Search Result
Results for "
Alpha 7 beta 1 integrin Inhibitors
" in MedChemExpress (MCE) Product Catalog:
9883
Inhibitors & Agonists
920
Biochemical Assay Reagents
679
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-48959
-
|
|
Integrin
|
Metabolic Disease
|
|
α7β1 integrin modulator-1 is a potent α7β1 integrin modulator. α7β1 integrin modulator-1 has the potential for the research of muscular dystrophy [1].
|
-
-
- HY-152073
-
|
|
Fluorescent Dye
|
Others
|
|
BETA-1 is the first twisted intramolecular charge transfer (TICT)-aggregation-induced emission (AIE) integration molecule. BETA-1 emits cyan fluorescence in lipid droplets (LDs) and red fluorescence in mitochondria. BETA-1 can be used for the simultaneous and dual-color imaging of LDs and mitochondria in vivo and in vitro [1].
|
-
-
- HY-139702
-
|
|
Integrin
|
Cancer
|
|
α5β1 integrin agonist-1, acting as α5β1 integrin agonist, is able to selectively deliver 5-FU into tumor cells, successfully leading to cancer cell death.
|
-
-
- HY-P1868
-
|
DGEA peptide
|
Integrin
|
Infection
|
|
α2β1 Integrin Ligand Peptide interacts with the α2β1 integrin receptor on the cell membrane and mediates extracellular signals into cells. It is a potential antagonist of collagen receptors [1].
|
-
-
- HY-P1868A
-
|
DGEA peptide TFA
|
Integrin
|
Others
|
|
α2β1 Integrin Ligand Peptide TFA interacts with the α2β1 integrin receptor on the cell membrane and mediates extracellular signals into cells. It is a potential antagonist of collagen receptors [1].
|
-
-
- HY-134130
-
|
|
Integrin
|
Inflammation/Immunology
|
|
Integrin modulator 1 is a potent and selective α4β1 integrin agonist, with an IC50 of 9.8 nM for RGD-binding α4β1. Integrin modulator 1 increases cell adhesion mediated by α4β1 integrin, with an EC50 of 12.9 nM [1].
|
-
-
- HY-P9911A
-
|
|
Integrin
|
Inflammation/Immunology
|
|
Vedolizumab (anti-α4β7-integrin) is a humanized IgG1 monoclonal antibody that targets the α4β7 integrin for the treatment of ulcerative colitis and Crohn's disease [1] .
|
-
-
- HY-P5189A
-
|
|
Endogenous Metabolite
Cholinesterase (ChE)
|
Others
|
|
His-D-beta-Nal-Ala-Trp-D-Phe-Lys-NH2 TFA, is a growth hormone releasing peptide, as well as a metabolite of GHRP-1. GHRP-1, or Ala-His-D-beta Nal-Ala-Trp-D-Phe-Lys-NH2, has the effect of promoting the release of growth hormone (GH). GHRP-1 increases GH release and increases [Ca2+]i levels in static monolayer cells of rat pituitary gland, but does not affect cAMP levels [1].
|
-
-
- HY-E70044
-
|
|
Glycosyltransferase
|
Metabolic Disease
|
|
beta-1, 3-N-Acetylhexaminyltransferase (LgtA) is a glycosyltransferase, is often used in biochemical studies. beta-1, 3-N-Acetylhexaminyltransferase (LgtA) catalyzes the transfer of N-acetylglucosamine from UDP-GlcNAc to N-acetyllactosamine and lactose [1].
|
-
-
- HY-161730
-
-
-
- HY-P5542
-
-
-
- HY-159179
-
|
|
Integrin
|
Inflammation/Immunology
|
|
α4 integrin receptor antagonist 3 (Compound 11) is an orally active α4integrin receptor antagonist. α4 integrin receptor antagonist 3 can inhibit the adhesion of K562 cells mediated by the interaction between α4β1/VCAM-1 and α4β7/MAdCAM-1, with IC50 values of 130 nM and 2 nM, respectively. α4 integrin receptor antagonist 3 has the potential to be used in the study of dextran sulfate sodium (DSS) colitis mouse model [1].
|
-
-
- HY-CE00040
-
|
(24E)-3Alpha,7Alpha,12Alpha-trihydroxy-5beta-cholest-24-en-26-oyl-coenzyme A
|
Biochemical Assay Reagents
|
Others
|
|
(24E)-3Alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-en-26-oyl-CoA ((24E)-3Alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-en-26-oyl-coenzyme A) is a 3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-en-26-oyl-CoA.
|
-
-
- HY-E70191
-
|
EC:2.4.1.22; B4GALT2
|
Glycosyltransferase
|
Others
|
|
β-1,4-Galactosyltransferase 2 catal exclusive specificity for the donor substrate UDP-galactose and all transfer galactosein a beta1,4 linkage [1].
|
-
-
- HY-CE00074
-
|
(25S)-THCA-Coenzyme A
|
Biochemical Assay Reagents
|
Others
|
|
(25S)-3Alpha,7alpha,12alpha-trihydroxy-5beta-cholestanoyl-CoA ((25S)-THCA-Coenzyme A) is a 3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA.
|
-
-
- HY-N1064
-
|
|
nAChR
|
Neurological Disease
|
|
Xanthoplanine, isolated from theroot of Xylopia parviflora, fully inhibits the EC50 ACh responses of both alpha7 and alpha4beta2 nACh receptors with estimated IC50 values of 9 μM (alpha7) and 5 μM (alpha4beta2) [1].
|
-
-
- HY-CE00053
-
|
(24R,25R)-3Alpha,7Alpha,12Alpha,24-Tetrahydroxy-5beta-cholestanoyl-coenzyme A
|
Biochemical Assay Reagents
|
Others
|
|
(24R,25R)-3Alpha,7alpha,12alpha,24-Tetrahydroxy-5beta-cholestan-26-oyl-CoA ((24R,25R)-3Alpha,7alpha,12alpha,24-Tetrahydroxy-5beta-cholestanoyl-coenzyme A) is an acyl-CoA.
|
-
-
- HY-CE00056
-
|
(24R,25R)-3Alpha,7Alpha,24-trihydroxy-5beta-cholestan-26-oyl-coenzyme A
|
Biochemical Assay Reagents
|
Others
|
|
(24R,25R)-3Alpha,7alpha,24-trihydroxy-5beta-cholestan-26-oyl-CoA ((24R,25R)-3Alpha,7alpha,24-trihydroxy-5beta-cholestan-26-oyl-coenzyme A) is a steroidal acyl-CoA.
|
-
-
- HY-113097
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
3α,7α-Dihydroxycoprostanic acid is an endogenous metabolite. 3α,7α-Dihydroxycoprostanic acid, a bile acid, is the precursor to chenodeoxycholic acid [1].
|
-
-
- HY-CE00046
-
-
-
- HY-108790
-
|
Peginterferon β-1a
|
Apoptosis
|
Neurological Disease
Cancer
|
|
Peginterferon beta-1a (Peginterferon β-1a) is the first pegylated interferon beta-1a molecule. Peginterferon beta-1a induces cancer cells apoptosis and shows anti-tumor activities in nude mice models. Peginterferon beta-1a can be used for the research of cancer and multiple sclerosis (RMS) [1].
|
-
-
- HY-164293
-
-
-
- HY-N9262
-
|
|
Others
|
Others
|
|
2α,7β,13α-Triacetoxy-5α-cinnamoyloxy-9β-hydroxy-2(3→20)abeotaxa-4(20),11-dien-10-one is a Diterpenoids product that can be isolated from the herbs of Taxus yunnanensis [1].
|
-
-
- HY-113097S1
-
-
-
- HY-129453
-
|
|
Integrin
|
Inflammation/Immunology
|
|
BOP sodium is a potent and selective dual α9β1/α4β1 integrin inhibitor with Kd values in the picomolar range. BOP sodium shows the rapid and preferential mobilization of hematopoietic stem cell (HSC) and progenitors. BOP sodium has little inhibitory activity on α4β7, α1β1, α2β1, and α5β1, αIIBβ3 integrins [1] .
|
-
-
- HY-113097S
-
|
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Others
|
|
3α,7α-Dihydroxycoprostanic acid-d3 is the deuterium labeled 3α,7α-Dihydroxycoprostanic acid (HY-113097) [1]. 3α,7α-Dihydroxycoprostanic acid is an endogenous metabolite. 3α,7α-Dihydroxycoprostanic acid, a bile acid, is the precursor to chenodeoxycholic acid .
|
-
-
- HY-156521
-
|
|
Integrin
|
Others
|
|
αvβ1 integrin-IN-2 (compound 32) is a potent inhibitor of integrins ανβ1 and α5β1 with IC50s of 0.9 nM，and 33 nM，respectively. αvβ1 integrin-IN-2 also inhibits other integrins with ，，IC50s of 380 nM (ανβ3)，280 nM (ανβ5)，230 nM (ανβ6)，87 nM (ανβ8)，respectively，in SPRA assay [1].
|
-
-
- HY-P9911
-
|
Anti-Human lymphocyte α4β7 integrin, Humanized Antibody
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Vedolizumab is a humanized IgG1 monoclonal antibody that targets the α4β7 integrin for the treatment of ulcerative colitis and Crohn's disease.
|
-
-
- HY-136214
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
R-BC154 acetate is a selective fluorescent α9β1 integrin antagonist. R-BC154 acetate acts as a useful high affinity, activation dependent integrin probe, which can be used to investigate α9β1 and α4β1 integrin binding activity [1].
|
-
-
- HY-123802
-
|
|
Integrin
|
Cancer
|
|
BIO7662 is a specific α4β1 antagonist. BIO7662 can be used to study α4β1 integrin-ligand interactions [1] .
|
-
-
- HY-150124A
-
|
|
Integrin
Apoptosis
|
Cancer
|
|
K34c hydrochloride is a potent and selective α5β1 integrin antagonist. By inhibiting α5β1 integrin, K34c hydrochloride reduces chemotherapy-induced premature senescence and promotes apoptosis. K34c hydrochloride can be used in glioblastoma research [1].
|
-
-
- HY-150124
-
|
|
Integrin
Apoptosis
|
Cancer
|
|
K34c is a potent and selective α5β1 integrin antagonist. By inhibiting α5β1 integrin, K34c reduces chemotherapy-induced premature senescence and promotes apoptosis. K34c can be used in glioblastoma research [1].
|
-
-
- HY-129434A
-
|
|
Bacterial
|
Infection
|
|
4aα,7α,7aα-Nepetalactone exhibits antibacterial activity, and inhibits Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Salmonella typhi and Enterococcus faecalis.
|
-
-
- HY-146066
-
|
|
nAChR
JAK
STAT
NO Synthase
|
Inflammation/Immunology
|
|
α7 nAchR-JAK2-STAT3 agonist 1 is a potent α7 nAchR-JAK2-STAT3 agonist, with an IC50 value of 0.32 μM for nitric oxide (NO). α7 nAchR-JAK2-STAT3 agonist 1 effectively suppresses the expression of iNOS, IL-1β, and IL-6 in murine RAW264.7 macrophages. α7 nAchR-JAK2-STAT3 agonist 1 can inhibit LPS-induced NO release, NF-κB activation and cytokine production. α7 nAchR-JAK2-STAT3 can be used for researching sepsis [1].
|
-
-
- HY-E70060
-
|
EB4GALT1 (LgtE)
|
Others
|
Others
|
|
beta-1,4-Galactosyltransferase (LgtE) (EB4GALT1 (LgtE)) catalyzes the reaction involving UDP-galactose and N-acetylglucosamine for the production of galactose beta-1,4-N-acetylglucosamine [1].
|
-
-
- HY-100445
-
-
-
- HY-14564A
-
|
DMXB-A; DMBX-anabaseine
|
nAChR
5-HT Receptor
|
Inflammation/Immunology
|
|
GTS-21 dihydrochloride is a selective alpha7 nicotinic acetylcholine receptor (α7-nAChR) agonist with anti inflammatory and cognition enhancing activities. GTS-21 dihydrochloride is also a α4β2 (Ki=20 nM for humanα4β2) and 5-HT3A receptor (IC50=3.1 μM) antagonist [1] .
|
-
-
- HY-157129
-
|
|
AMPK
|
Cardiovascular Disease
|
|
AMPK-α1β1γ1 activator 1 (M1) is an acyl glucuronide metabolite of Indole-3-carboxylic Acid-based AMPK activator. AMPK-α1β1γ1 activator 1 can selectively activated human β1 isoforms with an EC50 value of 38.1nM. AMPK-α1β1γ1 activator 1 can direct binding with human AMPK α1β1γ1 isoform. AMPK-α1β1γ1 activator 1 can be used for the research of diabetic nephropathy [1].
|
-
-
- HY-A0275
-
-
-
- HY-146066A
-
|
|
nAChR
JAK
STAT
NO Synthase
|
Others
|
|
(R)-α7 nAchR-JAK2-STAT3 agonist 1 is the R-enantiomer of α7 nAchR-JAK2-STAT3 agonist 1 (HY-146066). α7 nAchR-JAK2-STAT3 agonist 1 is a potent α7 nAchR-JAK2-STAT3 agonist, with an IC50 value of 0.32 μM for nitric oxide (NO). α7 nAchR-JAK2-STAT3 agonist 1 effectively suppresses the expression of iNOS, IL-1β, and IL-6 in murine RAW264.7 macrophages. α7 nAchR-JAK2-STAT3 agonist 1 can inhibit LPS-induced NO release, NF-κB activation and cytokine production. α7 nAchR-JAK2-STAT3 can be used for researching sepsis [1].
|
-
-
- HY-107666
-
|
|
nAChR
|
Neurological Disease
Inflammation/Immunology
|
|
PHA 568487 a selective agonist of alpha-7 nicotinic acetylcholine receptor (α-7 nAchR) [1] .PHA 568487 reduces neuroinflammation and oxidative stress . PHA-568487 has rapid brain penetration .
|
-
-
- HY-P10045
-
|
|
Integrin
|
Cardiovascular Disease
|
|
Integrin signaling inhibitor, mP13 is an inhibitor of integrin signaling. Integrin signaling inhibitor, mP13 inhibits inside-out and outside-in signaling, including fibrinogen binding, platelet adhesion, and clot retraction [1].
|
-
-
- HY-100445A
-
-
-
- HY-160529
-
|
|
nAChR
|
Neurological Disease
|
|
α7 nAChR Modulator-2 (Compound 7b) is a α7 nAChR positive allosteric modulator (PAM) with an EC50 of 2.1 μM. α7 nAChR Modulator-2 can be used for the research of cognitive disorders [1].
|
-
-
- HY-15770
-
|
|
Integrin
|
Inflammation/Immunology
|
|
TR-14035 is a orally active dual α4β7/α4β1 integrin antagonist, with IC50 s of 7 nM and 87 nM for α4β7 and α4β1, respectively. TR-14035 can be used for the research of inflammation and autoimmune diseases [1] .
|
-
-
- HY-157958
-
|
|
nAChR
|
Neurological Disease
|
|
α7 nAChR modulator-3 (Compound 6p) is a α7 nAChR positive allosteric Modulator with a IC50 value of 1.3 μM. α7 nAChR Modulator-3 can be used to inhibit auditory gating defects in a mouse schizophrenic model [1].
|
-
-
- HY-W145539
-
|
GlcNAc beta(1-3)[GlcNAc beta(1-6)]GalNAc-Alpha-Thr
|
Biochemical Assay Reagents
|
Others
|
|
GlcNAcβ(1-3)[GlcNAcβ(1-6)]GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![GlcNAcβ(1-3)[GlcNAcβ(1-6)]GalNAc-α-Thr](//file.medchemexpress.com/product_pic/hy-w145539.gif)
-
- HY-145363
-
|
|
Integrin
|
Cancer
|
|
Sulodexide (pIC50 = 8.2 nM) selectively binds to the αvβ5 integrin in K562 and A549 cell lines and exhibits a significant inhibitory effect [1].
|
-
-
- HY-19490
-
|
AQW-051
|
nAChR
|
Neurological Disease
|
|
VQW-765 (AQW-051) is a selective and orally active alpha-7 nicotinic acetylcholine receptor (α7-nAChR) agonist with a pKD value of 7.56 to recombinantly expressed human α7-nAChR. VQW-765 shows anxiolytic-like effect in vivo. VQW-765 can be used for the research of anxiety disorder and acute performance anxiety [1].
|
-
-
- HY-14564
-
|
|
nAChR
5-HT Receptor
|
Inflammation/Immunology
|
|
GTS-21 dihydrochloride is a selective alpha7 nicotinic acetylcholine receptor (α7-nAChR) agonist with anti‑inflammatory and cognition‑enhancing activities. GTS-21 dihydrochloride is also a α4β2 (Ki=20 nM for humanα4β2) and 5-HT3A receptor (IC50=3.1 μM) antagonist. GTS-21 can be used in age-associated memory impairment (AAMI) and Alzheimer's disease research [1] .
|
-
- HY-139137
-
|
AGGC
|
DNA Methyltransferase
Integrin
|
Cancer
|
|
N-Acetyl-S-geranylgeranyl-L-cysteine is a Methyltransferase inhibitor. N-Acetyl-S-geranylgeranyl-L-cysteine inhibits beta 2 integrin-induced actin polymerization with an IC50 of 45 nM [1].
|
-
- HY-148325
-
|
|
nAChR
|
Neurological Disease
|
|
α7 Nicotinic receptor agonist-1 (Preparation 5) is an α7 nAChR agonist. α7 Nicotinic receptor agonist-1 can be used in studies of psychiatric disorders (such as schizophrenia, manic or hypomanic depression and anxiety disorders) and intellectual disorders (such as alzheimer's disease, learning deficits, cognitive deficits, attention deficits, memory loss, lewy body dementia and attention deficit hyperactivity disorder) [1].
|
-
- HY-P1654
-
|
|
Integrin
|
Cancer
|
|
A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from the foot-and-mouth disease virus. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors [1].
|
-
- HY-P9984
-
|
rhuMAb beta7; RG7413; PRO145223
|
Integrin
|
Cancer
|
|
Etrolizumab (rhuMAb Beta7) is a gut-selective, anti-β7 integrin monoclonal antibody. Etrolizumab is specific targeting of the β7 subunit of α4β7 and αEβ7 integrins with Ki values of 18 nM and 1800 pM for Human α4β7 and Human αEβ7-293, respectively. Etrolizumab can be used in research of inflammatory bowel disease (IBD) [1] .
|
-
- HY-W145655
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gal-β1,3-GalNAc-α1-OBn is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-W145586
-
|
GlcNAc beta(1-3)GalNAc-Alpha-Thr
|
Biochemical Assay Reagents
|
Others
|
|
GlcNAcβ(1-3)GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-P990207
-
|
|
Integrin
|
Others
|
|
Anti-Mouse/Human Integrin β7 Antibody (FIB504) is a rat-derived IgG2a, κ type antibody inhibitor, targeting to mouse/human Integrin β7.
|
-
- HY-12149
-
|
|
nAChR
|
Neurological Disease
|
|
A-867744 is a highly potent and selective type II positive allosteric modulator (PAM) of the alpha7 nicotinic acetylcholine receptors (nAChR) with an EC50 of 1.0 μM [1].
|
-
- HY-111413
-
|
|
Integrin
|
Cancer
|
|
c(phg-isoDGR-(NMe)k) is a selective and potent α5β1-integrin ligand with an IC50 of 2.9 nM [1].
|
-
- HY-130119
-
|
|
Integrin
|
Cancer
|
|
Integrin-IN-2 (compound 39) is an orally bioavailable pan αv integrin inhibitor. Integrin-IN-2 can increases the αvβ6, αvβ3, αvβ5 and αvβ8 binding affinities with pIC50 values of 7.8, 8.4, 8.4 and 7.4, respectively [1].
|
-
- HY-B1337
-
|
|
nAChR
Endogenous Metabolite
|
Cancer
|
|
Choline chloride is an essential nutrient that activates alpha7 nicotinic receptors and has analgesic and anti-inflammatory activity. Glycerophosphoinositol choline can affect diseases such as liver disease, atherosclerosis and neurological disorders [1] .
|
-
- HY-111413A
-
|
|
Integrin
|
Cancer
|
|
c(phg-isoDGR-(NMe)k) TFA is a selective and potent α5β1-integrin ligand with an IC50 of 2.9 nM [1].
|
-
- HY-B1337B
-
-
- HY-E70179
-
|
EC 2.4.1.149; B4GAT1; β3GNTI
|
Glucosylceramide Synthase (GCS)
|
Others
|
|
beta-1,4-Glucuronyltransferase 1 is a glucosyltransferase. beta-1,4-Glucuronyltransferase 1 transfers glucuronic acid towards both α and β anomers of xylose [1].
|
-
- HY-108831A
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Natalizumab (Solution) is a recombinant, humanized IgG4 monoclonal antibody, binds to α4β1-integrin and blocks its interaction with vascular cell adhesion molecule-1 (VCAM-1). Natalizumab can be used for the treatment of relapsing remitting multiple sclerosis and Crohn's disease. Natalizumab is also the first targeted therapy which blocks an essential mechanism for lymphocyte entry to the CNS and thus prevents acute demyelinating relapses [1].
|
-
- HY-P2267
-
LDV
1 Publications Verification
|
Integrin
|
Others
|
|
LDV is a non-fluorescent analog of LDV-FITC. LDV is a α4β1 integrin (VLA-4) ligand, and binds α4β1 integrin in leukemia cells [1] .
|
-
- HY-101327
-
|
Corwin; ICI 118587
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Xamoterol is a selective and potent agonist of beta1-adrenergic receptor. Xamoterol has the potential for the research of arrhythmogenesis. Xamoterol has the potential for the investigating the relationship between β1-adrenergic stimulation and IKr [1].
