, Hamster
ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

Ace 3 Inhibitors

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

NaturalProducts

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Natural
Products