|
-
- HY-B0381
-
-
- HY-B0381A
-
-
- HY-P3522A
-
|
|
Integrin
|
Cancer
|
|
REDV TFA is the minimal active sequence within the CS5 site of the alternatively spliced type III connecting segment (IIICS) region of fibronectin. REDV TFA can mediate adhesion to the IIICS region of plasma fibronectin by binding the integrin alpha 4 beta 1(α4β1). REDV TFA can be used for the research of cell adhesion [1].
|
-
- HY-W145622
-
|
Gal beta(1-3)[Neu5Ac Alpha(2-6)]GlcNAc-beta-pNP
|
Biochemical Assay Reagents
|
Others
|
|
Galβ(1-3)[Neu5Acα(2-6)]GlcNAc-β-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Galβ(1-3)[Neu5Acα(2-6)]GlcNAc-β-pNP](//file.medchemexpress.com/product_pic/hy-w145622.gif)
- HY-18668
-
|
|
Integrin
|
Cancer
|
|
Integrin antagonist 27 is a small molecule integrin αvβ3 antagonist with binding affinity of 18 nM, as s novel anticancer agent.
|
-
- HY-101327A
-
|
Corwin hemifumarate; ICI 118587 hemifumarate
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Xamoterol hemifumarate is a selective and potent agonist of beta1-adrenergic receptor. Xamoterol hemifumarate has the potential for the research of arrhythmogenesis. Xamoterol hemifumarate has the potential for the investigating the relationship between β1-adrenergic stimulation and IKr [1].
|
-
- HY-107588
-
TC-I 15
1 Publications Verification
|
Integrin
|
Cardiovascular Disease
|
|
TC-I 15 (TC-I-15) is a type of allosteric collagen-binding integrin α2β1 inhibitor, and it also inhibits α1β1 and α11β1. TC-I 15 inhibits platelet adhesion to collagen and thrombus deposition. TC-I 15 prevents the formation of a pre-metastatic microenvironment by inhibiting the uptake of cancer-associated fibroblast (CAF) extracellular vesicles (EVs) by lung fibroblasts, which reduces the metastasis of salivary gland adenocystic carcinoma (SACC) to the lungs in mouse models, [1] .
|
-
- HY-156905
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
6-Azido-N-acetylgalactosamine-UDP (compound 5) is an active sugar donor in the beta-1, 3-N-Acetylhexaminyltransferase (LgtA)-catalyzed glycosylation of lactose [1].
|
-
- HY-124290A
-
|
AJM300 hydrochloride
|
Integrin
|
Inflammation/Immunology
|
Carotegrast methyl (AJM300) hydrochloride is an orally active and selective α4 integrin antagonist. HCA2969, an active metabolite of Carotegrast methyl hydrochloride, is a specific and dual α4β1/α4β7 integrin antagonist. Carotegrast methyl hydrochloride prevents the development of colitis in mice [1].
|
-
- HY-124290
-
|
AJM300
|
Integrin
|
Inflammation/Immunology
|
Carotegrast methyl (AJM300) is an orally active and selective α4 integrin antagonist. HCA2969, an active metabolite of Carotegrast methyl, is a specific and dual α4β1/α4β7 integrin antagonist. Carotegrast methyl prevents the development of colitis in mice [1].
|
-
- HY-118161
-
|
beta-1-Adamantylaspartic acid
|
Biochemical Assay Reagents
|
Others
|
|
1-Adamantylaspartate is a newly developed β-β-1-imidopropionic acid used to synthesize the C-terminal octapeptide of the β subunit of human chorionic gonadotropin (hCG) and the hexadecapeptide of the α subunit of the insulin receptor (30-55) by conventional solution methods and solid phase methods, aiming to inhibit the formation of asparagine during the synthesis of asparagyl peptides. Studies have shown that β-β-1-imidopropionic acid is an effective protector of the β-carboxyl function of aspartic acid residues.
|
-
- HY-138542
-
|
|
Integrin
|
Inflammation/Immunology
|
|
RO0270608, the active metabolite of R411, is a dual alpha4beta1-alpha4beta7 (α4β1/α4β7) integrin antagonist. Antiinflammatory activity [1] .
|
-
- HY-P3522
-
|
|
Integrin
|
Cardiovascular Disease
|
|
REDV is the minimal active sequence within the CS5 site of the alternatively spliced type III connecting segment (IIICS) region of fibronectin. REDV can mediate adhesion to the IIICS region of plasma fibronectin by binding the integrin alpha 4 beta 1(α4β1). REDV can be used for the research of cell adhesion. REDV is used to study the effects of gene vectors containing REDV on cells [1] .
|
-
- HY-169870
-
|
(+)-Mecamylamine; TC-5214
|
nAChR
|
Neurological Disease
|
|
Dexmecamylamine ((+)-Mecamylamine) is the antagonist for nicotinic acetylcholine receptor (nAChR), that antagonises the α3β4/α4β2/α7/α1β1γδ receptor with IC50 of micromolare levels. Dexmecamylamine exhibits anxiolytic and antidepressant-like activities [1].
|
-
- HY-N5143
-
|
|
Others
|
Others
|
|
(2R)-3α,7,4'-Trihydroxy-5-methoxy-8-prenylflavanone is isolated from the roots of Sophora flavescens [1].
|
-
- HY-P2869A
-
|
|
Others
|
Metabolic Disease
|
|
β1-3 Galactosidase is a highly specific exoglycosidase that catalyzes the hydrolysis of terminal β1-3-linked galactose from oligosaccharides and glycoprotein substrates, at a much lower rate, β1-6 linked galactose residues from oligosaccharides [1].
|
-
- HY-N14900
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Milbemycin β1 is a macrolide antibiotic. Milbemycin β1 has insecticidal effects on agricultural harmful insects, pans, larvae, etc [1].
|
-
- HY-N1876
-
|
|
Others
|
Neurological Disease
|
|
Aromadendrane-4β,10α-diol is a sesquiterpene alcohol. Aromadendrane-4β,10α-diol significantly ameliorates the Aβ1-42 peptide-induced memory impairment. Aromadendrane-4β,10α-diol can be used for Alzheimer's disease (AD) research [1].
|
-
- HY-W145521
-
|
β Glucan
|
Biochemical Assay Reagents
IKK
NO Synthase
Bacterial
|
Infection
Inflammation/Immunology
Cancer
|
|
β-1,3-Glucan (β Glucan) is an orally active polysaccharide composed of glucose polymers. β-1,3-Glucan increase the activity of IKKβ kinase, enhances the production of nitric oxide. β-1,3-Glucan improves resistance to Vibrio harveyi infection. β-1,3-Glucan enhances immune response, promotes blood pressure recovery, reduces lung, kidney and liver damage, inhibits the growth of syngeneic tumors [1] [7] .
|
-
- HY-W145556
-
|
Gal beta(1-3)GlcNAc beta(1-3)Gal beta(1-4)Glc-beta-pNP
|
Biochemical Assay Reagents
|
Others
|
|
Galβ(1-3)GlcNAcβ(1-3)Galβ(1-4)Glc-β-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-126402
-
|
|
Integrin
|
Cancer
|
|
Arg-Gly-Asp (RGD) is a synthetic peptide corresponding to the cell adhesion sequence for the integrins αVβ1, αVβ3, αVβ5, αVβ6, αVβ8, α8β1, and α5β1. It is a component of radioligands and peptidomimetics that have been used in the study of integrin expression and activity in vivo.
|
-
- HY-P2869C
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β1-3,4 Galactosidase is a highly specific exoglycosidase that catalyzes the hydrolysis of terminal β1-3 and β1-4 linked galactose residues from oligosaccharides [1].
|
-
- HY-B1337R
-
|
|
nAChR
Endogenous Metabolite
|
Cancer
|
|
Choline (chloride) (Standard) is the analytical standard of Choline (chloride). This product is intended for research and analytical applications. Choline chloride is an essential nutrient that activates alpha7 nicotinic receptors and has analgesic and anti-inflammatory activity. Glycerophosphoinositol choline can affect diseases such as liver disease, atherosclerosis and neurological disorders [1] .
|
-
- HY-168385
-
|
|
Drug Derivative
|
Others
|
|
1,3-Dimyristoyl-2-oleoylglycerol is a crystal structure of the beta1 polymorphs of mono-unsaturated triacylglycerols [1].
|
-
- HY-P2869E
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β1-3,4,6 Galactosidase is a broad specificity exoglycosidase that catalyzes the hydrolysis of terminal, non-reducing β1-3 β1-4 and β1-6 linked galactose residues from oligosaccharides, with β1-6 linked galactose residues at a slower rate [1].
|
-
- HY-153807
-
-
- HY-75385
-
|
CDP323; UCB1184197
|
Integrin
|
Inflammation/Immunology
|
|
Zaurategrast ethyl ester (CDP323), the ethyl ester proagent of CT7758 [1], is a α4β1/α4β7 integrin antagonist used for the treatment of inflammatory and autoimmune disorders .
|
-
- HY-B1337S5
-
|
|
nAChR
Endogenous Metabolite
|
Cancer
|
|
Choline- 13C2 (chloride) is the 13C labeled Choline chloride[1]. Choline chloride is an essential nutrient that activates alpha7 nicotinic receptors and has analgesic and anti-inflammatory activity. Glycerophosphoinositol choline can affect diseases such as liver disease, atherosclerosis and neurological disorders[2][3].
|
-
- HY-P1264
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM [1] .
|
-
- HY-B0381S
-
-
- HY-B0381AS
-
|
SL75212-d7
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Betaxolol-d7 (hydrochloride) is the deuterium labeled Betaxolol hydrochloride. Betaxolol Hydrochloride is a selective beta1 adrenergic receptor blocker that can be used for the research of hypertension and glaucoma.
|
-
- HY-P2294
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction [1] .
|
-
- HY-75385A
-
|
CDP323 sulfate; UCB1184197 sulfate
|
Integrin
|
Inflammation/Immunology
|
|
Zaurategrast ethyl ester sulfate (CDP323 sulfate), the ethyl ester proagent of CT7758 [1], is a α4β1/α4β7 integrin antagonist used for the treatment of inflammatory and autoimmune disorders .
|
-
- HY-16141
-
|
EMD 121974
|
Integrin
Autophagy
Apoptosis
STAT
PD-1/PD-L1
|
Cancer
|
|
Cilengitide (EMD 121974) is a potent integrins antagonist with IC50s of 0.61 nM (ανβ3), 8.4 nM (ανβ5) and 14.9 nM (α5β1), respectively. Cilengitide inhibits the binding of ανβ3 and ανβ5 to Vitronectin with IC50s of 4 nM and 79 nM, respectively. Cilengitide inhibits TGF-β/Smad signaling, mediates PD-L1 expression. Cilengitide also induces apoptosis, shows antiangiogenic effect in the research against glioblastoma and other cancers [1] .
|
-
- HY-137561
-
|
PLN-74809
|
Integrin
|
Inflammation/Immunology
|
|
Bexotegrast (PLN-74809) is an orally active, potent dual αvβ6/αvβ1 integrin inhibitor with Kd of 5.7 nM and 3.4 nM, respectively. Bexotegrast inhibits αvβ6- and αvβ1-induced TGF-β activation with IC50 values of 29.8 nM and 19.2 nM, respectively. Bexotegrast has antifibrogenic effects and block multiple avenues of TGF-β activation in the fibrotic lung [1] .
|
-
- HY-169330
-
|
|
Drug Metabolite
|
Neurological Disease
Metabolic Disease
|
|
3β,5α,6β-Trihydroxycholanic acid is a metabolite of 3β,5α,6β-Trihydroxycholestane (HY-W010934). 3β,5α,6β-Trihydroxycholanic acid can be used in research related to neurodegenerative diseases associated with lysosomal dysfunction [1].
|
-
- HY-N10750
-
|
|
Others
|
Others
|
|
1α, 2α-Diacetoxy-8β-isobutanoyloxy-9α-benzoyloxy-15-β-(β-furancarbonyloxy)-4β, 6β-dihydroxy-β-dihydroagarofuran (compound 7) is an eudesmane-type sesquiterpenoid that can be founfd in the the root bark of Pseudolarix kaempferi [1].
|
-
- HY-B0381R
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Betaxolol (Standard) is the analytical standard of Betaxolol. This product is intended for research and analytical applications. Betaxolol is a selective beta1 adrenergic receptor blocker that can be used for the research of hypertension and glaucoma.
|
-
- HY-B0381AR
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Betaxolol (hydrochloride) (Standard) is the analytical standard of Betaxolol (hydrochloride). This product is intended for research and analytical applications. Betaxolol Hydrochloride is a selective beta1 adrenergic receptor blocker that can be used for the research of hypertension and glaucoma.
|
-
- HY-P2294A
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
pm26TGF-β1 TFA peptide is a peptide that mimics a portion of the human TGF-β1 molecule. pm26TGF-β1 peptide TFA shows high affinity for the TGF-β1 receptor. pm26TGF-β1 peptide TFA displays potent anti-inflammatory properties and does not exhibit neutrophils’ chemoattraction [1] .
|
-
- HY-P2869D
-
|
|
Others
|
Metabolic Disease
|
|
β1-3,6 Galactosidase, Xanthomonas manihotis is a highly specific exoglycosidase that catalyzes the hydrolysis of non-reducing terminal β1-3 and β1-6 linked galactose from complex carbohydrates and glycoproteins [1].
|
-
- HY-168130
-
|
|
TNF Receptor
Interleukin Related
|
Cardiovascular Disease
|
|
TNF-α/IL-1β-IN-1 (compund 11a) is an anti-inflammatory agent that reduces the expression of TNF-α and IL-1β, inhibits oxidative stress and cardiomyocyte apoptosis, has good activity against septic myocardial injury, and improves myocardial blood supply in vivo [1].
|
-
- HY-P5038
-
|
c(GRGDSP)
|
Integrin
|
Cancer
|
|
Cyclo(Gly-Arg-Gly-Asp-Ser-Pro) (c(GRGDSP)) is an RGD-containing inhibitory peptide. Cyclo(Gly-Arg-Gly-Asp-Ser-Pro) is a synthetic α5β1 integrin ligand that competitively inhibits the binding of invasin (Inv) to α5β1 integrin expressed on Caco-2 cells [1].
|
-
- HY-E70046
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
beta-1,4-Galactosyltransferase (LgtB) (EC 2.4.1.90) (B4GALT1 (LgtB)) is often used in biochemical studies. beta-1,4-Galactosyltransferase (LgtB) catalyzes the reaction involving UDP-galactose and N-acetylglucosamine for the production of galactose beta-1,4-N-acetylglucosamine [1].
|
-
- HY-P2869B
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β1-4 Galactosidase, E. coli is a highly specific exoglycosidase that catalyzes the hydrolysis of terminal, non-reducing β1-4 linked galactose residues from oligosaccharides [1].
|
-
- HY-E70297
-
|
MGAT4A
|
Endogenous Metabolite
|
Cancer
|
|
N-Acetylglucosaminyltransferase IVa (MGAT4A) is a glycosyltransferase that can enhance the migration, invasion, and adhesion abilities of cancer cells, and increase β1,4GlcNAc branched glycans on integrin β1 (ITGB1), a tumor-associated glycoprotein closely related to cell motility [1].
|
-
- HY-137561A
-
|
PLN-74809 hydrochloride
|
Integrin
|
Inflammation/Immunology
|
|
Bexotegrast hydrochloride (PLN-74809 hydrochloride) is a small molecule dual selective inhibitor with activity targeting αVβ1 and αVβ6. Bexotegrast hydrochloride is used for idiopathic pulmonary fibrosis (IPF) and primary sclerosing cholangitis (PSC). Bexotegrast hydrochloride inhibits the activation of TGF-β1 by blocking the function of these integrins, thereby preventing the growth of fibrous tissue in the lungs and bile ducts [1].
|
-
- HY-W587978
-
-
- HY-14951
-
|
SB 683699
|
Integrin
|
Neurological Disease
|
|
Firategrast (SB 683699) is an orally active and specific α4β1/α4β7 integrin antagonist. Firategrast reduces trafficking of lymphocytes into the central nervous system (CNS) and decreases multiple sclerosis (MS) activity [1] .
|
-
- HY-N8279
-
|
Endo-β-1,3-1,4-glucanase
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β-1,3-1,4-Glucanase catalyzes the hydrolysis ofβ-glucan into low molecular weight glucose polymers, thus reducing the hydrophilicity and viscosity of chyme and eliminating the anti-nutritional negative effect. β-1,3-1,4-glucanase can improve feed intake, enhance animal production, regulate cecal microbiota and increase feed conversion ratio [1].
|
-
- HY-164768
-
|
|
Integrin
|
Cancer
|
|
LT25 (compound 17) is a agonist of α5β1 integrin with EC50 value of 9.9 nM [1].
|
-
- HY-B1204S
-
-
- HY-123712
-
-
- HY-W145663
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gal-β1,3-GalNAc-β-OMe is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-N15362
-
|
|
Endogenous Metabolite
|
Endocrinology
|
|
5α-Pregnane-3β,17α,20α-triol is an endogenous steroid compound. 5α-Pregnane-3β,17α,20α-triol is the metabolite of Pregnenolone (HY-B0151) or Progesterone (HY-N0437). 5α-Pregnane-3β,17α,20α-triol is promising for research of the endocrine function of the placenta and the mechanisms related to steroid hormone metabolism during pregnancy [1].
|
-
- HY-P99184
-
|
|
Integrin
|
Infection
Inflammation/Immunology
Cancer
|
|
Abrilumab is a fully human monoclonal antibody directed against α4β7. Abrilumab selectively binds the α4β7 integrin heterodimer. Abrilumab can be used for the research of inflammatory bowel disease (IBD) [1].
|
-
- HY-E70054
-
|
CgtB
|
Others
|
Others
|
|
beta-1,3-Galactosyltransferase (WbgO) (CgtB) acts on N-glycan substrates. beta-1,3-Galactosyltransferase (WbgO) catalyzes the formation of type 1 chains on oligosaccharide, glycopeptide, and glycoprotein substrates, including itself [1].
|
-
- HY-P2532
-
|
|
Integrin
|
Others
|
|
Integrin Binding Peptide is derived by fibronectin. Integrin Binding Peptide can be used for PEG hydrogel preparation [1] .
|
-
- HY-P4288
-
|
|
Amino Acid Derivatives
|
Others
|
|
Beta-Asp-His is a dipeptide containing aspartic acid and histidine, which can form amino acid derivatives by complexing with Zinc [1].
|
-
- HY-W010934S
-
-
- HY-101274A
-
-
- HY-P1188
-
|
|
Integrin
|
Cancer
|
|
LDV-FITC, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC can be used to detect α4β1 integrin affinity [1] .
|
-
- HY-170663
-
|
|
Glycosyltransferase
|
Infection
|
|
β-1,4-GALT1-IN-1 (Compound 6) is a β-1,4-GALT1 inhibitor, with an IC50 value of 6.2 μM. β-1,4-GALT1-IN-1 can be used in many pathology investigations such as cancer, autoimmune diseases and viral infections [1].
|
-
- HY-N0988
-
|
|
Others
|
Cancer
|
|
1β,4β,7α-Trihydroxyeudesmane (compound 4) is a nature product that could be isolated from the rhizomes of Homalomena occulta. 1β,4β,7α-Trihydroxyeudesmane has antiproliferative active. 1β,4β,7α-Trihydroxyeudesmane can be used in research of cancer [1].
|
-
- HY-N10639
-
|
|
Others
|
Others
|
|
(1α,2α,6β,8α,9α)-1,2,6,8,12-Pentakis(acetyloxy)-9-(benzoyloxy)dihydro-β-agarofuran is a sesquiterpene polyol ester. (1α,2α,6β,8α,9α)-1,2,6,8,12-Pentakis(acetyloxy)-9-(benzoyloxy)dihydro-β-agarofuran can be used for the research of various biochemical [1].
|
-
- HY-105058A
-
|
14α/β-RU 24722
|
Others
|
Neurological Disease
|
|
14α/β-Vindeburnol (14α/β-RU 24722) a synthetic molecule derived from the eburnamine-vincamine alkaloid group, has many neuropsychopharmacological and antidepressant-like effects [1].
|
-
- HY-114573
-
|
|
IKK
Interleukin Related
TNF Receptor
RIP kinase
|
Others
|
|
TNF-α-IN-19 is an inhibitor of TNFα that can block the interaction between TNFαRI, TRADD, and RIP1, the EC50 values for TNFα, IL-1β, and IL-1β/TNFα are 2.451, 3.792 and 1.54 μM, respectively. TNF-α-IN-19 only inhibits the degradation of IκBα when cells are stimulated by TNFα and not by IL-1β .
|
-
- HY-163536
-
|
|
TGF-beta/Smad
|
Inflammation/Immunology
|
|
TGF-β1/Smad3-IN-1 (Compound 5aa) is an inhibitor of the TGF-β1/Smad3 signaling pathway(IC50=1.07 μM). TGF-β1/Smad3-IN-1 possesses antifibrotic activity and oral potency [1].
|
-
- HY-P99333
-
|
M200; Eos 200-4
|
Integrin
|
Cardiovascular Disease
Cancer
|
|
Volociximab (M200) is a chimeric human/murine IgG4 antibody IIA1 targeting integrin α5β1 (EC50=0.2 nM). Integrin α5β1 is a major fibronectin receptor involved in angiogenesis. Volociximab has antiangiogenic and antitumor activities and inhibits the proliferation of human umbilical vein vascular endothelial cells (HUVECs) [1] .
|
-
- HY-P10417
-
|
|
Integrin
|
Others
Cancer
|
|
RTDLDSLRTYTL is an Alpha (v) beta (6) integrin (avb6) inhibitor with high affinity and specificity. RTDLDSLRTYTL binds to avb6 integrin, a peptide sequence that activates cytotoxicity and cytokine production in T cells, such as interferon-gamma. RTDLDSLRTYTL is designed through a chimeric T cell antigen receptor (CAR) so that T cells can be redirected to specifically recognize and attack tumor cells. RTDLDSLRTYTL can be used in the research of cancer immunotherapy and targeted drug development [1].
|
-
- HY-105670
-
|
|
nAChR
|
Neurological Disease
|
|
PHA-543613 is a potent, orally active, brain-penetrant and selective α7 nAChR agonist with a Ki of 8.8 nM. PHA-543613 displays selectivity for α7-nAChR over α3β4, α1β1γδ, α4β2 and 5-HT3 receptors [1]. PHA-543613 can be used for the cognitive deficits of Alzheimer's disease and schizophrenia research .
|
-
- HY-105670B
-
|
|
nAChR
|
Neurological Disease
|
|
PHA-543613 dihydrochloride is a potent, orally active, brain-penetrant and selective α7 nAChR agonist with a Ki value of 8.8 nM. PHA-543613 dihydrochloride displays selectivity for α7-nAChR over α3β4, α1β1γδ, α4β2 and 5-HT3 receptors [1]. PHA-543613 dihydrochloride can be used for the cognitive deficits of Alzheimer's disease and schizophrenia research .
|
-
- HY-N13420
-
|
|
Others
|
Others
|
|
3beta-Acetoxy-11alpha,12alpha-epoxyoleanan-28,13beta-olide is a natural product [1].
|
-
- HY-13535A
-
|
ATN-161 TFA salt
|
Integrin
|
Cancer
|
|
ATN-161 trifluoroacetate salt is a novel integrin α5β1 antagonist, which inhibits angiogenesis and growth of liver metastases in a murine model.
|
-
- HY-13535
-
|
|
Integrin
|
Cancer
|
|
ATN-161 is a novel integrin α5β1 antagonist, which inhibits angiogenesis and growth of liver metastases in a murine model.
|
-
- HY-E70138
-
|
EC:2.4.1.133; B4GALT7
|
Glycosyltransferase
|
Others
|
|
β-1,4-Galactosyltransferase 7 has exclusive specificity for the donor substrate UDP-galactose and all transfer galactose in a β-1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. [1].
|
-
- HY-W751152R
-
|
|
Others
|
Cancer
|
|
α,β-Thujone (Standard) is the analytical standard of α,β-Thujone. This product is intended for research and analytical applications. α,β-Thujone is a component of the essential oils of some plants. α,β-Thujone causes cancers in male rats and induces seizures in the highest doses [1].
|
-
- HY-P1188A
-
|
|
Integrin
|
Cancer
|
|
LDV-FITC TFA, a fluorescent peptide, is a FITC-conjugated LDV peptide (HY-P2267). LDV-FITC TFA binds to the α4β1 integrin with high affinity (Kd: 0.3 nM and 12 nM for binding to U937 cells in the presence and absence of Mn 2+ respectively). LDV-FITC TFA can be used to detect α4β1 integrin affinity [1] .
|
-
- HY-E70139
-
|
EC:2.4.1.313; B3GALNT2; β-1,3-N-acetylgalactosaminyltransferase II
|
Glucosylceramide Synthase (GCS)
|
Others
|
|
UDP-GalNAc:β-1,3-N-acetylgalactosaminyltransferase 2 ( EC:2.4.1.313; B3GALNT2; β-1,3-N-acetylgalactosaminyltransferase II) is a glycosyltransferase
[1].
|
-
- HY-131171
-
|
3β,5α-NET
|
Drug Derivative
|
Others
|
|
3β,5α-Tetrahydronorethisterone is a tetrahydro derivative of norethindrone (NET) [1].
|
-
- HY-129953S1
-
-
- HY-151892S
-
-
- HY-100506
-
|
|
Integrin
|
Cancer
|
|
GLPG0187 is a broad spectrum integrin receptor antagonist with antitumor activity; inhibits αvβ1-integrin with an IC50 of 1.3 nM [1]. GLPG0187 inhibits migrasome biogenesis without cytotoxicity .
|
-
- HY-E70285
-
|
B4GALT1 (Y285L)
|
Endogenous Metabolite
|
Metabolic Disease
|
|
beta-1,4-Galactosyltransferase 1 (Y285L) can enzymatic synthesis of the LacdiNAc motif. beta-1,4-Galactosyltransferase 1 (Y285L) can transfer of GalNAc from UDP-GalNAc [1].
|
-
- HY-129953S
-
-
- HY-129953
-
-
- HY-N3604
-
|
2β,9α-Clovanediol; 2β,9α-Dihydroxyclovane; Clovane-2β,9α-diol
|
Others
|
Others
|
|
Clovanediol (2β,9α-Clovanediol) is a product that can be isolated from [1].
|
-
- HY-P6022
-
|
|
Integrin
|
Others
|
|
G4RGDSP, Integrin-binding peptide is a cell integrin-binding peptide that targets integrin receptors. G4RGDSP, integrin-binding peptide is coupled to alginate to increase the viability of cells in the scaffold. G4RGDSP, integrin-binding peptide can be used as an extrudable carrier for chondrocyte delivery for the study of 3D printing technology [1]
|
-
- HY-107589A
-
|
|
Integrin
|
Inflammation/Immunology
|
|
BIO5192 hydrate is a selective and potent integrin α4β1 (VLA-4) inhibitor (Kd<10 pM). BIO5192 hydrate selectively binds to α4β1 (IC50=1.8 nM) over a range of other integrins. BIO5192 hydrate results in a 30-fold increase in mobilization of murine hematopoietic stem and progenitors (HSPCs) over basal levels [1] .
|
-
- HY-107589
-
BIO5192
1 Publications Verification
|
Integrin
|
Inflammation/Immunology
|
|
BIO5192 is a selective and potent integrin α4β1 (VLA-4) inhibitor (Kd<10 pM). BIO5192 selectively binds to α4β1 (IC50=1.8 nM) over a range of other integrins. BIO5192 results in a 30-fold increase in mobilization of murine hematopoietic stem and progenitors (HSPCs) over basal levels [1] .
|
-
- HY-W145656S
-
-
- HY-W751152
-
|
|
GABA Receptor
|
Cancer
|
|
α,β-Thujone is a component of the essential oils of some plants. α,β-Thujone causes cancers in male rats and induces seizures in the highest doses [1].
|
-
- HY-P0023
-
|
|
Integrin
|
Cancer
|
|
Cyclo(-RGDfK) is a potent and selective inhibitor of the αvβ3 integrin, with an IC50 of 0.94 nM [1]. Cyclo(-RGDfK) TFA potently targets tumor microvasculature and cancer cells through the specific binding to the αvβ3 integrin on the cell surface .
|
-
- HY-W145631
-
|
GalNAc beta(1-4)GlcNAc-beta-pNP
|
Biochemical Assay Reagents
|
Others
|
|
GalNAcβ(1-4)GlcNAc-β-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-W145607
-
|
Gal beta(1-3)GalNAc-beta-pNP
|
Biochemical Assay Reagents
|
Others
|
|
Galβ(1-3)GalNAc-β-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-W145558
-
|
Gal beta(1-4)Glc-beta-MP
|
Biochemical Assay Reagents
|
Others
|
|
Galβ(1-4)Glc-β-MP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-P0023A
-
|
|
Integrin
|
Cancer
|
|
Cyclo(-RGDfK) TFA is a potent and selective inhibitor of the αvβ3 integrin, with an IC50 of 0.94 nM [1]. Cyclo(-RGDfK) TFA potently targets tumor microvasculature and cancer cells through the specific binding to the αvβ3 integrin on the cell surface .
|
-
- HY-N1202
-
|
Sitostane-3β,5α,6β-triol
|
Others
|
Others
|
|
Sitostanetriol (Sitostane-3β,5α,6β-triol) is a steroid isolated from Casearia membranacea (Flacourtiaceae) [1].
|
-
- HY-43470R
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
3α,12β-Dihydroxycholanoic acid (Standard) is the analytical standard of 3α,12β-Dihydroxycholanoic acid. This product is intended for research and analytical applications. 3α,12β-Dihydroxycholanoic acid is a bile acid that can be isolated from urine specimens of healthy humans[1].
|
-
- HY-108831
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Natalizumab is a recombinant, humanized IgG4 monoclonal antibody, binds to α4β1-integrin and blocks its interaction with vascular cell adhesion molecule-1 (VCAM-1). Natalizumab can be used for the treatment of relapsing remitting multiple sclerosis and Crohn's disease. Natalizumab is also the first targeted therapy which blocks an essential mechanism for lymphocyte entry to the CNS and thus prevents acute demyelinating relapses [1].
|
-
- HY-N1661
-
|
|
Others
|
Others
|
|
2α,3β-Dihydroxypterodontic acid is a natural product used for synthesize 2α,3β-dihydroxy-5,11(13)-dien-eudesman-12-oic acid [1].
|
-
- HY-W145620
-
|
Gal[246Bn]beta(1-4)Glc[236Bn]-beta-MP
|
Biochemical Assay Reagents
|
Others
|
|
Gal[246Bn]β(1-4)Glc[236Bn]-β-MP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Gal[246Bn]β(1-4)Glc[236Bn]-β-MP](//file.medchemexpress.com/product_pic/hy-w145620.gif)
- HY-W145594
-
|
Gal[26bn]beta(1-4)glc[236bn]-beta-MP
|
Biochemical Assay Reagents
|
Others
|
|
Gal[26Bn]β(1-4)Glc[236Bn]-β-MP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Gal[26Bn]β(1-4)Glc[236Bn]-β-MP](//file.medchemexpress.com/product_pic/hy-w145594.gif)
- HY-N9187
-
|
|
Others
|
Others
|
|
1α,4β,10β-Trihydroxyguaia-2,11(13)-dien-12,6α-olide is a Sesquiterpenoids product that can be isolated from the rhizomes of Alisma orientale [1].
|
-
- HY-N6712
-
|
Acetopyrrothin
|
Bacterial
Antibiotic
Endogenous Metabolite
Deubiquitinase
|
Infection
Metabolic Disease
|
|
Thiolutin (Acetopyrrothin) is a disulfide-containing antibiotic and anti-angiogenic compound produced by Streptomyces. Thiolutin inhibits the JAMM metalloproteases Csn5, Associated-molecule-with-the-SH3-Domain-of-STAM (AMSH) and Brcc36 [1]. Thiolutin is a potent and selective inhibitor of endothelial cell adhesion accompanied by rapid induction of Heat-shock protein beta-1 (Hsp27) phosphorylation .
|
-
- HY-P0178
-
|
|
Integrin
|
Inflammation/Immunology
|
|
LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect [1] .
|
-
- HY-N10525
-
|
|
Others
|
Others
|
|
3α,4β-Galactotriose is a galactosyl residue [1].
|
-
- HY-W145656
-
|
Alpha,beta-Trehalose
|
Biochemical Assay Reagents
|
Others
|
|
α,β-Trehalose is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-14189
-
|
R-411
|
Integrin
|
Inflammation/Immunology
|
|
Valategrast hydrochloride (R-411) is a potent integrin α4β1 (VLA-4) and α4β7 dual antagonist. Valategrast hydrochloride has the potential for Chronic obstructive pulmonary disease (COPD) and asthma treatment [1] .
|
-
- HY-P0178A
-
|
|
Integrin
|
Inflammation/Immunology
|
|
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 TFA increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect [1] .
|
-
- HY-161671
-
|
|
nAChR
|
Neurological Disease
Inflammation/Immunology
|
|
GAT2711 is a full agonist of α9 nAChR with an EC50 of 230 nM. GAT2711 shows 340-fold selective for α9 over α7 nAChRs. GAT2711 inhibits ATP-induced IL-1β release in THP-1 cells. GAT2711 retains full analgesic activity in α7 nAChR knockout mice [1].
|
-
- HY-167584S
-
-
- HY-133966
-
|
5α-Cholestane-3β,6α-diol
|
Reactive Oxygen Species
|
Others
|
|
6α-Hydroxy-5α-cholestane (5α-Cholestane-3β,6α-diol) is an oxysterol that promotes the production of superoxide anions in SK-N-BE cells at concentrations of 50 μM and 100 μM [1].
|
-
- HY-114364
-
|
|
P2Y Receptor
Endogenous Metabolite
|
Infection
Neurological Disease
Metabolic Disease
|
|
UDP-Galactose disodium is a natural agonist of the P2Y14 receptor with an EC50 of 0.67 μM for the hP2Y14 receptor. UDP-Galactose disodium is a substrate for the transferase beta-1, 4 galactosyltransferase V (B4GALT5). In addition, UDP-Galactose disodium is required for the biosynthesis of several abundant glycoconjugates that form the surface glycocalyx of Leishmania major [1] .
|
-
- HY-100206
-
|
|
AMPK
|
Neurological Disease
|
|
5α-Androstane-3β,5,6β-triol is a neuroprotectant. 5α-Androstane-3β,5,6β-triol can remarkably reverse intracellular acidification and alleviate neuronal injury through the inhibition of AMPK signaling. 5α-Androstane-3β,5,6β-triol remarkably reduced the infarct volume and attenuated neurologic impairment in acute ischemic stroke models of middle cerebral artery occlusion in vivo [1].
|
-
- HY-E70050
-
|
GM1-synthase
|
Endogenous Metabolite
|
Others
|
|
beta-1,3-Galactosyltransferase (CgtB) (GM1-synthase) is an enzyme that required for sialylated lipooligosaccharide (LOS SIAL) production, is often used in biochemical studies. beta-1,3-Galactosyltransferase (CgtB) catalyzes the addition of a galactose molecule, which is required for GM1-like LOS SIAL structure production [1].
|
-
- HY-126304A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Glycerophosphoric acid (disodium salt hydrate) (α and β mixture) is a complex contains α and β Glycerophosphoric acid isomers.
|
-
- HY-124463
-
-
- HY-P10704
-
|
|
Integrin
|
Cancer
|
|
C16Y is a short peptide and an inhibitor of integrins αvβ3 and α5β1. C16Y acts on the cell membrane and exerts its anticancer activity by inhibiting angiogenesis [1].
|
-
- HY-N3825
-
|
|
Apoptosis
|
Cancer
|
|
ent-Kaurane-3α,16β,17-triol (Compound 3) is an anticancer agent. ent-Kaurane-3α,16β,17-triol induces apoptosis in HCT116 cells [1].
|
-
- HY-166970
-
|
|
Biochemical Assay Reagents
|
Others
|
|
3α,4β,3α-Galactotetraose is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-100740C
-
|
(1α,1'S,4β)-AZD3293; (1α,1'S,4β)-LY3314814
|
Beta-secretase
|
Neurological Disease
|
|
(1α,1'S,4β)-Lanabecestat ((1α,1'S,4β)-AZD3293) a less active enantiomer of Lanabecestat. Lanabecestat is a potent, orally active and blood-brain barrier penetrating BACE1 inhibitor with a Ki of 0.4 nM [1].
|
-
- HY-N1810
-
|
3α,6β-Ditigloyloxytropan-7β-ol
|
Others
|
Others
|
|
Ditigloylteloidine (3α,6β-Ditigloyloxytropan-7β-ol) is a Sesquiterpenoids product that can be isolated from the herbs of Eupatorium chinense var. tozanense. [1].
|
-
- HY-W010934
-
|
|
Biochemical Assay Reagents
|
Others
|
|
3β,5α,6β-Trihydroxycholestane is a steroid that occurs naturally in the body and is also found in certain foods. It belongs to a class of compounds known as cholestanes, which are closely related to the better known cholesterol. This particular compound is formed from cholesterol through a series of enzymatic reactions in the liver and other organs. It has been studied for its potential health benefits, including its ability to reduce inflammation and oxidative stress in the body. Some research suggests that it may also play a role in regulating blood sugar levels and improving insulin sensitivity. Despite these potential benefits, 3β,5α,6β-Trihydroxycholestane is not widely used as a supplement or medicine due to its relatively low content, focus on natural resources and limited research. However, researchers continue to investigate its potential uses and effects on human health.
|
-
- HY-W145559
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gal[236Bn]β(1-4)Glc[236Bn]-β-MP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Gal[236Bn]β(1-4)Glc[236Bn]-β-MP](//file.medchemexpress.com/product_pic/hy-w145559.gif)
- HY-N3824
-
|
|
Others
|
Others
|
|
ent-Atisane-3β,16α,17-triol is a compound that can be isolated from the acetone extract of roots of Euphorbia sieboldiana. ent-Atisane-3β,16α,17-triol is a natural control product [1].
|
-
- HY-N3363
-
|
20(29)-Lupene-2α,3β-diol; 2α,3β-Dihydroxylup-20(29)-ene
|
Others
|
Others
|
|
Lup-20(29)-ene-2alpha,3beta-diol (20(29)-Lupene-2α,3β-diol) is a phenol product that can be isolated from Chinese bog bilberry wines [1].
|
-
- HY-N0181A
-
|
9β,10α-Ergosterol
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Lumisterol (9β,10α-Ergosterol), a steroid compound, is the (9β,10α)-stereoisomer of Ergosterol (HY-N0181). Lumisterol is a photoprotective agent against UVB-induced DNA damage and anti-proliferative activities [1].
|
-
- HY-W141862
-
-
- HY-13306
-
|
|
Integrin
|
Metabolic Disease
|
|
Pyrintegrin is an β1-integrin agonist and a 2,4-disubstituted pyrimidine that promotes embryonic stem cells survival. Pyrintegrin enhances cell-extracellular matrix (ECM) adhesion-mediated integrin signaling. Pyrintegrin can be used as a podocyte-protective agent and has robustly adipogenic [1] .
|
-
- HY-43470
-
-
- HY-101514
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
β3-AR agonist 1 (compound 15) is a highly potent, selective, and orally available β3-adrenergic receptor (β3-AR) agonist (EC50=18 nM), being inactive to β1-, β2-, and α1A-AR (β1/β3, β2/β3, and α1A/β3>556-fold) [1].
|
-
- HY-146767S
-
-
- HY-N1601
-
|
2β,6β,15α-(-)-Kaur-16-ene
|
Others
|
Others
|
|
2β,6β,15α-Trihydroxy-ent-kaur-16-ene (compound 19) is a compound isolated from the aerial parts of Pteris cretica [1].
|
-
- HY-E70048
-
|
Gb4 synthetase
|
Others
|
Others
|
|
beta-1,3-N-Acetylgalactosaminyltransferase (LgtD) (Gb4 synthetase) expressed by mature/activated B cells [1].
|
-
- HY-W013854
-
|
3β-Hydroxy-5α-androstane
|
Endogenous Metabolite
|
Others
|
|
5α-Androstan-3β-ol (Androstan), a saturated sterol, is a CAR (constitutive androstane receptor) inverse agonist ligand. 5α-Androstan-3β-ol (Androstan) increases the AmB-channel conductance in a concentration dependent manner [1] .
|
-
- HY-14190
-
|
R-411 free base
|
Integrin
|
Inflammation/Immunology
|
|
Valategrast (R-411 free base) is a potent and orally active integrin α4β1 (VLA-4) and α4β7 dual antagonist. Valategrast has the potential for Chronic obstructive pulmonary disease (COPD) and asthma treatment [1] .
|
-
- HY-N15534
-
|
|
Others
|
Others
|
|
5β,6α-Dihydroxy-3β-(β-glucopyranosyloxy)-7-megastigmen-9-one (Compound 2) is a compound found in Agastache rugosa. 5β,6α-Dihydroxy-3β-(β-glucopyranosyloxy)-7-megastigmen-9-one (Compound 2) is promising for research of skin pigment-related diseases [1].
|
-
- HY-N15425
-
-
- HY-P5906
-
|
Citrullinated Aβ (1-40); Citrullinated Aβ40
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P0265) with a citrullination at the Arg5 site. Citrullinated amyloid-β (1-40) peptide (human) exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified β-Amyloid (1-40) [1].
|
-
- HY-N8011
-
|
|
Others
|
Others
|
|
25(R)-3β,17α-Dihydroxy-5α-spirostan-6-one 3-O-α-D-rhamnopyranosyl-(1→2)-β-D-glucopyranoside is a compound that can be isolated from Lilium brownii var. viridulum [1].
|
-
- HY-109564
-
|
|
Drug Metabolite
|
Cancer
|
|
5α-Pregnane-3β,6α-diol-20-one is a mitogenic metabolite of progesterone, and it can be produced in starved androgen-responsive prostate cancer cells.
|
-
- HY-164568
-
|
|
Drug Derivative
|
Cancer
|
|
7β,16α-Dihydroxybufalin is a dihydroxylated derivative of bufalin, which exhibits cytotoxicities against cancer cell lines [1] .
|
-
- HY-P5812
-
|
|
Integrin
|
Inflammation/Immunology
|
|
IDR-1002 is an anti-infective peptide that enhances the ability of human monocytes to migrate toward chemokines on fibronectin. IDR-1002 also induces adhesion and activation of β1-integrin, a mechanism that promotes monocyte recruitment [1].
|
-
- HY-146766S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
D-Galactosyl-β-1,1'-N-tridecanoyl-D-erythro-sphingosine-d7 is deuterium labeled D-Galactosyl-β-1,1'-N-tridecanoyl-D-erythro-sphingosine.
|
-
- HY-146764S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
D-Lactosyl-β-1,1'-N-pentadecanoyl-D-erythro-sphingosine-d7 is deuterium labeled D-Lactosyl-β-1,1'-N-pentadecanoyl-D-erythro-sphingosine.
|
-
- HY-105670A
-
|
|
nAChR
|
Neurological Disease
|
|
PHA-543613 hydrochloride is an oral or active α7 nAChR agonist with brain permeability, For α3β4, α1β1γδ, α4β2 and 5-HT3 receptors selective. PHA-543613 hydrochloride affects sensory gating and memory in an in vivo model of schizophrenia [1] [1].
|
-
- HY-N10868
-
|
|
LIM Kinase (LIMK)
|
Cancer
|
|
8β,9α-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olide (compound 3), a sesquiterpene, has anti-LIMK1 activity. 8β,9α-Dihydroxylindan-4(5),7(11)-dien-8alpha,12-olide has inhibitory property on cell motility [1].
|
-
- HY-N11477
-
|
|
Glycosidase
|
Metabolic Disease
|
|
(2α,3β,4α)-2,3,19-Trihydroxyurs-12-ene-23,28-dioic acid is a saponin that can be isolated from Rubus ellipticus var. obcordatus. (2α,3β,4α)-2,3,19-Trihydroxyurs-12-ene-23,28-dioic acid inhibits α-Glucosidase with an IC50 of 1.68 mM [1].
|
-
- HY-N10636
-
|
|
Others
|
Others
|
|
D-lactosyl-β-1,1′ N-stearoyl-D-erythro-sphingosine is a neutral glycolipid [1].
|
-
- HY-N2587
-
|
|
Integrin
Apoptosis
|
Cancer
|
|
Irigenin is a is a lead compound, and mediates its anti-metastatic effect by specifically and selectively blocking α9β1 and α4β1 integrins binding sites on C-C loop of Extra Domain A (EDA). Irigenin shows anti-cancer properties. It sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells [1].
|
-
- HY-137611A
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
α,β-MTDP trisodium, a thymidylate analog, is a thymidine kinase inhibitor with a Ki of 23 µM [1].
|
-
- HY-122084
-
-
- HY-113019
-
-
- HY-N7170
-
|
|
Glycosidase
|
Metabolic Disease
|
|
(-)-6β-Hydroxy-5β,8β,9β,10α-cleroda-3,13-dien-16,15-olid-18-oic acid (compound 4) is a α-Glucosidase inhibitor with an IC50 value of 577.7 µM [1].
|
-
- HY-N3808
-
|
|
Others
|
Others
|
|
(4α,11β,15β)-11,15-Dihydroxykaur-16-en-19-oic acid is a compound isolated from the Tunisian Pulicaria laciniata (Coss.et Kral.) Thell. flowers [1].
|
-
- HY-N10794
-
|
|
Others
|
Cancer
|
|
18β-Hydroxy-3-epi-α-yohimbine is a yohimbine derivative. 18β-Hydroxy-3-epi-α-yohimbine is a nature product that can be found in Rauvolfia vomitoria [1].
|
-
- HY-N1035
-
|
|
Others
|
Others
|
|
Urs-12-ene-3β,16β,22α-triol is a terpenoid compound isolated from the ethanol extract of fresh aerial parts of the Patagonian shrub Nardophyllum bryoides [1].
|
-
- HY-N8971
-
|
16α-Hydroxybauerenol
|
Bacterial
|
Infection
|
|
Bauer-7-ene-3β,16α-diol, a triterpenoid, is a natural product that can be isolated from dried flower buds of Tussilago farfara L. or Petasites tricholobus (Compositae). Bauer-7-ene-3β,16α-diol shows medium antibacterial activity against E. coli [1].
|
-
- HY-134440A
-
|
|
P2X Receptor
|
Inflammation/Immunology
|
|
α,β-Methylene-ATP is an agonist of P2X1 and P2X3 receptors and can cross the blood-brain barrier. α,β-Methylene-ATP can trigger a reflex pressor response by activating P2X receptors in peripheral muscles and the central locus coeruleus (LC); this effect can be blocked by the P2X antagonist PPADS (HY-108960). α,β-Methylene-ATP also activates noradrenergic neurons in the central locus coeruleus, mediating antinociceptive effects; this effect can be attenuated by the locus coeruleus damaging agent DSP-4 (HY-103210/HY-121602). α,β-Methylene-ATP can be used to study the pathological mechanisms of neuropathic pain, cardiovascular reflex regulation, and antinociceptive effects of the central nervous system [1] .
|
-
- HY-139671
-
-
- HY-E70141
-
|
EC:2.4.1.149; B3GNT4
|
Glycosyltransferase
|
Others
|
|
β-1,3-N-Acetylglucosaminyltransferase 4 (EC:2.4.1.149, B3GNT4) is involved in the synthesis of poly-N-acetyllactosamine and has activity for type 2 oligosaccharides [1].
|
-
- HY-E70049
-
|
GM2/GD2 synthase
|
Others
|
Neurological Disease
|
|
beta-1,4-N-Acetylgalactosaminyltransferase (CgtA) (GM2/GD2 synthase) is a key enzyme which catalyzes the conversion of GM3, GD3 and lactosylceramide (LacCer) to GM2, GD2 and asialo-GM2 (GA2), respectively. beta-1,4-N-Acetylgalactosaminyltransferase (CgtA) is a key enzyme to control the synthesis of brain-enriched complex gangliosides [1].
|
-
- HY-W587733
-
-
- HY-113019S
-
-
- HY-P990160
-
|
|
CD3
|
Others
|
|
Anti-Rat TCR alpha/beta Antibody (R73) is a mouse-derived IgG1, κ type antibody inhibitor, targeting to rat TCR alpha/beta.
|
-
- HY-N9738
-
|
|
Endogenous Metabolite
|
Others
|
|
14β,16β-Dihydroxy-3β-(β-D-glucopyranosyloxy)-5α-bufa-20,22-dienolide (compound 10) is a butadiene lactone that can be used in related research in the field of life sciences.
|
-
- HY-N2743
-
|
7α-Hydroxystigmasterol; Stigmast-5,22E-diene-3β,7α-diol
|
Others
|
Others
|
|
(3β,7α,22E)-Stigmasta-5,22-diene-3,7-diol (7α-Hydroxystigmasterol) is a Triterpenoids product that can be isolated from the herbs of Glochidion puberum L. [1].
|
-
- HY-P5905
-
|
Citrullinated Aβ (1-42); Citrullinated Aβ42
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets [1].
|
-
- HY-W741922
-
-
- HY-146638S
-
|
|
Isotope-Labeled Compounds
|
Cancer
|
|
5α-Pregnan-11β,17α,21-triol-3,20-dione-1,2,4,5-d4 is the deuterium labeled 5α-Pregnan-11β,17α,21-triol-3,20-dione-1,2,4,5[1].
|
-
- HY-E70289
-
|
Bovin B4GALT1 (Y289L)
|
Endogenous Metabolite
|
Others
|
|
Bovin beta-1,4-galactosyltransferase 1 (Y289L) (Bovin B4GALT1 (Y289L)) is a mutated form of bovine-derived galactosyltransferase with a mutation at the Y289L genetic site. Bovin beta-1,4-galactosyltransferase 1 can label O-GlcNAcylated proteins with an N-azidoacetylgalactosamine (GalNAz) group. This labeling method allows for the specific, unbiased, and global labeling of O-GlcNAcylated proteins. After labeling, the appended azide group can react with a wide variety of alkyne-modified chemical probes, facilitating multiple downstream analyses [1].
|
-
- HY-129397
-
|
BPG; 2,3-Dinor-11β-PGF2α; 2,3-dinor-11-epi PGF2α
|
Prostaglandin Receptor
|
Endocrinology
|
|
2,3-Dinor-11beta-prostaglandin F2alpha (2,3-Dinor-11β-PGF2α) is a metabolite of PGD2. Urinary excretion of 2,3-Dinor-11beta-prostaglandin F2alpha is increased in patients with mast cell activation disease (MCAD) and has been used as a marker of increased PGD2 levels. 2,3-Dinor-11beta-prostaglandin F2alpha levels are also increased in the urine of patients with asthma and are positively correlated with impaired lung function.
|
-
- HY-15102
-
MK-0429
4 Publications Verification
L-000845704
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
MK-0429 (L-000845704) is an orally active, potent, selective and nonpeptide pan-integrin antagonist with IC50 values of 1.6 nM, 2.8 nM, 0.1 nM, 0.7 nM, 0.5 nM and 12.2 nM for αvβ1, αvβ3, αvβ5, αvβ6, αvβ8 and α5β1, respectively [1] .
|
-
- HY-P10941A
-
|
|
Integrin
FAK
ERK
|
Inflammation/Immunology
Cancer
|
|
VSLRGDTRG acetate is a synthetic peptide containing the RGD motif from cadherin 17 (CDH17), which binds to α2β1 integrin and activates its signaling pathway. VSLRGDTRG acetate promotes the high-affinity conformational change of β1 integrin through the RGD motif, enhancing cell adhesion and phosphorylation of FAK and ERK1/2, thereby driving tumor proliferation and metastasis. VSLRGDTRG acetate can be used in research on cancers expressing CDH17, such as colon cancer and pancreatic cancer [1] .
|
-
- HY-P10941
-
|
|
Integrin
FAK
ERK
|
Inflammation/Immunology
Cancer
|
|
VSLRGDTRG is a synthetic peptide containing the RGD motif from cadherin 17 (CDH17), which binds to α2β1 integrin and activates its signaling pathway. VSLRGDTRG promotes the high-affinity conformational change of β1 integrin through the RGD motif, enhancing cell adhesion and phosphorylation of FAK and ERK1/2, thereby driving tumor proliferation and metastasis. VSLRGDTRG can be used in research on cancers expressing CDH17, such as colon cancer and pancreatic cancer [1] .
|
-
- HY-107673
-
-
- HY-129113
-
|
|
COX
|
Inflammation/Immunology
|
|
α-Chaconine inhibits the expressions of COX-2, IL-1β, IL-6, and TNF-α at the transcriptional level. α-Chaconine inhibits the LPS-induced expressions of iNOS and COX-2 at the protein and mRNA levels and their promoter activities in RAW 264.7 macrophages. Anti-inflammatory effects [1].
|
-
- HY-N8653
-
-
- HY-112502B
-
|
Adenosine 5'-(α,β-methylene)diphosphate sodium
|
CD73
|
Cancer
|
|
MethADP (sodium salt) (Adenosine 5'-(α,β-methylene)diphosphate (sodium)) is a specific CD73 inhibitor.
|
-
- HY-W704091
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
α-Amino-β-methylaminopropionic acid-d3 hydrochloride is the deuterium labeled α-Amino-β-methylaminopropionic acid. Radioactive isotopes labeled compounds can be used in metabolic analysis, allowing the movement of individual atoms to be precisely tracked and quantified [1].
|
-
- HY-N9175
-
|
|
Others
|
Others
|
|
4α,6α-Dihydroxyeudesm-11(13)-en-12,8β-olide is a Sesquiterpenoids product that can be isolated from the herbs of Chloranthus elatior [1].
|
-
- HY-108652
-
|
|
P2X Receptor
|
Inflammation/Immunology
|
|
α,β-Methylene-ATP trisodium is an agonist of P2X1 and P2X3 receptors and can cross the blood-brain barrier. α,β-Methylene-ATP trisodium can trigger a reflex pressor response by activating P2X receptors in peripheral muscles and the central locus coeruleus (LC); this effect can be blocked by the P2X antagonist PPADS (HY-108960). α,β-Methylene-ATP trisodium also activates noradrenergic neurons in the central locus coeruleus, mediating antinociceptive effects; this effect can be attenuated by the locus coeruleus damaging agent DSP-4 (HY-103210/HY-121602). α,β-Methylene-ATP trisodium can be used to study the pathological mechanisms of neuropathic pain, cardiovascular reflex regulation, and antinociceptive effects of the central nervous system [1] .
|
-
- HY-134440
-
|
|
P2X Receptor
|
Inflammation/Immunology
|
|
α,β-Methylene-ATP dilithium is an agonist of P2X1 and P2X3 receptors and can cross the blood-brain barrier. α,β-Methylene-ATP dilithium can trigger a reflex pressor response by activating P2X receptors in peripheral muscles and the central locus coeruleus (LC); this effect can be blocked by the P2X antagonist PPADS (HY-108960). α,β-Methylene-ATP dilithium also activates noradrenergic neurons in the central locus coeruleus, mediating antinociceptive effects; this effect can be attenuated by the locus coeruleus damaging agent DSP-4 (HY-103210/HY-121602). α,β-Methylene-ATP dilithium can be used to study the pathological mechanisms of neuropathic pain, cardiovascular reflex regulation, and antinociceptive effects of the central nervous system [1] .
|
-
- HY-N10128
-
|
|
Bacterial
|
Infection
|
|
(8'α,9'β-Dihydroxy)-3-farnesylindole shows strong inhibitory activity (EC50 9.8 μM) against B. subtilis.
|
-
- HY-P99291
-
|
LM 609; MEDI 523; Anti-αvβ3 integrin Recombinant Antibody
|
Integrin
|
Cancer
|
|
Etaracizumab (LM 609) is an αvβ3 integrin IgG1 monoclonal antibody. Etaracizumab inhibits angiogenesis and melanoma tumor growth. Etaracizumab can be used to research anticancer [1].
|
-
- HY-N10634
-
|
C16 Glucosyl(β) Ceramide (d18:1/16:0)
|
Others
|
Inflammation/Immunology
|
|
D-Glucosyl-β-1,1′-N-palmitoylsphingosine (C16 Glucosyl(β) Ceramide (d18:1/16:0)) is an endogenous Mincle ligand possessing immunostimulatory activity [1].
|
-
- HY-P3523
-
|
|
Integrin
|
Others
|
|
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser [1].
|
-
- HY-124463S1
-
-
- HY-N1111
-
|
6β,19α-Dihydroxyursolic acid
|
HIV
|
Infection
|
|
Uncaric acid (6β,19α-Dihydroxyursolic acid) (compound 6) is a triterpene that can be found in Eriobotrya japonica. Uncaric acid shows anti HIV-1, HRV 1B, SNV activity [1].
|
-
- HY-133830
-
|
(3β,7α,24S)-Cholest-5-ene-3,7,24-triol
|
Endogenous Metabolite
|
Others
|
|
7α,24(S)-Dihydroxycholesterol ((3β,7α,24S)-Cholest-5-ene-3,7,24-triol) serves as a ligand for liver X receptor (LXR), binding specifically to the ligand binding domains of both LXRα and LXRβ. This compound is synthetically produced from E-α,β-enone, utilizing Arsonium ylide and J-tert-butyldimethylsilyloxy-bisnor-5-cholenaldehyde as starting materials, followed by a series of transformations to yield 7α,24(S)-dihydroxycholesterol.
|
-
- HY-W699180
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Fuc1-α-2Gal1-β-3GlcNAc-β-PNP is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-W145534
-
|
|
Biochemical Assay Reagents
|
Others
|
|
GlcNAcβ(1-3)GalNAc-α-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-N2587R
-
|
|
Integrin
Apoptosis
|
Cancer
|
|
Irigenin (Standard) is the analytical standard of Irigenin. This product is intended for research and analytical applications. Irigenin is a is a lead compound, and mediates its anti-metastatic effect by specifically and selectively blocking α9β1 and α4β1 integrins binding sites on C-C loop of Extra Domain A (EDA). Irigenin shows anti-cancer properties. It sensitizes TRAIL-induced apoptosis via enhancing pro-apoptotic molecules in gastric cancer cells [1].
|
-
- HY-N8229
-
|
|
Others
|
Inflammation/Immunology
|
|
7β,15α,20-Trihydroxy-3,11,23-trioxo-5α-lanosta-8-en-26-oic acid is a triterpenoid compound found in Ganoderma lucidum. 7β,15α,20-Trihydroxy-3,11,23-trioxo-5α-lanosta-8-en-26-oic acid may exhibit anti-inflammatory activity and holds potential for research in inflammatory diseases [1].
|
-
- HY-107819R
-
|
Dihydrocholesterol(Standard); 5α-Cholestanol(Standard); NSC 18188 (Standard)
|
Endogenous Metabolite
|
Others
|
|
5α-Cholestan-3β-ol (Standard) is the analytical standard of 5α-Cholestan-3β-ol. This product is intended for research and analytical applications. 5α-Cholestan-3β-ol is a derivitized steroid compound.
|
-
- HY-118816
-
|
11-epi PGF2α-EA; 11β-PGF2α-EA; 11β-Prostamide F2α
|
Drug Metabolite
|
Metabolic Disease
|
|
11β-Prostaglandin F2α ethanolamide (11β-PGF2α-EA) is the theoretical hepatic metabolite of PGD2-EA, produced during COX-2 metabolism of the endogenous cannabinoid AEA which is found in brain, liver, and other mammalian tissues.1 AEA can be used directly by COX-2 and specific PG synthase to produce ethanolamide congeners of the classical PGs. PGD2-EA is formed in activated RAW 264.7 cells treated with AEA.
|
-
- HY-E70033
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
D-galactosyl-β1-3-N-acetyl-D-hexosamine phosphorylase (BiGalHexNAcP) is a member of CAZy glycoside hydrolase GH112 family, is often used in biochemical studies. D-galactosyl-β1-3-N-acetyl-D-hexosamine phosphorylase (BiGalHexNAcP) catalyses the phosphorolysis of lacto-n-biose and galacto-n-biose, to produce Gal-1-P and the corresponding N-acetyl-D-hexosamine [1].
|
-
- HY-13671
-
|
HIF-1α inhibitor; LW8
|
HIF/HIF Prolyl-Hydroxylase
Apoptosis
|
Cancer
|
|
LW6 (HIF-1α inhibitor) is a novel HIF-1 inhibitor with an IC50 value of 4.4 μM, and it is also an inhibitor of MDH2. LW6 decreases HIF-1α protein expression without affecting HIF-1β expression.
|
-
- HY-N12017
-
|
|
Others
|
Infection
Cancer
|
|
3-O-α-L-Rhamnopyranosyl-(1→2)-α-L-arabinopyranosyl hederagenin28-O-β-D-xylopyranosyl-(1→6)-β-D-glucopyranosyl ester is a hederagenin-type saponin with antitumor and anti-inflammatory properties [1].
|
-
- HY-N6911
-
|
(18β,20α)-Glycyrrhizic acid
|
Others
|
Metabolic Disease
|
|
Licorice-saponin H2 ((18β,20α)-Glycyrrhizic acid) is a saponin from Glycyrrhiza uralensis Fischer [1].
|
-
- HY-129113R
-
|
|
COX
|
Inflammation/Immunology
|
|
α-Chaconine (Standard) is the analytical standard of α-Chaconine. This product is intended for research and analytical applications. α-Chaconine inhibits the expressions of COX-2, IL-1β, IL-6, and TNF-α at the transcriptional level. α-Chaconine inhibits the LPS-induced expressions of iNOS and COX-2 at the protein and mRNA levels and their promoter activities in RAW 264.7 macrophages. Anti-inflammatory effects [1].
|
-
- HY-N9137
-
|
|
Others
|
Others
|
|
2α-Hydroxy-8β-(2-methylbutyryloxy)costunolide is a Sesquiterpenoids product that can be isolated from the aerial parts of Artemisia myriantha [1].
|
-
- HY-P3533
-
|
|
Integrin
|
Cardiovascular Disease
|
|
EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis [1].
|
-
- HY-N9398
-
|
|
Sirtuin
|
Cancer
|
|
3β,6α,12β-Dammar-E-20(22)-ene-3,6,12,25-tetraol, a SIRT1 activator, exhibits significant stimulation of SIRT1 activity. Anti-tumor activity [1].
|
-
- HY-146761S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
3-O-Sulfo-D-galactosyl-β1-1'-N-tridecanoyl-D-erythro-sphingosine-d7 is deuterium labeled 3-O-Sulfo-D-galactosyl-β1-1'-N-tridecanoyl-D-erythro-sphingosine.
|
-
- HY-129397S
-
|
2,3-Dinor-11β-PGF2α-d9, 2,3-dinor-11-epi PGF2α-d9
|
Isotope-Labeled Compounds
|
Others
|
|
2,3-Dinor-11β-prostaglandin F2α-d9 is the deuterium labeled 2,3-Dinor-11β-prostaglandin F2α[1].
|
-
- HY-118335
-
|
SZL 49
|
Adrenergic Receptor
|
Neurological Disease
|
|
Prazobind (SZL 49), a prazosin analog, is a potent alpha 1-adrenoceptor blocker. Prazobind competes for alpha 1-adrenoceptor binding sites with a similar potency (IC50=1 nM) in tissues enriched in both the alpha 1A (hippocampus) and alpha 1B (liver) subtypes [1] .
|
-
- HY-107819
-
-
- HY-157056S
-
-
- HY-N1014
-
|
|
Others
|
Others
|
|
11α,12β-Di-O-acetyltenacigenin B is a polyoxypregnane compound isolated from the CHCl(3)-soluble fraction of the ethanolic extract of the stem of Marsdenia tenacissima [1].
|
-
- HY-W145540
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Galβ(1-3)[Neu5Acα(2-6)]GalNAc-α-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Galβ(1-3)[Neu5Acα(2-6)]GalNAc-α-pNP](//file.medchemexpress.com/product_pic/hy-w145540.gif)
- HY-N2850
-
|
5α-Stigmasta-7,22-dien-3β-ol, acetate; Spinasteryl acetate
|
Others
|
Others
|
|
α-Spinasterol acetate (5α-Stigmasta-7,22-dien-3β-ol, acetate) is a Sesquiterpenoids product that can be isolated from the roots of Trigonostemon chinensis Merr. [1].
|
-
- HY-N11122
-
|
|
Others
|
Others
|
|
7-[α-L-Arabinopyranosyl-(1→6)-β-D-glucopyranosyloxy]cuminol is a cuminol glycoside. 7-[α-L-Arabinopyranosyl-(1→6)-β-D-glucopyranosyloxy]cuminol can be isolated from Rhodiola rosea sup>[1].
|
-
![7-[α-L-Arabinopyranosyl-(1→6)-β-D-glucopyranosyloxy]cuminol](//file.medchemexpress.com/product_pic/hy-n11122.gif)
- HY-123489
-
|
THDOC
|
GABA Receptor
|
Neurological Disease
|
|
3α,21-Dihydroxy-5α-pregnan-20-one (THDOC), an endogenous neurosteroid, is a positive modulator of GABAA receptors. 3α,21-Dihydroxy-5α-pregnan-20-one potentiates neuronal response to low concentrations of GABA at α4β1δ GABAA receptors in vitro.
|
-
- HY-N13438
-
|
|
Others
|
Others
|
|
6beta-(Hexa-2,4-dienoyloxy)-9alpha,12-dihydroxydrimenol is a natural product [1].
|
-
- HY-N1762
-
|
|
Fungal
|
Cancer
|
|
3α,22β-Dihydroxyolean-12-en-29-oic acid is a terpenoid that can be isolated from Maytenus royleanus cufodontis [1].
|
-
- HY-P1408
-
|
|
Integrin
|
Cancer
|
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer [1] .
|
-
- HY-N1936
-
|
α-Spinasterol glucoside
|
Others
|
Inflammation/Immunology
|
|
α-Spinasterol-3-O-β-D-glucoside is a sterol glucoside that can be isolated from the seeds of Momordica cochinchinensis [1].
|
-
- HY-N8811
-
|
|
Others
|
Inflammation/Immunology
Cancer
|
|
Acetyl 11α-methoxy-β-boswellic acid is a terpenoid compound derived from the resin of olive plants, and it holds promise for research in fields such as anti-inflammatory, anti-cancer, and analgesic applications [1].
|
-
- HY-W782607
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
5α-Cholesta-8,14-dien-3β-ol is an efficient precursor of cholesterol, which converts to cholesterol under aerobic conditions. 5α-Cholesta-8,14-dien-3β-ol can be used for metabolic research [1].
|
-
- HY-N15532
-
|
|
Trk Receptor
|
Neurological Disease
|
|
Phenylmethyl 6-O-α-L-arabinofuranosyl-β-D-glucopyranoside (Compound 12) is a nerve growth factor (NGF) secretion promoter, which is found in plants of the genus Piper. Phenylmethyl 6-O-α-L-arabinofuranosyl-β-D-glucopyranoside is promising for research of neurodegenerative diseases (such as Parkinson's disease and Alzheimer's disease) and diabetic polyneuropathy [1] .
|
-
- HY-W776848
-
-
- HY-114791
-
|
|
nAChR
|
Neurological Disease
|
|
Lobelanidine is an antagonist for nicotinic acetylcholine receptor (nAChR), which inhibits α7 nAChR response and α3β2/α3β4 nAChR responses, with IC50 of 2.8 and 8.2 μM [1].
|
-
- HY-N9453S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
5α-Cholesta-7,24-dien-3β-ol-d6 is deuterium labeled 5α-Cholesta-7,24-dien-3β-ol. 5α-Cholesta-7,24-dien-3β-ol, a sterol, can be found in hamster cauda epididymal mature spermatozoa[1].
|
-
- HY-N6058
-
|
|
Parasite
|
Others
|
|
(3β)-3-[(O-β-D-Glucopyranosyl-(1→3)-O-6-deoxy-α-L-mannopyranosyl-(1→2)-α-L-arabinopyranosyl)oxy]olean-12-en-28-oic acid is a member of Oleanolic acid saponins with trematocide activity [1].
|
-
![(3β)-3-[(O-β-D-Glucopyranosyl-(1→3)-O-6-deoxy-α-L-mannopyranosyl-(1→2)-α-L-arabinopyranosyl)oxy]olean-12-en-28-oic acid](//file.medchemexpress.com/product_pic/hy-n6058.gif)
- HY-W152862S
-
|
Alpha-cyano-3-phenoxybenzyl [1R-[1Alpha(R*),3beta]]-3-(2,2-dichlorovinyl)-2,2-dimethylcyclopropanecarboxylate-d5
|
Isotope-Labeled Compounds
|
Others
|
|
Beta-cypermethrin-d5 (Alpha-cyano-3-phenoxybenzyl [1R-[1alpha(R*),3beta]]-3-(2,2-dichlorovinyl)-2,2-dimethylcyclopropanecarboxylate-d5) is deuterium labeled Beta-cypermethrin [1].
|
-
- HY-W155446
-
|
Decyl 4-O-α-D-glucopyranosyl-1-thio-β-D-glucopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
Decyl beta-d-thiomaltopyranoside (Decyl 4-O-α-D-glucopyranosyl-1-thio-β-D-glucopyranoside) is a biochemical assay reagent.
|
-
- HY-15746
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Dobutamine hydrochloride is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine hydrochloride is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine hydrochloride can increase cardiac output and correct hypoperfusion [1] .
|
-
- HY-15746A
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Dobutamine is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine can increase cardiac output and correct hypoperfusion [1] .
|
-
- HY-N11910
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Kaempferol-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside (Compound 3) is a wound healing agent with dose-dependent wound healing ability. Kaempferol-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside can be used for wound repair research [1].
|
-
![Kaempferol-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside](//file.medchemexpress.com/product_pic/hy-n11910.gif)
- HY-N1718
-
|
2,24-Dihydroxyursolic acid
|
Others
|
Others
|
|
2α,3β,24-Trihydroxyurs-12-en-28-oic acid is a natural product that can be isolated from Salvia palaestina [1].
|
-
- HY-E70299
-
|
ST3GAL5
|
TGF-beta/Smad
|
Cancer
|
|
ST3 β-Gal α-2,3-Sialyltransferase 5 (ST3GAL5) is a glycosphingolipid (GSL) biosynthetic enzyme that can inhibit TGF-β-induced epithelial-mesenchymal transition (EMT), invasion, and metastasis both in vivo and in vitro. ST3 β-Gal α-2,3-Sialyltransferase 5 can be used in cancer research [1].
|
-
- HY-W129233
-
|
Dihydroartemisinin (α,β mixture)
|
Parasite
Autophagy
Apoptosis
|
Infection
Cancer
|
|
Dihydroartemisinin (mixture of α and β isomers) is an anti-malaria and anticancer agent, as well as an active metabolite of artemisinin and its derivatives. Dihydroartemisinin exerts anticancer effects through various molecular mechanisms, such as inhibiting proliferation, inducing apoptosis, inhibiting tumor metastasis and angiogenesis, promoting immune function, inducing autophagy and endoplasmic reticulum stress [1].
|
-
- HY-139654
-
|
|
Bacterial
|
Infection
|
|
α/β-Hydrolase-IN-1 exhibits the best-in-class MICs of 50 μM (25 μg/mL) and 16 μM (8.4 μg/mL) against M. smegmatis and M. tuberculosis H37Ra, respectively.
|
-
- HY-113208AS1
-
|
11β-13,14-Dihydro-15-keto PGF2α-d4; 11-epi-13,14-Dihydro-15-keto PGF2α-d4
|
Isotope-Labeled Compounds
|
Others
|
|
11β-13,14-Dihydro-15-keto Prostaglandin F2α-d4 is is the deuterium labeled 11β-13,14-dihydro-15-keto Prostaglandin F2α.
|
-
- HY-171331
-
|
|
PD-1/PD-L1
Integrin
|
Cancer
|
|
AB-3PRGD2 is a radiotherapeutic agent targeting integrin αvβ3. AB-3PRGD2 shows improved tumor uptake and prolonged tumor retention, leading to significantly enhanced tumor growth suppression. AB-3PRGD2 can remodel the tumor immune microenvironment by upregulating PD-L1 expression and increasing tumor-infiltrating CD8 + T cells [1].
|
-
- HY-N9345
-
|
|
Others
|
Others
|
|
(2α,3β)-Olean-12-ene-2,3-diol (Compound 3) is a triterpenoid with lupane, oleanane, and ursane skeleton [1].
|
-
- HY-P2558
-
|
|
GSK-3
|
Others
|
|
GSK3 Substrate, α, β subunit is peptide substrate for glycogen synthase kinase-3 (GSK-3) and can be used to measure GSK-3 activity [1].
|
-
- HY-113105
-
|
Estriol 16-glucosiduronate
|
Endogenous Metabolite
|
Others
|
|
Estriol 16α-(β-D-glucuronide) is an endogenous metabolite present in Urine that can be used for the research of Pregnancy [1] .
|
-
- HY-15746B
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Dobutamine tartrate is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine tartrate is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine tartrate can increase cardiac output and correct hypoperfusion [1] .
|
-
- HY-N11432
-
|
|
Others
|
Others
|
|
Apigenin-6-C-β-D-xylopyranosyl-8-C-α-L-arabinopyranoside is a flavonoid with antioxidant activity. Apigenin-6-C-β-D-xylopyranosyl-8-C-α-L-arabinopyranoside can be isolated from Traditional Chinese Medicine TiepiShihu [1].
|
-
- HY-B0172A
-
|
3β-Hydroxy-5α-cholanic acid
|
Drug Derivative
|
Inflammation/Immunology
|
|
Isoallolithocholic acid (3β-Hydroxy-5α-cholanic acid), a derivative of Lithocholic acid (HY-10219), is a T cell regulator. Isoallolithocholic acid enhances regulatory T cells (Tregs) differentiation [1].
|
-
- HY-W414390
-
|
2-Cyclohexylethyl-4-O-(Alpha-D-glucopyranosyl)-beta-D-glucopyranoside, 98%
|
Biochemical Assay Reagents
|
Others
|
|
2-Cyclohexylethyl-4-O-(α-D-glucopyranosyl)-β-D-glucopyranoside, 98% (2-Cyclohexylethyl-4-O-(alpha-D-glucopyranosyl)-beta-D-glucopyranoside, 98%) is a detergent that can be used for the purification and crystallization of membrane-bound proteins in their native structure. It can self-assemble into micelles and vesicles in aqueous solution and can be used for the study of biomembrane models.
|
-
- HY-107819S
-
-
- HY-W145662
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Octadecylthioethyl 4-O-α-D-galactopyranosyl-β-D-galactopyranoside is a glycolipid receptor that can be used to study lipid regulation mechanisms [1].
|
-
- HY-P0031
-
|
|
Integrin
|
Others
|
|
Cyclo(RADfK) is a selective α(v)β(3) integrin ligand that has been extensively used for research, therapy, and diagnosis of neoangiogenesis.
|
-
- HY-148533
-
|
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
|
β2AR agonist /M-receptor antagonist-1 is a potent dual muscarinic antagonist/beta 2 agonist (MABA). β2AR agonist /M-receptor antagonist-1 potently relaxes either Carbachol (HY-B1208)-induced contraction, in the absence (MABA) or presence of Propranolol (M3; HY-B1208), or Histamine (HY-B1204)-induced contraction (β2) [1] .
|
-
- HY-116030
-
|
|
Integrin
|
Metabolic Disease
|
|
JNJ-26076713 is a potent and orally active alpha V integrin antagonist with IC50 values of 2.3 nM and 6.3 nM for alpha(V)beta(3) and alpha(V)beta(5), respectively. JNJ-26076713 inhibits retinal neovascularization [1].
|
-
- HY-70073
-
-
- HY-P1408A
-
|
|
Integrin
|
Cancer
|
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research [1].
|
-
- HY-W654264
-
|
|
Endogenous Metabolite
Integrin
|
Cardiovascular Disease
|
|
2-Methylbutyrylcarnitine (chloride) is a gut microbial metabolite which binds to integrin α2β1 in platelets, potentiating cytosolic phospholipase A2 (cPLA2) activation and platelet hyperresponsiveness. 2-Methylbutyrylcarnitine (chloride) enhances platelet hyperreactivity and thrombus formation in mice. 2-Methylbutyrylcarnitine (chloride) is a branched-chain acylcarnitine [1].
|
-
- HY-112502C
-
|
Adenosine 5'-(α,β-methylene)diphosphate triammonium
|
CD73
|
Cancer
|
|
MethADP (Adenosine 5'-(α,β-methylene)diphosphate) triammonium is a CD73 inhibitor. MethADP can be used for the research of ATP-adenosine pathway [1].
|
-
- HY-15746R
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Dobutamine (hydrochloride) (Standard) is the analytical standard of Dobutamine (hydrochloride). This product is intended for research and analytical applications. Dobutamine hydrochloride is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine hydrochloride is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine hydrochloride can increase cardiac output and correct hypoperfusion [1] .
|
-
- HY-15746S1
-
|
|
Isotope-Labeled Compounds
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
(rac)-Dobutamine-d6 (hydrochloride) is a labelled racemic Dobutamine hydrochloride. Dobutamine hydrochloride is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine hydrochloride is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine hydrochloride can increase cardiac output and correct hypoperfusion[1][2][3][4].
|
-
- HY-15746S
-
|
|
Isotope-Labeled Compounds
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
|
|
(rac)-Dobutamine-d4 (hydrochloride) is a labelled racemic Dobutamine hydrochloride. Dobutamine hydrochloride is a synthetic catecholamine that acts on α1-AR, β1-AR, β2-AR (α-1, β-1 andβ-2 adrenoceptors). Dobutamine hydrochloride is a selective β1-AR agonist, relatively weak activity at α1-AR and β2-AR. Dobutamine hydrochloride can increase cardiac output and correct hypoperfusion[1][2][3][4].
|
-
- HY-P99560
-
|
C4G1; YM-337
|
Integrin
|
Cardiovascular Disease
|
|
Tadocizumab (C4G1; YM-337) is a humanized monoclonal antibody tageting integrin αIIbβ3. Tadocizumab has antiplatelet and antithrombotic effects, and can be used for cardiovascular disease research [1] .
|
-
- HY-N5113
-
|
|
Bacterial
|
Others
|
|
6α-Chloro-5β-hydroxywithaferin A is a withanolide that can be isolated from W. somnifera. W. somnifera has antioxidant, anti-inflammatory, immunomodulatory, anticarcinogenic, antibacterial antiparkinsonism and antistress properties [1].
|
-
- HY-N5129
-
|
|
Others
|
Others
|
|
Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside] is an isoflavone triglycoside that could be isolated from Sophora japonica [1].
|
-
![Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside]](//file.medchemexpress.com/product_pic/hy-n5129.gif)
- HY-107684
-
|
3-Br-cytisine
|
nAChR
|
Neurological Disease
|
|
3-Bromocytisine (3-Br-cytisine) is a potent nACh receptors agonist, with IC50s are 0.28, 0.30 and 31.6 nM for hα4β4, hα4β2, and hα7-nACh, respectively. 3-Bromocytisine (3-Br-cytisine) shows different effects on high (HS) and low (LS) ACh sensitivity α4β2 nAChRs with EC50s are 8 and 50 nM, respectively [1] .
|
-
- HY-N3148
-
|
(3β,11α)-Olean-12-ene-3,11-diol; 11α-Hydroxy-β-amyrin
|
Others
|
Others
|
|
Olean-12-ene-3,11-diol ((3β,11α)-Olean-12-ene-3,11-diol) is a Phenols product that can be isolated from the herbs of Onychium japonicum [1].
|
-
- HY-P1613
-
|
Cyclo(RGDfV); C(RGDfV)
|
Integrin
Apoptosis
|
Cancer
|
|
Cyclo(Arg-Gly-Asp-D-Phe-Val) (Cyclo(RGDfV)) is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) can be used for the research of acute myeloid leukemia [1].
|
-
- HY-W698411
-
|
|
Biochemical Assay Reagents
|
Others
|
|
GlcNAc1-β-6GalNAc-α-PNP is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-112502D
-
|
Adenosine 5'-(α,β-methylene)diphosphate trisodium
|
CD73
|
Cancer
|
|
MethADP (Adenosine 5'-(α,β-methylene)diphosphate) trisodium is a CD73 inhibitor. MethADP trisodium can be used for the research of ATP-adenosine pathway [1].
|
-
- HY-N8163
-
|
|
Others
|
Others
|
|
Kaempferol-3-O-α-L-rhamnopyranosyl-(1→6)-β-D-glucopyranosyl-(1→2)-β-D-glucopyranoside is an antioxidant with an IC50 of 26.6 μM (DPPH assay) [1].
|
-
- HY-N1885
-
|
|
Others
|
Others
|
|
4alpha,8beta-Dihydroxyeudesm-7(11)-en-12,8-olide is a Sesquiterpenoids product that can be isolated from the herbs of Chloranthus elatior [1].
|
-
- HY-N12147
-
|
|
Others
|
Cancer
|
|
Cannogenol 3-O-β-gentiobiosyl-(1→4)-α-L-thevetoside (Compound 12) is a cardiac glycoside that can be isolated from seeds of Thevetia peruvian. Cannogenol 3-O-β-gentiobiosyl-(1→4)-α-L-thevetoside shows cytotoxicity against SW1990 and MGC-803 cells (IC50: 9.52 and 7.70 μM) [1].
|
-
- HY-P3908
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-Amyloid β-Protein (1-42) ammonium is a FITC tagged Aβ1-42 monomer peptide. Aβ1-42 plays a key role in the pathogenesis of Alzheimer’s disease [1].
|
-
- HY-164032
-
|
7α,11β-Dimethyl-17β-hydroxyestr-4-en-3-one 17-undecanoate
|
GnRH Receptor
|
Endocrinology
|
|
Dimethandrolone undecanoate (7α,11β-Dimethyl-17β-hydroxyestr-4-en-3-one 17-undecanoate) exhibits withrogens and progesterone activity. Dimethandrolone undecanoate inhibits production of gonadotropins, suppresses testosterone production, and thus inhibits sperm production. Dimethandrolone undecanoate is potent for development of male hormone contraceptives [1].
|
-
- HY-W250316
-
-
- HY-P5929
-
|
|
Integrin
FAK
|
Inflammation/Immunology
|
|
VnP-16 can promote bone formation by accelerating osteoblast differentiation and activity through direct interaction with β1 integrin followed by FAK activation [1].
|
-
- HY-P5811
-
|
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 [1].
|
-
- HY-N9453
-
|
|
Others
|
Others
|
|
5α-Cholesta-7,24-dien-3β-ol, a sterol, can be found in hamster cauda epididymal mature spermatozoa [1].
|
-
- HY-N5128
-
|
|
Others
|
Others
|
|
Apigenin6-C-α-L-arabinopyranosyl-8-C-β-D-xylopyranoside is a natural flavanone compound.
|
-
- HY-N13526
-
|
|
Others
|
Others
|
|
Neochlorogenin6-O-α-L-rhamnopyranosyl-(1→3)-β-D-quinovopyranoside is a natural product [1].
|
-
- HY-N9368
-
|
|
Others
|
Others
|
|
Luteolin-7-O-α-L-arabinopyranosyl (1→6)-β-D-glucopyranoside is a flavonoid with antiradical activity [1].
|
-
- HY-N12816
-
|
|
Others
|
Others
|
|
Glaucogenin C 3-O-α-L-cymaropyranosyl-(1→4)–β-D-digitoxopyranosyl-(1→4)-β-D-Canaropyranoside is a steroidal glycoside and can be isolated from Cynanchum stauntonii [1].
|
-
- HY-18644
-
CWHM-12
5 Publications Verification
|
Integrin
|
Cancer
|
|
CWHM-12 is a potent inhibitor of αV integrins with IC50s of 0.2, 0.8, 1.5, and 1.8 nM for αvβ8, αvβ3, αvβ6, and αvβ1.
|
-
- HY-N12031
-
|
|
Others
|
Others
|
|
Acacetin 7-O-(6′′-O-α-L-rhamnopyranosyl-β-sophoroside) is a flavonoid glycoside isolated from Valeriana jatamansi Jones [1].
|
-
- HY-P1930A
-
|
|
Integrin
|
Inflammation/Immunology
|
|
Risuteganib hydrochloride is a synthetic RGD (arginyl-glycyl-aspartic acid)-class peptide. Risuteganib hydrochloride is an anti-integrin that downregulates oxidative stress and restores homeostasis, and targets three integrin receptors that are implicated in dry age-related macular degeneration (AMD) in order to restore homeostasis in the retina [1].
|
-
- HY-P1930
-
|
|
Integrin
|
Inflammation/Immunology
|
|
Risuteganib is a synthetic RGD (arginyl-glycyl-aspartic acid)-class peptide. Risuteganib is an anti-integrin that downregulates oxidative stress and restores homeostasis, and targets three integrin receptors that are implicated in dry age-related macular degeneration (AMD) in order to restore homeostasis in the retina [1].
|
-
- HY-N13157
-
|
|
P-glycoprotein
|
Cancer
|
|
11α-O-Benzoyl-12β-O-acetyltenacigenin B is a P-glycoprotein (Pgp) inhibitor derived from Marsdenia tenacissima and belongs to the Tenacigenin B (HY-N1168) derivatives. 11α-O-Benzoyl-12β-O-acetyltenacigenin B can inhibit multidrug resistance (MDR) caused by P-glycoprotein (Pgp) overexpression in HepG2/Dox cells and holds potential for research in the field of cancer [1].
|
-
- HY-N12032
-
|
|
Others
|
Others
|
|
Acacetin 7-O-β-D-xylopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside (Compound 10), a flavone glycoside, can be isolated from extracts of the leaves of Robinia pseudoacacia [1].
|
-
![Acacetin 7-O-β-D-xylopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside](//file.medchemexpress.com/product_pic/hy-n12032.gif)
- HY-N10527
-
|
Globoisotetraose
|
Others
|
Others
|
|
Isoglobotetraose (Globoisotetraose) is the oligosaccharide moiety of human glycosphingolipids. Synthesis process: globotetraose (GalNAcβ1→3Galα1→4Galβ1→4Glc) and isoglobotetraose (GalNAcβ1→3Galα1→3Galβ1→4Glc) [1].
|
-
- HY-N3361
-
|
|
Others
|
Cancer
|
|
(3β,4α)-Lup-20(29)-ene-3,23-diol (compound 11) is a natural lupane-type triterpenes betulinic acid with anti-tumor activity [1].
|
-
- HY-N2326
-
|
|
nAChR
|
Neurological Disease
|
|
(±)-Anatoxin A fumarate is a natural alkaloid isolated from freshwater cyanobacterium.(±)-Anatoxin A fumarate is a potent nicotinic receptor agonist and exhibits Ki values of 1.25 nM and 1.84 μM for binding to putative α4β2-type nAChR and α7-type nAChR in rat brain membranes, respectively. (±)-Anatoxin A fumarate stimulates [ 3H]-dopamine release from rat striatal synaptosomes (EC50=134 nM) [1].
|
-
- HY-W008859
-
Tetrac
1 Publications Verification
Tetraiodothyroacetic acid; 3,3',5,5'-Tetraiodothyroacetic acid
|
Integrin
Endogenous Metabolite
|
Cancer
|
|
Tetrac (Tetraiodothyroacetic acid), a derivative of L-thyroxine (T4), is a thyrointegrin receptor antagonist. Tetrac blocks the actions of T4 and 3,5,3'-triiodo-L-thyronine (T3) at the cell surface receptor for thyroid hormone on integrin αvβ3. Tetra has anti-angiogenic and anti-tumor activities [1] .
|
-
- HY-P1613A
-
|
Cyclo(RGDfV) TFA; C(RGDfV) TFA
|
Integrin
Apoptosis
|
Cancer
|
|
Cyclo(Arg-Gly-Asp-D-Phe-Val) (TFA) (Cyclo(RGDfV) (TFA))is an integrin αvβ3 inhibitor. Cyclo(Arg-Gly-Asp-D-Phe-Val) (TFA) has antitumor activity. Cyclo(Arg-Gly-Asp-D-Phe-Val) (TFA) can be used for the research of acute myeloid leukemia [1].
|
-
- HY-N11901
-
|
|
Others
|
Others
|
|
Quercetin-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside can be isolated from the aerial parts of the fern Ophioglossum vulgatum L and has wound healing activity [1].
|
-
![Quercetin-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside](//file.medchemexpress.com/product_pic/hy-n11901.gif)
- HY-W127321
-
-
- HY-P0322
-
|
EMD 56574
|
Integrin
|
Cardiovascular Disease
Metabolic Disease
|
|
GRGDSPK (EMD 56574) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK (EMD 56574) is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK is used to study the role of integrins in bone formation and resorption [1] .
|
-
- HY-P1378
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use [1].
|
-
- HY-W698353
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Fuc1-α-3GlcNAc1-β-Ome is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-16702
-
|
PFT β; Cyclic Pifithrin-α
|
MDM-2/p53
|
Cancer
|
|
Pifithrin-β (PFT β) is a potent p53 inhibitor with an IC50 of 23 μM.
|
-
- HY-N12030
-
|
|
Others
|
Others
|
|
Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside (compound 8) is a flavonoid glycoside that can be obtained from black locust (Leguminosae ) isolated from leaf extract [1].
|
-
![Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside](//file.medchemexpress.com/product_pic/hy-n12030.gif)
- HY-N9734
-
|
|
Others
|
Others
|
|
3α-Cinnamoyloxy-9β,17-dihydroxy-ent-kaur-15-en-19-oic acid is a natural product [1].
|
-
- HY-113887A
-
|
11β-PGF1β
|
Drug Isomer
|
Endocrinology
|
|
11β-Prostaglandin F1β (11β-PGF1β) is a stereoisomer of PGF1α with inverted C-9 and C-11 hydroxyl groups [1].
|
-
- HY-N13158
-
|
|
Others
|
Cancer
|
|
11α-O-Acetyl-12β-O-tigloyl Tenacissoside A is a polyoxypregnane glycoside derived from Marsdenia tenacissima with anti-cancer activity [1] .
|
-
- HY-N0952
-
|
(+)-Lyoniresinol 9'-O-glucoside
|
Others
|
Others
|
|
(+)-Lyoniresinol 3α-O-β-D-glucopyranoside (Compound 1) is a natural product that can be isolated from the bark of Aegle marmelos CORREA [1].
|
-
- HY-P0322A
-
|
EMD 56574 TFA
|
Integrin
|
Cardiovascular Disease
Metabolic Disease
|
|
GRGDSPK TFA (EMD 56574 TFA) is a peptide incluing Arg-Gly-Asp (RGD). GRGDSPK TFA is an competitive and reversible inhibitory peptide for inhibiting integrin-fibronectin binding. GRGDSPK TFA is used to study the role of integrins in bone formation and resorption [1] .
|
-
- HY-129674
-
|
|
nAChR
|
Neurological Disease
|
|
PHA 568487 free base is a selective alpha 7 nicotinic acetylcholine receptor (α-7 nAchR) agonist. PHA 568487 free base reduces neuroinflammation [1] .
|
-
- HY-W698547
-
-
- HY-107671
-
|
|
nAChR
|
Neurological Disease
|
|
DMAB-anabaseine dihydrochloride is a selective nicotinic α7 receptor partial agonist and an α4β2 nAChR antagonist. DMAB-anabaseine dihydrochloride shows cognition-enhancing effects [1] .
|
-
- HY-B0942S
-
-
- HY-W399297
-
|
7α,12α-Dihydroxycholanoic acid
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Isodeoxycholic acid (7α,12α-Dihydroxycholanoic acid) is the 3β-epimer of ursodeoxycholic acid. Isodeoxycholic acid has the effect on choleresis and liver biochemistry [1].
|
-
- HY-P1378A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use [1].
|
-
- HY-130437
-
|
|
MDM-2/p53
TGF-β Receptor
Caspase
|
Infection
Metabolic Disease
|
|
p-nitro-Pifithrin-α, a cell-permeable analog of pifithrin-α, is a potent p53 inhibitor. p-nitro-Pifithrin-α suppresses p53-mediated TGF-β1 expression in HK-2 cells. p-nitro-Pifithrin-α inhibits the activation of caspase-3 by Zika virus (ZIKV) strains. p-nitro-Pifithrin-α attenuates steatosis and liver injury in mice fed a high-fat diet [4].
non-alcoholic fatty liver disease [1] .
|
-
- HY-129953B
-
|
15(R)-PGF2α
|
Endogenous Metabolite
|
Inflammation/Immunology
|
|
15(R)-Prostaglandin F2α is the isomer of 9α,11β-Prostaglandin F2α (HY-129953). 9α,11β-Prostaglandin F2α is an endogenous metabolite present in Urine that can be used for the research of Asthma [1] .
|
-
- HY-P99721
-
|
ABT-981
|
Interleukin Related
|
Inflammation/Immunology
|
|
Lutikizumab (ABT-981) is an anti-IL-1α and IL-1β dual variable domain immunoglobulin. Lutikizumab binds and inhibits IL-1α and IL-1β. Lutikizumab can be used for the research of osteoarthritis [1].
|
-
- HY-N2514
-
|
α-D-Lactose
|
Others
|
Others
|
|
α-Lactose (α-D-Lactose) is the major sugar present in milk. Lactose exists in the form of two anomers, α and β. The α form normally crystallizes as a monohydrate [1] .
|
-
- HY-E70298
-
|
ST3GAL1
|
Endogenous Metabolite
|
Cancer
|
|
ST3 β-Gal α-2,3-Sialyltransferase 1 (ST3GAL1) is a sialyltransferase whose overexpression in ovarian cancer cell lines enhances cell growth, migration, and invasion capabilities, as well as increases tumorigenicity and resistance to paclitaxel in vivo. ST3 β-Gal α-2,3-Sialyltransferase 1 catalyzes the transfer of sialic acid from cytidine monophosphate-sialic acid to galactose-containing substrates and can be utilized in studies of cancer progression and chemotherapy resistance [1].
|
-
- HY-N8894
-
|
(-)-Isolariciresinol 3α-O-β-D-glucopyranoside
|
Others
|
Others
|
|
(-)-Isolariciresinol 9'-O-glucoside ((-)-Isolariciresinol 3α-O-β-D-glucopyranoside) is a Diterpenoids product that can be isolated from From Aspergillus flavus [1].
|
-
- HY-E70110
-
|
|
Others
|
Others
|
|
Endo-1,4-β-mannanase is an important catalytic agent that randomly cleave the β-1,4-linkage in the mannan backbone and release short β-1,4-mannooligosaccharides and mannose [1].
|
-
- HY-E70052
-
|
GGTA1
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-1,3-Galactosyltransferase (a1,3GalT) (GGTA1) catalyzes the generation of the α-gal glycan via the transfer of a galactose (Gal) in α1-3 linkage, from a uridyl-diphosphate (UDP) donor onto the N-acetyllactosamine (Galβ1,4GlcNAc-R) of glycoproteins. alpha-1,3-Galactosyltransferase (a1,3GalT) is responsible for the synthesis of the α-galactose (α-Gal) epitope found in most mammalian species [1].
|
-
- HY-N13701
-
|
|
NO Synthase
|
Inflammation/Immunology
|
|
3β,7β,15α-Trihydroxy-4-(hydroxymethyl)-11,23-dioxo-lanost-8-en-26-oic acid is a triterpene compound that can be found in Ganoderma lucidum, and it inhibits nitric oxide (NO) production in BV-2 microglial cells induced by lipopolysaccharide (LPS, HY-D1056), with an IC50 of 4.15 μM [1].
|
-
- HY-106720
-
|
YM 09538
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Amosulalol (YM 09538) is an orally active and dual inhibitor of α1/β1-Adrenergic Receptor. Amosulalol exhibits antihypertensive activity via α1-Adrenergic Receptor inhibition. Amosulalol decreases reflexogenic increases in heart rate and plasma renin activity (PRA) via β1-Adrenergic Receptor inhibition in spontaneously hypertensive rats (SHR) [1].
|
-
- HY-106720A
-
|
YM 09538 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Amosulalol (YM 09538) hydrochloride is an orally active and dual inhibitor of α1/β1-Adrenergic Receptor. Amosulalol hydrochloride exhibits antihypertensive activity via α1-Adrenergic Receptor inhibition. Amosulalol hydrochloride decreases reflexogenic increases in heart rate and plasma renin activity (PRA) via β1-Adrenergic Receptor inhibition in spontaneously hypertensive rats (SHR) [1].
|
-
- HY-N9871
-
|
|
Others
|
Others
|
|
(6R,9S)-3-Oxo-α-ionol β-D-glucopyranoside is a natural product [1].
|
-
- HY-113208A
-
|
11β-13,14-Dihydro-15-keto PGF2α; 11-epi-13,14-dihydro-15-keto PGF2α
|
Endogenous Metabolite
|
Others
|
|
11β-13,14-Dihydro-15-keto Prostaglandin F2α is the deviative of 13,14-Dihydro-15-keto PGF2a (HY-113208), which is an endogenous metabolite present in Blood that can be used for the research of Pregnancy [1] .
|
-
- HY-W015546R
-
|
|
Bacterial
mGluR
PKC
|
Neurological Disease
Inflammation/Immunology
|
|
Clenbuterol (Standard) is the analytical standard of Clenbuterol. This product is intended for research and analytical applications. Clenbuterol (NAB-365) is a β2-adrenergic receptor agonist with an EC50 of 31.9 nM [1]. Clenbuterol is a very potent inhibitor of the lipopolysaccharide (LPS)-induced release of TNF-α and IL-1β. Clenbuterol can inhibit the inflammatory process. Clenbuterol is a bronchodilator .
|
-
- HY-N9529
-
|
|
Others
|
Others
|
|
Kaempferol 3-O-(2′′-O-α-rhamnosyl-6′′-O-malonyl-β-glucoside) is a flavonoid glycoside compound [1].
|
-
- HY-112023
-
|
9β,10α-Cholesta-5,7-dien-3β-ol; Cholecalciferol EP Impurity C
|
Endogenous Metabolite
|
Metabolic Disease
|
|
Lumisterol 3 (>90%) (9β,10α-Cholesta-5,7-dien-3β-ol) is a normal human secosterooid metabolite from the class of vitamin D3 photoisomer derivatives. Lumisterol 3 (>90%) is used in the preparation of vitamin D [1].
|
-
- HY-P1051
-
|
Amyloid β-Protein (12-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (Amyloid β-Protein (12-28)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) shows aggregation properties. β-Amyloid (12-28) has the potential for Alzheimer’s disease research [1].
|
-
- HY-N3821
-
|
|
Others
|
Others
|
|
ent-7α,9-Dihydroxy-15-oxokaur-16-en-19,6β-olide is a Diterpenoids product that can be isolated from the rhizomes of Isodon yuennanensis [1].
|
-
- HY-P5810
-
|
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively [1].
|
-
- HY-N0175
-
|
Cytisine; Sophorine; Baptitoxine
|
nAChR
|
Metabolic Disease
Cancer
|
|
Cytisinicline (Cytisine) is an alkaloid. Cytisinicline (Cytisine) is a partial agonist of α4β2 nAChRs [1], and partial to full agonist at β4 containing receptors and α7 receptors . Has been used medically to help with smoking cessation .
|
-
- HY-N12436
-
|
|
Aurora Kinase
|
Cancer
|
|
11α-O-Tigloyl-12β-O-acetyltenacigenin B is an ester derivative of Tenacigenin B (HY-N1168), which is isolated from Garcinia cambogia (MTC). Tenacigenin B modulates the antitumor effects of Aurora-A in lymphoma.
|
-
- HY-W018512
-
|
3α-Hydroxy-7-oxo-5β-cholanic acid
|
Endogenous Metabolite
|
Metabolic Disease
|
|
7-Ketolithocholic acid (3α-Hydroxy-7-oxo-5β-cholanic acid), a bile acid, can be absorbed and suppresses endogenous bile acid production and biliary cholesterol secretion [1] .
|
-
- HY-123489S
-
|
THDOC-d3
|
GABA Receptor
|
Neurological Disease
|
|
3α,21-Dihydroxy-5α-pregnan-20-one-d3 is the deuterium labeled 3α,21-Dihydroxy-5α-pregnan-20-one. 3α,21-Dihydroxy-5α-pregnan-20-one (THDOC), an endogenous neurosteroid, is a positive modulator of GABAA receptors. 3α,21-Dihydroxy-5α-pregnan-20-one potentiates neuronal response to low concentrations of GABA at α4β1δ GABAA receptors in vitro.
|
-
- HY-W145701
-
|
4-O-methylglucuronoxylan
|
Biochemical Assay Reagents
|
Others
|
|
4-O-Methyl-α-D-glucurono-β-D-xylan is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-N5112B
-
|
Isoarnebin I
|
HIF/HIF Prolyl-Hydroxylase
Apoptosis
Notch
NO Synthase
Bcl-2 Family
|
Cancer
|
|
β,β-Dimethylacrylshikonin (Isoarnebin I) is a naphthoquinone derivative that can be isolated from Lithospermum erythrorhizon Sieb. et Zucc. β,β-Dimethylacrylshikonin promotes angiogenesis by inducing eNOS, VEGF and HIF-1α expression through the PI3K-dependent pathway. β,β-Dimethylacrylshikonin inhibits Notch-1 activation. β,β-Dimethylacrylshikonin inhibtis tumor cell proliferation, induces tumor cell apoptosis, and inhibits tumor growth [1] .
|
-
- HY-106720C
-
|
(+)-YM 09538
|
Adrenergic Receptor
|
Others
|
|
(+)-Amosulalol ((+)-YM 09538) is an isomer of Amosulalol (HY-106720), an orally active dual inhibitor of α1/β1-adrenergic receptors. Amosulalol exhibits antihypertensive activity by inhibiting α1-adrenergic receptors. Amosulalol reduces the reflex increase in heart rate and plasma renin activity (PRA) in spontaneously hypertensive rats (SHR) by inhibiting β1-adrenergic receptors.
|
-
- HY-106720B
-
|
(-)-YM 09538
|
Adrenergic Receptor
|
Others
|
|
(-)-Amosulalol ((-)-YM 09538) is an isomer of Amosulalol (HY-106720), an orally active dual inhibitor of α1/β1-adrenergic receptors. Amosulalol exhibits antihypertensive activity by inhibiting α1-adrenergic receptors. Amosulalol reduces the reflex increase in heart rate and plasma renin activity (PRA) in spontaneously hypertensive rats (SHR) by inhibiting β1-adrenergic receptors.
|
-
- HY-N11983
-
|
|
Others
|
Others
|
|
(25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside (compound 1) is a steroidal saponin , can be isolated from the roots of Ophiopogon japonicus [1].
|
-
![(25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside](//file.medchemexpress.com/product_pic/hy-n11983.gif)
- HY-N2174
-
|
|
Others
|
Cardiovascular Disease
|
|
Ophiogenin 3-O-α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside, a terpenoid glycoside from Ophiopogon japonicus roots, has good pharmacological effects on the cardiovascular system [1].
|
-
- HY-113887
-
-
- HY-116701
-
|
|
Thyroid Hormone Receptor
|
Others
|
|
A 274 is an amiodarone analogue that has the activity of inhibiting the binding of T3 to α1- and β1-thyroid hormone receptors in vitro. Its IC50 values for inhibition of α1-T3R and β1-T3R are certain values (depending on the specific experimental results).
|
-
- HY-D1510
-
|
|
Biochemical Assay Reagents
|
Others
|
|
4-Nitrophenyl 2-O-(β-L-Fucopyranosyl)-β-D-Galactopyranoside is a synthetic chromogenic substrate and can be used in the assay of α-fucosidases which hydrolyze the glycosidic linkage Fuc α1-2Gal. The assay is based on the sequential action of α-fucosidase and an exogenously added exo-β-d-galactosidase to release the easily measurable p-nitrophenol moiety [1].
|
-
- HY-N10947
-
|
|
Others
|
Others
|
|
Lanosta-7,9(11),24-trien-3β,15α-dihydrcxy-26-oic acid (compound 2) is a nature product that could be isolated from the Chinese medicinal fungus Ganoderma lucidurn [1].
|
-
- HY-12152
-
|
NSC 216666
|
nAChR
|
Neurological Disease
Inflammation/Immunology
|
|
PNU-120596 (NSC 216666) is a potent and selective α7 nAChR positive allosteric modulator (PMA) with an EC50 of 216 nM. PNU-120596 is inactive against α4β2, α3β4, and α9α10 nAChRs. PNU-120596 has the potential for psychiatric and neurological disorders research [1].
|
-
- HY-14126
-
|
|
Integrin
|
Inflammation/Immunology
|
|
BIO-1211 is a highly selective and orally active α4β1 (VLA-4) inhibitor, with IC50 values of 4 nM and 2 μM for α4β1 and α4β7, respectively [1] .
|
-
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models [1] .
|
-
- HY-110160
-
|
ABT-089 dihydrochloride
|
nAChR
|
Neurological Disease
|
|
Pozanicline dihydrochloride (ABT-089 dihydrochloride) is an orally bioavailable nicotinic acetylcholine receptor (nAChR) agonist with a Ki of 16.7 nM for binding to [ 3H]cytisine sites [1]. Pozanicline is an α4β2-selective nAChR agonist, which binds to rat brain α4β2 nAChR with a Ki of 17 nM while binding to α7 nAChR is insignificant .
|
-
- HY-B0942R
-
|
|
nAChR
Bacterial
|
Neurological Disease
|
|
Benzethonium (chloride) (Standard) is the analytical standard of Benzethonium (chloride). This product is intended for research and analytical applications. Benzethonium chloride inhibits nicotinic acetylcholine receptors in human recombinant α7 and α4β2 neurons in Xenopus laevis oocytes.
|
-
- HY-163748
-
|
|
GSK-3
|
Inflammation/Immunology
|
|
GSK-3β inhibitor 17 (compound 5 n) is a potent GSK-3β inhibitor. GSK-3β inhibitor 17 decreases cisplatin (HY-17394) induced p-p65, KIM-1 protein and mRNA expression. GSK-3β inhibitor 17 decreases cisplatin induced TNF-α, IL-1β, IL-6 and MCP-1 mRNA expression. GSK-3β inhibitor 17 shows anti-inflammation effect and has the potential for the research of acute kidney injury [1].
|
-
- HY-N9439
-
|
|
Endogenous Metabolite
|
Others
|
|
6-O-β-D-Galactopyranosyl-D-galactose, a disaccharide, is a part of the polysaccharide main chain with β-(1→6)-glycoside bonds with a side chain bonded to the main one by the β-(1→3) bond [1].
|
-
- HY-B0172AS1
-
|
3β-Hydroxy-5α-cholanic acid-d4
|
Isotope-Labeled Compounds
Others
|
Inflammation/Immunology
|
|
Isoallolithocholic acid-d4 (3β-Hydroxy-5α-cholanic acid-d4) is deuterium labeled Isoallolithocholic acid. Isoallolithocholic acid (3β-Hydroxy-5α-cholanic acid), a derivative of Lithocholic acid (HY-10219), is a T cell regulator. Isoallolithocholic acid enhances regulatory T cells (Tregs) differentiation [1] .
|
-
- HY-P1051A
-
|
Amyloid β-Protein (12-28) (TFA); Amyloid beta-Peptide (12-28) (human) TFA; β-Amyloid protein fragment(12-28) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (TFA) (Amyloid β-Protein (12-28) (TFA)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) (TFA) shows aggregation properties. β-Amyloid (12-28) (TFA) has the potential for Alzheimer’s disease research [1].
|
-
- HY-B0172AR
-
|
3β-Hydroxy-5α-cholanic acid (Standard)
|
Drug Derivative
|
Inflammation/Immunology
|
|
Isoallolithocholic acid (Standard) is the analytical standard of Isoallolithocholic acid. This product is intended for research and analytical applications. Isoallolithocholic acid (3β-Hydroxy-5α-cholanic acid), a derivative of Lithocholic acid (HY-10219), is a T cell regulator. Isoallolithocholic acid enhances regulatory T cells (Tregs) differentiation[1].
|
-
- HY-P4886
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the amyloid template block in Alzheimer's disease. pEAβ(3-42) accelerated the aggregation of Aβ(1-42), while Aβ(1-42) significantly slowed the primary and secondary nucleation of pEAβ(3-42) [1].
|
-
- HY-N2332A
-
|
MLA
|
nAChR
|
Neurological Disease
|
|
Methyllycaconitine citrate is a specific antagonist of α7 neuronal nicotinic acetylcholine receptor (α7nAChR) with blood-brain barrier permeability.
|
-
- HY-N13070
-
|
|
Others
|
Metabolic Disease
|
|
3β-Acetoxy-5α-lanosta-8,24-dien-21-oic acid (compound 89) can be isolated from the secretions of the fungus Poria cocos (Schw.) [1].
|
-
- HY-N10885
-
|
|
Others
|
Others
|
|
α,β-Dihydro-4,6-dihydroxy-2-methoxy-3-methylchalcone (compound 7) is a nature product that could be isolated from dragons blood of Daemonorops draco [1].
|
-
- HY-N13687
-
|
|
Others
|
Others
|
|
24,24-Dimethyl-5α-lanosta-9(11),25-dien-3β-ol is a natural product [1].
|
-
- HY-N8423
-
|
|
ERK
GSK-3
|
Neurological Disease
Metabolic Disease
|
|
α-Amyrin is a pentacyclic triterpenoid compound with oral activity. α-Amyrin activates the ERK and GSK-3β signaling pathways. α-Amyrin can be used in the study of metabolic syndrome induced by high fructose diet and cognitive dysfunction caused by low cholinergic neurotransmission [1] .
|
-
- HY-13225D
-
|
RJR-2403 fumarate; (E)-Metanicotine fumarate
|
nAChR
|
Neurological Disease
|
|
Rivanicline fumarate is a neuronal nicotinic receptor (neuronal nicotinic receptor) agonist that is highly selective for the α4β2 subtype,Ki is 26 nM, which is more than 1000 times more inhibitory than α7 receptor [1].
|
-
- HY-107201
-
|
betadex
|
Influenza Virus
|
Infection
|
|
β-Cyclodextrin is a cyclic polysaccharide composed of seven units of glucose (α-D-glucopyranose) linked by α-(1,4) type bonds. β-Cyclodextrin has often been used to enhance the solubility of agents. β-Cyclodextrin has anti-influenza virus H1N1 activities.
|
-
- HY-P1740
-
|
|
Integrin
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
RGD peptide (GRGDNP) is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) plays an important role in cell adhesion, migration, growth, and differentiation [1] .
|
-
- HY-16702A
-
|
PFT β hydrobromide; Cyclic Pifithrin-α hydrobromide
|
MDM-2/p53
Ferroptosis
|
Cancer
|
|
Pifithrin-β hydrobromide (PFT β hydrobromide) is a potent p53 inhibitor with an IC50 of 23 μM.
|
-
- HY-N9522
-
|
|
Endogenous Metabolite
|
Others
|
|
β-D-glucopyranosyl-[α-L-rhamnopyranosyl-(1→3)-βD-glucuronopyranosyl-(1→3)]-3β-hydroxyolean-12-ene28-oate, as a saponin, has a glucuronic acid attached to carbon C-3 and is isolated from S. simplex [1].
|
-
![β-D-glucopyranosyl-[α-L-rhamnopyranosyl-(1→3)-βD-glucuronopyranosyl-(1→3)]-3β-hydroxyolean-12-ene28-oate](//file.medchemexpress.com/product_pic/hy-n9522.gif)
- HY-P2549
-
-
- HY-P4886A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) TFA is a precursor of Pyr peptide. Pyroglutamic acid-modified Aβ (pEAβ) (3-42) is the core of the amyloid plaque in Alzheimer's disease. pEAβ (3-42) accelerates the aggregation of Aβ(1-42), while Aβ(1-42) significantly slows down the primary and secondary nucleation of pEAβ(3-42).
|
-
- HY-10063
-
|
TC-1734; ACD3480
|
nAChR
|
Neurological Disease
|
|
Ispronicline (TC-1734), an orally active, brain-selective α4β2 nicotine acetylcholine receptor (nAChR) partial agonist, has shown memory-enhancing properties in rodents and a good tolerability profile. Ispronicline binds to the α4β2 nAChR with high affinity (Ki=11 nM) and is highly selective to other nAChRs such as α7 nAChR and α3β4 nAChR [1] .
|
-
- HY-151427
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
TGFβ1-IN-1 (compound 42) is a potent, orally active TGF-β1 inhibitor. TGFβ1-IN-1 inhibits the upregulation of TGF-β1-induced fibrosis markers (α-SMA and fibronectin) and can be used in liver fibrosis disease studies [1].
|
-
- HY-P3860
-
-
- HY-P5053
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Integrin
|
Cancer
|
|
Galacto-RGD is an RGD analogue that can be coupled with the radioactive isotope 18F and used as an integrin α?β? selective tracer [1]. Galacto-RGD can be used for the synthesis/research of Radionuclide-Drug Conjugates (RDCs).
|
-
- HY-W087904
-
|
α-D-Lactose hydrate
|
Endogenous Metabolite
|
Others
|
|
α-Lactose (hydrate) (α-D-Lactose (hydrate)) is the principal carbohydrate in the milk of most mammals. α-Lactose (hydrate) consists of glucose and galactose and exists in the form of two anomers, α and β. α-Lactose (hydrate) has many uses in the food and pharmaceutical industries, such as a free-flowing or agglomerating agent, a diluent for pigments, flavors, or enzymes [1] .
|
-
- HY-N8423R
-
|
|
ERK
GSK-3
|
Neurological Disease
Metabolic Disease
|
|
α-Amyrin (Standard) is the analytical standard of α-Amyrin. This product is intended for research and analytical applications. α-Amyrin is a pentacyclic triterpenoid compound with oral activity. α-Amyrin activates the ERK and GSK-3β signaling pathways. α-Amyrin can be used in the study of metabolic syndrome induced by high fructose diet and cognitive dysfunction caused by low cholinergic neurotransmission [1] .
|
-
- HY-P10038
-
|
Myr-FEEERA-OH
|
Integrin
|
Infection
|
|
mP6 (Myr-FEEERA-OH) is a myristoylated peptide. mP6 inhibits the interaction of Gα13 with integrin β3 without disrupting talin-dependent integrin function. mP6 can block the GTP usage of Rac1, Rap1, and Rab7, effectively inhibiting the infection of CHO-A24 cells [1].
|
-
- HY-108693
-
-
- HY-146626S
-
|
|
Isotope-Labeled Compounds
|
Cancer
|
|
1,3,5(10)-Estratriene-17α-ethyl-3,17β-diol 3-methyl ether-d5 is the deuterium labeled 1,3,5(10)-Estratriene-17α-ethyl-3,17β-diol 3-methyl ether[1].
|
-
- HY-115766
-
|
|
nAChR
|
Neurological Disease
|
|
Anabaseine is a non-selective nicotinic agonist. Anabaseine stimulates all AChRs, preferentially stimulates skeletal muscle and brain α7 subtypes [1] . Anabaseine is also a weak partial agonist at α4β2 nAChRs .
|
-
- HY-P3688
-
|
Aβ (1-38); Aβ38
|
Amyloid-β
|
Others
|
|
β-Amyloid (1-38) (Aβ (1-38); Aβ38) is aAβ Fragment.
|
-
- HY-N5051
-
|
|
Others
|
Inflammation/Immunology
|
|
25(S)-Ruscogenin-1-O-α-L-rhamnopyranosyl (1→2)-β-D-xylopyranoside shows inhibitory activity of neutrophil respiratory burst stimulated by PMA(phorbol myristate acetate) [1].
|
-
- HY-W145561
-
|
Neu5Ac Alpha(2-3)Gal beta MP glycoside
|
Biochemical Assay Reagents
|
Others
|
|
Neu5Acα(2-3)Galβ MP Glycoside is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-123495
-
-
- HY-135386
-
-
- HY-114850
-
-
- HY-W699613
-
|
|
Biochemical Assay Reagents
|
Others
|
|
α-D-Galactopyranoside, β-D-fructofuranosyl, 6-acetate is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-P5370
-
|
|
Amyloid-β
|
Others
|
|
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
|
-
- HY-120358
-
-
- HY-N6575
-
-
- HY-E70136
-
|
|
Others
|
Metabolic Disease
|
|
Endo-β-Galactosidase catalyzes the hydrolysis of internal β1-4 galactose linkages in unbranched, repeating poly-N-acetyllactosamine ([GlcNAc- (1-3)Gal- (1-4)]n) structures [1].
|
-
- HY-N7682
-
|
|
Fungal
|
Others
|
|
β-Tomatine is a breakdown product of α-tomatine and a less fungitoxic compound. β-Tomatine can suppress plant defense responses [1].
|
-
- HY-148301
-
-
- HY-125135
-
|
β-Peltatin
|
Drug Isomer
|
Cancer
|
|
(-)-β-Peltatin is an organic heterotetracyclic compound with antitumor activity and phytometabolite effects that are functionally related to α-peltatin [1].
|
-
- HY-12150
-
CCMI
1 Publications Verification
AVL-3288; UCI-4083
|
nAChR
|
Neurological Disease
|
|
CCMI (AVL-3288) is a potent and selective α7 nAChR-positive allosteric modulator, does not bind to or activate α7 nAChRs via the orthosteric site, and causes significant positive modulation of agonist-induced currents at α7 nAChRs. CCMI has potential in CNS diseases with cognitive dysfunction [1].
|
-
- HY-P1787
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (4-10) is an epitope for the polyclonal anti-Aβ(1-42) antibody, reduces amyloid deposition in a transgenic Alzheimer disease mouse model [1].
|
-
- HY-163471
-
|
|
PDGFR
VEGFR
|
Cancer
|
|
PDGFRα/β/VEGFR-2-IN-1 (6f), a multiple PDGFRα/ and VEGFR-2 tyrosine kinase inhibitor, particularly targets PDGFRα, PDGFRβ, and VEGFR-2 kinases with Nano molar concentrations [1].
|
-
- HY-106416
-
-
- HY-P1740A
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
RGD peptide (GRGDNP) TFA is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) TFA competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) TFA promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) TFA plays an important role in cell adhesion, migration, growth, and differentiation [1] .
|
-
- HY-16708A
-
|
|
AMPK
|
Metabolic Disease
|
|
ZLN024 hydrochloride is an AMPK allosteric activator. ZLN024 directly activates recombinant AMPK α1β1γ1, AMPK α2β1γ1, AMPK α1β2γ1 and AMPK α2β2γ1 heterotrimer with EC50s of 0.42 µM, 0.95 µM, 1.1 µM and 0.13 µM, respectively.
|
-
- HY-16708
-
|
|
AMPK
|
Metabolic Disease
|
|
ZLN024 is an AMPK allosteric activator. ZLN024 directly activates recombinant AMPK α1β1γ1, AMPK α2β1γ1, AMPK α1β2γ1 and AMPK α2β2γ1 heterotrimer with EC50s of 0.42 µM, 0.95 µM, 1.1 µM and 0.13 µM, respectively.
|
-
- HY-149282
-
-
- HY-149281
-
-
- HY-W145553
-
|
|
Biochemical Assay Reagents
|
Others
|
|
GalNAcβ(1-3)GlcNAc-β-pNP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-E70064
-
|
|
Endogenous Metabolite
|
Others
|
|
alpha-1,3-Fucosyltransferase (α1,3FucT) catalyzes the transfer of L-fucose moiety from guanosine diphosphate-beta-L-fucose (GDP-Fuc) to acceptor sugars. alpha-1,3-Fucosyltransferase (α1,3FucT) is often used in biochemical studies, and it can be used to form fucoglycoconjugates [1].
|
-
- HY-P2858
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β-Mannosidase is a lysosomal enzyme from the glycosyl hydrolase family 2 that cleaves the single β(1-4)-linked mannose at the nonreducing end of N-glycosylated proteins, and plays an important role in the polysaccharide degradation pathway [1].
|
-
- HY-165104
-
|
GuCGp; Gulopyranosyl-(β1-1)-caldarchaetidylglycerol
|
Bacterial
|
Others
|
|
β-L-Gulopyranosyl-caldarchaetidyl-glycerol (GuCGp) is a compound that is studied in the polar lipid composition of thermoacidophilic bacteria. Its content varies under different culture conditions, which may be related to the adaptation of bacteria to the environment.
|
-
- HY-N0175R
-
|
|
nAChR
|
Metabolic Disease
Cancer
|
|
Cytisinicline (Standard) is the analytical standard of Cytisinicline. This product is intended for research and analytical applications. Cytisinicline (Cytisine) is an alkaloid. Cytisinicline (Cytisine) is a partial agonist of α4β2 nAChRs [1], and partial to full agonist at β4 containing receptors and α7 receptors . Has been used medically to help with smoking cessation .
|
-
- HY-121573
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
|
α-Acetyldigoxin can be used in heart failure related research and is orally available. The bioavailability of α-Acetyldigoxin is lower than that of β-Acetyldigoxin when administered orally and intravenously [1].
|
-
- HY-114522
-
-
- HY-133011
-
|
|
nAChR
|
Neurological Disease
|
|
nAChR agonist 1 is a potent, brain-permeable, and orally efficacious positive allosteric modulator of α7 nicotinic acetylcholine receptor (α7 nAChR). nAChR agonist 1 has the EC50 of 0.32 µM in a Ca 2+ mobilization assay (PNU-282987-induced, FLIPR based) in human IMR-32 neuroblastoma cells that endogenously express α7 nAChR. nAChR agonist 1 can be develpoped for the treatment of Alzheimer’s disease [1].
|
-
- HY-13225A
-
|
RJR-2403; (E)-Metanicotine
|
nAChR
|
Neurological Disease
|
|
Rivanicline (RJR-2403; (E)-Metanicotine) is a neuronal nicotinic receptor (neuronal nicotinic receptor) agonist that is highly selective for the α4β2 subtype,Ki is 26 nM, which is more than 1000 times more inhibitory than α7 receptor [1].
|
-
- HY-160266
-
-
- HY-112769
-
EX229
5 Publications Verification
|
AMPK
|
Metabolic Disease
|
|
EX229, a Benzimidazole derivative, is a potent and allosteric activator of AMP-activated protein kinase (AMPK), with Kds of 0.06 μM, 0.06 μM and 0.51 μM for α1β1γ1, α2β1γ1 and α1β2γ1 in biolayer interferometry, respectively.
|
-
- HY-107670
-
|
DHβE hydrobromide
|
nAChR
|
Neurological Disease
|
|
Dihydro-β-erythroidine (DHβE) hydrobromide is a potent, orally active, and competitive antagonist of neuronal nAChRs. Dihydro-β-erythroidine hydrobromide shows selectivity for α4β4 and α4β2 nAChRs, with IC50s of 0.19 and 0.37 μM, respectively. Antidepressant-like activities [1] .
|
-
- HY-147038
-
|
|
AMPK
|
Metabolic Disease
|
|
AMPK activator 8 (compound 2) is an AMP-activated protein kinase (AMPK) activator with EC50s of 11, 27, 4, 2, and 4 nM for rAMPK α1β1γ1, rAMPK α2β1γ1, rAMPK α1β2γ1, rAMPK α2β2γ1, rAMPK α2β2γ3, respectively. AMPK activator 8 can be used for the research of type 2 diabetes [1].
|
-
- HY-12560D
-
|
|
nAChR
|
Others
|
|
PNU-282987 S enantiomer free base is the S-enantiomer of PNU-282987 free base. PNU-282987 is an α7 nicotinic acetylcholine receptor (α7 nAChR) agonist.
|
-
- HY-107683
-
|
|
nAChR
|
Neurological Disease
|
|
LY-2087101 is an allosteric potentiator of α7 nAChRs. LY-2087101 causes potentiation of agonist-evoked α7 responses by binding within the nAChR transmembrane region [1].
|
-
- HY-P10628
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β Amyloid (1-14), human is a peptide fragment of β-amyloid protein (Aβ), which is obtained by hydrolysis of Aβ1-40 peptide by catalytic antibody light chain #7TR. β Amyloid (1-14), human can be used for Alzheimer's disease research [1].
|
-
- HY-149542
-
|
|
Tau Protein
Apoptosis
GSK-3
|
Neurological Disease
|
|
GSK-3β inhibitor 15 (Compound 54) is a GSK-3β inhibitor (IC50: 3.4 nM). GSK-3β inhibitor 15 inhibits Aβ1-42-induced GSK-3β and tau protein phosphorylation. GSK-3β inhibitor 15 inhibits LPS-induced iNOS expression. GSK-3β inhibitor 15 has neuroprotective effects on Aβ1-42-induced neurotoxicity. GSK-3β inhibitor 15 can be used for research of Alzheimer’s disease (AD) [1].
|
-
- HY-108693R
-
|
|
Leukotriene Receptor
|
Inflammation/Immunology
|
|
β-Tocotrienol (Standard) is the analytical standard of β-Tocotrienol. This product is intended for research and analytical applications. β-Tocotrienol is one form of vitamin E. β-Tocotrienol is a less potent antioxidant than α-tocotrienol [1].
|
-
- HY-E70116
-
|
Glycogen α-1,6-glucanohydrolase
|
Glycosidase
|
Others
|
|
Isoamylase (Glycogen α-1,6-glucanohydrolase) catalyzes the hydrolysis of α-1,6-glycosidic linkages in glycogen, amylopectin and α/β-limit dextrins [1].
|
-
- HY-148925
-
|
|
Glycosidase
|
Inflammation/Immunology
|
|
α-Amyrenone is a triterpenoid that occurs naturally in very low concentrations in several oleoresins from Brazilian Amazon species of Protium (Burseraceae). The mixture of α and β-amyrenone inhibits α-glucosidase, and can reduce mechanical hypersensitivity and paw-oedema induced by carrageenan [1].
|
-
- HY-W794315
-
|
|
Biochemical Assay Reagents
|
Others
|
|
α-D-Glucopyranosiduronic acid,β-D-arabino-2-hexulofuranosonosyld is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-123349
-
|
|
Drug Metabolite
|
Cardiovascular Disease
|
|
5α-Hydroxy-6-keto cholesterol is major metabolite of β-epoxide (5α,6β-epoxycholesterol) during direct exposure of intact cultured human bronchial epithelial cells (16-HBE) to ozone. 5α-Hydroxy-6-keto cholesterol inhibits cholesterol synthesis with an IC50 of 350 nM [1].
|
-
- HY-113068
-
|
|
Tyrosinase
|
Metabolic Disease
|
|
(rel)-β-Tocopherol is a relative configuration of β-Tocopherol.(±)-β-Tocopherol is a lipid-soluble form of vitamin E with antioxidant activity. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol also can prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol [1].
|
-
- HY-19012
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
N-1518 is an α and β adrenergic receptor blocker that has competitive antagonism against β1 and α1 receptors, but does not show selectivity for β1 receptors, but shows about 20-fold selectivity for α1 receptors. N-1518 has vasodilatory effects and can be used in the research field of hypertension treatment [1].
|
-
- HY-12151
-
|
NSC 213859
|
nAChR
|
Neurological Disease
|
|
NS 1738 (NSC 213859) is a novel positive allosteric modulator of the α7 nAChR, with respect to positive modulation of α7 nAChR (EC50=3.4 μM in oocyte experiments).
|
-
- HY-B0445B
-
|
α-Nicotinamide Adenine Dinucleotide
|
Others
|
Others
|
|
α-NAD (α-Nicotinamide Adenine Dinucleotide) serves as a substrate for renalase and functions as an analog of β-NAD, influencing the kinetics of NAD-dependent enzymes, while also playing a crucial role as a cofactor in mitochondrial oxidation-reduction reactions.
|
-
- HY-N1760
-
|
|
Others
|
Others
|
|
3β, 19α-Dihydroxy-6-oxo-urs-12-en-23-al-28-oic acid (compound 1) is a triterpene that can be isolated from Uncaria [1].
|
-
- HY-103528
-
|
Salicylidene salicylhydrazide
|
GABA Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
SCS (Salicylidene salicylhydrazide) is a potent, allosteric and selective inhibitor of β1-containing GABAA receptors with an IC50 of 32 nM against α2β1γ1θ by VIPR measurement. SCS is also a chelator of metal ions [1].
|
-
- HY-N2925
-
|
β-Amyron
|
Fungal
COX
PPAR
|
Infection
Metabolic Disease
Inflammation/Immunology
|
|
β-Amyrone (β-Amyron) is a triterpene compound which has anti-inflammatory activity through inhibiting the expression of COX-2. β-Amyrone has antifungal activity , as well as antiviral activity against Chikungunya virus. β-Amyrone also inhibits α-glucosidase and acetylcholinesterase (AChE) activity. β-Amyrone can be used in the research of disease like inflammation, infection, and obesity [1] .
|
-
- HY-127010
-
-
- HY-107668A
-
|
|
nAChR
|
Neurological Disease
|
|
TC-1698 is a selective α7 nicotinic acetylcholine receptors agonist with EC50 value of 0.16 μM and 0.46 μM for monkey α7 nicotinic receptor and human α7 nicotinic receptor, respectively. TC-1698 improves memory and has neuroprotective effects. TC-1698 can be used for Alzheimer's disease research [1].
|
-
- HY-107668
-
|
|
nAChR
|
Neurological Disease
|
|
TC-1698 dihydrochloride is a selective α7 nicotinic acetylcholine receptors agonist with EC50 value of 0.16 μM and 0.46 μM for monkey α7 nicotinic receptor and human α7 nicotinic receptor, respectively. TC-1698 dihydrochloride improves memory and has neuroprotective effects. TC-1698 dihydrochloride can be used for Alzheimer's disease research [1].
|
-
- HY-14571
-
E7820
4 Publications Verification
ER68203-00
|
Molecular Glues
Integrin
|
Cancer
|
|
E7820 (ER68203-00), an orally active aromatic sulfonamide derivative, is a unique angiogenesis inhibitor suppressing an expression of integrin alpha2 subunit on endothelium. E7820 inhibits rat aorta angiogenesis with an IC50 of 0.11 μg/ml. E7820 modulates α-1, α-2, α-3, and α-5 integrin mRNA expression. Antiangiogenic and antitumor activity [1] .
|
-
- HY-145751
-
|
7α-Hydroxydehydroepiandrosterone; 3β,7α-Dihydroxy-Δ5-androsten-17-one
|
Cytochrome P450
Mitochondrial Metabolism
|
Metabolic Disease
Cancer
|
|
7α-Hydroxy-DHEA (7α-Hydroxydehydroepiandrosterone) is a 7α-hydroxylated metabolite of DHEA (HY-14650), catalyzed by intracellular steroid 7α-hydroxylases such as P450 2A1. 7α-Hydroxy-DHEA exhibits biological activity comparable to DHEA but does not convert into compounds with androgenic or estrogenic activity. It induces the activity of thermogenic enzymes such as mitochondrial sn-glycerol-3-phosphate dehydrogenase and cytosolic malic enzyme, enhancing heat production and reducing food utilization efficiency. As a more efficient and safer metabolite compared to DHEA, 7α-Hydroxy-DHEA holds potential for studies in the fields of obesity, metabolic diseases, and adrenal carcinoma [1].
|
-
- HY-P2551
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Biotin-β-Amyloid (17-40) is a N-terminal-labelled biotinylated amyloid-β(1-40) peptide. β-Amyloid (17-40) is a 24-residue fragment of the Aβ protein via post-translational processing of amyloid precursor protein (APP) [1].
|
-
- HY-W020795
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Hexadecyl β-D-maltoside is the anomer of Hexadecyl α-d-maltoside. Hexadecyl β-D-maltoside is different from Hexadecyl α-d-maltoside, showing non-Newtonian behavior, including thixotropic behavior, shear-thinning, and viscoelastic behavior [1].
|
-
- HY-13225B
-
|
RJR-2403 hemioxalate; (E)-Metanicotine hemioxalate
|
nAChR
|
Neurological Disease
|
|
Rivanicline hemioxalate (RJR-2403 hemioxalate; (E)-Metanicotine hemioxalate) is a neuronal nicotinic receptor agonist, showing high selectivity for the α4β2 subtype (Ki=26 nM); > 1,000 fold selectivity than α7 receptors(Ki= 3.6 μM).
|
-
- HY-13225
-
|
RJR-2403 oxalate; (E)-Metanicotine oxalate
|
nAChR
|
Neurological Disease
|
|
Rivanicline oxalate (RJR-2403 oxalate; (E)-Metanicotine oxalate) is a neuronal nicotinic receptor agonist, showing high selectivity for the α4β2 subtype (Ki=26 nM); > 1,000 fold selectivity than α7 receptors(Ki= 3.6 μM).
|
-
- HY-136736
-
|
|
Beta-secretase
|
Neurological Disease
|
|
β-Secretase Inhibitor II is a β-Secretase inhibitor. β-Secretase Inhibitor II is a simple tripeptide aldehyde (IC50=700 nM for inhibition of total Aβ and IC50=2.5 μM for Aβ1–42). β-Secretase Inhibitor II can be used for the research of Alzheimer's disease [1].
|
-
- HY-N9587
-
|
|
Apoptosis
|
Neurological Disease
|
|
Tricin 7-O-β-D-glucopyranoside is a potent and orally active neuroprotective agent. Tricin 7-O-β-D-glucopyranoside induces Apoptosis. Tricin 7-O-β-D-glucopyranoside decreases the expression of TNF-α induced phosphor-κB-α, phosphor-NF-κB, HMGB1 [1].
|
-
- HY-149054
-
|
|
GSK-3
Tau Protein
AAK1
Pim
PKC
|
Neurological Disease
|
|
GSK-3β inhibitor 13 (compound 47) is an orally active and potent GSK-3β inhibitor with blood-brain permeability. GSK-3β inhibitor 13 inhibits GSK-3β and GSK-3α with IC50s of 0.73 nM and 0.35 nM, respectively. GSK-3β inhibitor 13 significantly decreases the phosphorylation of tau (IC50=58 nM), which leads the formation of the neurofibrillary tangles associated with Alzheimer's disease [1].
|
-
- HY-B0203A
-
|
R 065824 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Nebivolol (R 065824) hydrochloride is an orally active beta receptor blocker and has the high beta(1)-receptor affinity.Nebivolol hydrochloride has direct vasodilator properties and adrenergic blocking characteristics. Nebivolol hydrochloride can be used for the research of kinds of diseases such as hypertension, coronary artery disease, congestive heart failure and ischemic heart disease [1] .
|
-
- HY-B0203
-
|
R 065824
|
Adrenergic Receptor
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Nebivolol (R 065824) is an orally active beta receptor blocker and has the high beta(1)-receptor affinity. Nebivolol has direct vasodilator properties and adrenergic blocking characteristics. Nebivolol can be used for the research of kinds of diseases such as hypertension, coronary artery disease, congestive heart failure and ischemic heart disease [1] .
|
-
- HY-N2703
-
|
|
Glycosidase
|
Metabolic Disease
|
|
6β-Hydroxyipolamiide can be isolated from the methanolic extract of S. jamaicensis leaves. 6β-Hydroxyipolamiide has α-glucosidase inhibitory activity with an IC50 of 539.17 μg/mL [1].
|
-
- HY-18060
-
|
TC-5619
|
nAChR
|
Neurological Disease
|
|
Bradanicline is a highly selective α7 nicotinic acetylcholine receptor (nAChR) agonist (humanα7 nAChR: EC50=17 nM; Ki= 1.4 nM). Bradanicline is used for the research of cognitive disorders [1] .
|
-
- HY-18593
-
|
6-O-Alpha-D-Maltosyl-beta-cyclodextrin
|
Biochemical Assay Reagents
|
Others
|
|
Mal-β-CD is a cellular cholesterol modifier which can form soluble inclusion complex with cholesterol.
|
-
- HY-P4896
-
|
|
Integrin
|
Cancer
|
|
FITC-Ahx Gly Arg Gly Asp Ser Pro is a GRGDSP (HY-P0290) coupled to FITC. GRGDSP is an integrin inhibitor that can inhibit the adherence of tumor cells to endothelial cells of blood vessels and limit its metastasis [1].
|
-
- HY-133680
-
|
|
Tyrosinase
|
Others
|
|
β-Tocopherol is an analogue of vitamin E, exhibits antioxidant properties. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol also can prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol [1] .
|
-
- HY-19306
-
|
|
Integrin
|
Cancer
|
|
SB-267268 is a selective and nonpeptidic alpha(v)beta3 (αvβ3) and alpha(v)beta5 (αvβ5) integrins antagonist, with Kis of 0.9, 0.5 and 0.7 nM for human αvβ3, monkey αvβ3 and human αvβ5, respectively. SB-267268 inhibits human and mouse αvβ3 with IC50s of 0.68 and 0.29 nM, respectively. SB-267268 reduces angiogenesis and VEGF expression [1].
|
-
- HY-150693
-
|
|
Estrogen Receptor/ERR
|
Cancer
|
|
Estrogen receptor β antagonist 2 is a potent and selective estrogen receptor β (ERβ) antagonist with IC50s of 109.10, 0.63 µM for Erα and Erβ, respectively [1].
|
-
- HY-120270
-
|
|
AMPK
|
Metabolic Disease
|
|
PF-06679142 (Compound 10) is a potent, orally active AMPK activator with an EC50 of 22 nM against α1β1γ1-AMPK. PF-06679142 can be used for diabetic nephropathy research [1].
|
-
- HY-W011243
-
|
|
11β-HSD
|
Cardiovascular Disease
|
|
11alpha-Hydroxyprogesterone is the analogue of 11beta-Hydroxyprogesterone (HY-N2337), and can be used as an experimental control. 11beta-Hydroxyprogesterone is a potent inhibitors of 11β-Hydroxysteroid dehydrogenase; also activates human mineralocorticoid receptor in COS-7 cells with an ED50 of 10 nM.
|
-
- HY-P5133
-
|
SSTN92-119
|
Integrin
|
Cancer
|
|
Synstatin (92-119) is an anti-tumor agent that inhibits angiogenesis and cancer cell invasion. Synstatin (92-119) down-regulates integrin α?β3 and reduces the activation of angiogenic growth factors VEGF and FGF-2 [1] .
|
-
- HY-115677
-
|
|
Integrin
DYRK
|
Cancer
|
|
ILK-IN-3 is an orally active integrin linked kinase (ILK) inhibitor. ILK-IN-3 improves the anticancer efficacy of Docetaxel (HY-B0011) in orthotopic LCC6 model [1] .
|
-
- HY-170491
-
|
|
GSK-3
|
Infection
Neurological Disease
|
|
GSK-3β inhibitor 23 (Compound 11726169) is the inhibitor for glycogen synthase kinase-3, that inhibits GSK-3β and GSK-3α with IC50 of 12.1 nM and 18.8 nM. GSK-3β inhibitor 23 exhibits antiviral activity against HIV 1. GSK-3β inhibitor 23 exhibits good metabolic stablility in mouse/human liver microsomes and plasma, but poor Caco-2 permeability (which predicts low oral bioavailability) [1].
|
-
- HY-136699
-
|
|
MMP
FAK
Src
Integrin
|
Cancer
|
|
Excisanin A is a potent anticancer agent. Excisanin A inhibits cell proliferation, migration, adhesion and invasion. Excisanin A decreases the expression of MMP-2, MMP-9, p-FAK, p-Src, integrin β1 protein. Excisanin A has the potential for the research of breast cancer [1].
|
-
- HY-139202
-
|
|
Integrin
|
Inflammation/Immunology
|
|
XVA143, an α/β I-like allosteric antagonist, inhibits LFA-1 dependent firm adhesion, while at the same time it enhances adhesion in shear flow and rolling both in vitro and in vivo [1].
|
-
- HY-101953
-
|
D'Orenone
|
RAR/RXR
|
Others
|
|
β-Apo-13-carotenone (D'Orenone) is a naturally occurring β-apocarotenoid functioned as an antagonist of RXRα.
|
-
- HY-149535
-
|
WU-04
|
SARS-CoV
|
Infection
|
|
Iscartrelvir (WU-04) is a non-covalent inhibitor of SARS-CoV-2, targeting the 3CLpro protein. Iscartrelvir has high inhibitory effect on the 3CLpro protein of 6 SARS-CoV-2 variants (Alpha, Beta, Gamma, Delta, Lambda and Omicron) and 2 coronaviruses (SARS-CoV and MERS-CoV) [1].
|
-
- HY-157161
-
|
|
11β-HSD
|
Cancer
|
|
11β-HSD2-IN-1 (compound CDSN) is a potent inhibitor of 11β-HSD2, inhibiting the metabolism of Cholestane-3β,5α,6β-triol (CT) in cells by 11β-HSD2 into the tumor promoter, carcinosterone. 11β-HSD2-IN-1 inhibits testosterone biosynthesis, thereby inhibiting MCF-7 cell proliferation. 11β-HSD2-IN-1 has immune activity and antiviral infection effects [1].
|
-
- HY-137261
-
|
|
Others
|
Metabolic Disease
|
|
UDP-β-D-glucose disodium is a the stereoisomer of UDP-α-D-glucose. UDP-β-D-glucose disodium is an oligosaccharide that can be used to synthesize glycoproteins and glycolipids. UDP-β-D-glucose disodium can be used as a substrate [1].
|
-
- HY-P10616
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Salusin-α is an endogenous bioactive peptide with hemodynamic and cell proliferation activities. Salusin-α can stimulate the proliferation of quiescent vascular smooth muscle cells (VSMCs) and fibroblasts, leading to a rapid and significant decrease in blood pressure and heart rate, but its effect is weaker than that of Salusin-β (HY-P10617). Salusin-α has potential application value in cardiovascular disease research [1].
|
-
- HY-N13706
-
|
|
NO Synthase
|
Inflammation/Immunology
|
|
3β,15α-Dihydroxy-7,11,23-trioxo-lanost-8-dien-26-oic acid is a triterpene compound that can be found in Ganoderma lucidum, and it inhibits nitric oxide (NO) production in BV-2 microglial cells induced by lipopolysaccharide (LPS, HY-D1056), with an IC50 of 6.50 μM, making it a potential candidate for anti-inflammatory research [1].
|
-
- HY-W698908
-
|
Methyl 3-O-[2-(acetylamino)-2-deoxy-β-D-galactopyranosyl]-α-D-galactopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
GalNAc1-b-3Gal-α-Ome (Methyl 3-O-[2-(acetylamino)-2-deoxy-β-D-galactopyranosyl]-α-D-galactopyranoside) is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-164957
-
|
|
Antibody-Drug Conjugates (ADCs)
Integrin
|
Cancer
|
|
SGN-B6A is an ADC, which targets integrin beta-6 (ITGB6) through human IgG1 monoclonal antibody Sigvotatug (HY-P990764), and exhibits cytotoxicity against multiple integrin beta-6-positive cancer cell through mitotic inhibitor MMAE (HY-15162) [1].
|
-
- HY-P5623B
-
|
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells [1].
|
-
- HY-P2769A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Thermostable β-Agarase is a hydrolase that can hydrolyze the β-1,4 linkages in agarose to produce neoagaro-oligosaccharides, and it can be used to extract DNA and RNA from gels. Compared to conventional β-Agarase, Thermostable β-Agarase exhibits higher heat resistance and stronger hydrolytic activity. The thermostable properties of Thermostable β-Agarase simplify experimental procedures and make it suitable for the rapid purification of intact large DNA molecules [1].
|
-
- HY-128417R
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-D-glucose (Standard) is the analytical standard of alpha-D-glucose. This product is intended for research and analytical applications. \alpha-D-glucose is a monosaccharide that has a more significant insulin stimulating effect than beta-D-glucose[1][2].
|
-
- HY-122552
-
|
|
Integrin
|
Cancer
|
|
Chrysotobibenzyl can be isolated from stem of Dendrobium pulchellum. Chrysotobibenzyl inhibits lung cancer cell (H460 and H292) migration, invasion, filopodia formation via Cav-1, integrins β1, β3, and αν, and EMT suppressions. Chrysotobibenzyl also sensitizes lung cancer cell death mediated by Cisplatin (HY-17394) [1].
|
-
- HY-W087904R
-
|
|
Endogenous Metabolite
|
Others
|
|
α-Lactose (hydrate) (Standard) is the analytical standard of α-Lactose (hydrate). This product is intended for research and analytical applications. α-Lactose (hydrate) (α-D-Lactose (hydrate)) is the principal carbohydrate in the milk of most mammals. α-Lactose (hydrate) consists of glucose and galactose and exists in the form of two anomers, α and β. α-Lactose (hydrate) has many uses in the food and pharmaceutical industries, such as a free-flowing or agglomerating agent, a diluent for pigments, flavors, or enzymes [1] .
|
-
- HY-N1940
-
|
Cycloicaritin
|
Interleukin Related
TNF Receptor
MMP
|
Inflammation/Immunology
Cancer
|
|
β-Anhydroicaritin is isolated from Boswellia carterii Birdware, has important biological and pharmacological effects, such as antiosteoporosis, estrogen regulation and antitumor properties [1]. β-Anhydroicaritin ameliorates the degradation of periodontal tissue and inhibits the synthesis and secretion of TNF-α and MMP-3 in diabetic rats . β-Anhydroicaritin decreases the overproduction of NO, IL-10, TNF-α, MCP-1 and IL-6 in inperitonitis mice. β-Anhydroicaritin inhibits the elevation of intracellular Ca 2+, and markedly decreases iNOS protein expression .
|
-
- HY-100563
-
|
|
Integrin
|
Cancer
|
|
Cyclo(RGDyK) trifluoroacetate is a potent and selective αVβ3 integrin inhibitor with an IC50 of 20 nM.
|
-
- HY-100563A
-
|
|
Integrin
|
Cancer
|
|
Cyclo(RGDyK) is a potent and selective αVβ3 integrin inhibitor with an IC50 of 20 nM.
|
-
- HY-W011410
-
|
p-Nitrophenyl β-D-Mannopyranoside
|
Glycosidase
|
Others
|
|
4-Nitrophenyl β-D-mannopyranoside is a useful substrate for β-D-mannopyranosidase. 4-Nitrophenyl β-D-mannopyranoside is also a substrate for GH1-glucosidase (EaBgl1A) and α-L-rhamnosidase [1] .
|
-
- HY-P10163
-
|
|
Fluorescent Dye
|
Others
|
|
α-Secretase Substrate II, Fluorogenic is an internally quenched fluorogenic peptide substrate for α-Secretase that contains the α-secretase cleavage site of β-Amyloid precursor protein (APP) [1].Ex/Em = 340/490 nm
|
-
- HY-113068R
-
|
|
Tyrosinase
|
Metabolic Disease
|
|
(rel)-β-Tocopherol (Standard) is the analytical standard of (rel)-β-Tocopherol. This product is intended for research and analytical applications. (rel)-β-Tocopherol is a relative configuration of β-Tocopherol.(±)-β-Tocopherol is a lipid-soluble form of vitamin E with antioxidant activity. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol also can prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol [1].
|
-
- HY-P5623
-
|
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells [1].
|
-
- HY-N2929
-
|
|
Glycosidase
|
Cardiovascular Disease
|
|
β-Hydroxypropiovanillone, a natural compound, shows significant concentration-dependent inhibitory effects on α-glucosidase with an IC50 of 257.8 μg/mL [1].
|
-
- HY-114508
-
|
3-Phenylpropiophenone; β-Phenylpropiophenone
|
Amyloid-β
|
Neurological Disease
|
|
Dihydrochalcone (3-Phenylpropiophenone) is a BBB-penatrable Aβ aggregation inhibitor. Dihydrochalcone destabilizes Aβ17-42 protofibrils by disrupting the β-sheet of β1 region. Dihydrochalcone destabilizes both U-shaped Aβ40/Aβ42 protofibrils and S-shaped Aβ42 protofibrils by binding to the protofibril cavity. Dihydrochalcone is the main component of daemonorops draco tree [1].
|
-
- HY-128417
-
-
- HY-B0522A
-
|
D-(-)-α-Aminobenzylpenicillin sodium salt
|
Bacterial
Antibiotic
|
Infection
|
|
Ampicillin sodium (D-(-)-α-Aminobenzylpenicillin sodium salt) is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria [1].
|
-
- HY-P3004
-
|
Lyticase
|
Endogenous Metabolite
|
Others
|
|
Endo-1,3-β-glucanase specifically hydrolyzes β-1,3-glycosidic bonds randomly along the β-glucan chain, and the final product is mainly glucan oligosaccharide. Endo-1,3-β-glucanase is produced by a variety of fungi, is often used in biochemical studies [1].
|
-
- HY-P4391
-
-
- HY-19411
-
|
|
nAChR
|
Neurological Disease
|
|
SSR180711 hydrochloride is an orally active, selective and reversible α7 acetylcholine nicotinic receptor (n-AChRs) partial agonist. SSR180711 hydrochloride can act on rat α7 n-AChR (Ki=22 nM; IC50=30 nM) and human α7 n-AChR (Ki=14 nM; IC50=18 nM). SSR180711 hydrochloride increases glutamatergic neurotransmission, ACh release and long-term potentiation (LTP) in the hippocampus [1].
|
-
- HY-W698539
-
|
|
Biochemical Assay Reagents
|
Others
|
|
n-Octyl 3,6-Di-O-(α-D-mannopyranosyl)-β-D-mannopyranoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-133680R
-
|
|
Tyrosinase
|
Others
|
|
β-Tocopherol (Standard) is the analytical standard of β-Tocopherol. This product is intended for research and analytical applications. β-Tocopherol is an analogue of vitamin E, exhibits antioxidant properties. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol also can prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol [1] .
|
-
- HY-E70063
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-2,3-Sialyltransferase (Phα2,3SiaT) is a beta-galactoside. alpha-2,3-Sialyltransferase (Phα2,3SiaT) catalyzes the transfer of sialic acid to carbohydrate groups of glycoproteins and glycolipids [1].
|
-
- HY-145480
-
|
Silodosin β-D-glucuronide sodium
|
Drug Metabolite
|
Others
|
|
Silodosin Glucuronide sodium (Silodosin β-D-glucuronide sodium) is the metabolite of Silodosin (HY-10122). Silodosin is a selective and orally active antagonist for α1A-adrenergic receptor (α1A-AR) with Ki of 0.036 nM [1].
|
-
- HY-N0604
-
-
- HY-N1125
-
|
Hypoglic acid
|
TNF Receptor
|
Others
|
|
Triptobenzene H (Hypoglic acid) significantly increases TNF-α and IL-1β mRNA levels in macrophages, causing indirect liver damage [1].
|
-
- HY-16143
-
|
EMD 121974 TFA
|
Integrin
Autophagy
|
Cancer
|
|
Cilengitide is a potent and selective integrin inhibitor for αvβ3 and αvβ5 receptor, with IC50 values of 4 nM and 79 nM, respectively.
|
-
- HY-112910
-
|
|
HSP
|
Inflammation/Immunology
Cancer
|
|
Grp94 Inhibitor-1 is a potent, selective Grp94 inhibitor with an IC50 value of 2 nM, and over 1000-fold selectivity to Grp94 against Hsp90α [1].
|
-
- HY-W145609
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Neu5Troc[1Me,4789Ac]α(2-3)Gal[26Bn]-β-MP is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
![Neu5Troc[1Me,4789Ac]α(2-3)Gal[26Bn]-β-MP](//file.medchemexpress.com/product_pic/hy-w145609.gif)
- HY-141488
-
|
Galβ1-3GlcNAc
|
Endogenous Metabolite
|
Endocrinology
|
|
Lacto-N-biose I (Galβ1-3GlcNAc), as an endogenous metabolite, is an acceptor for the α1,2-fucosyltransferase enzyme from Helicobacter pylori [1].
|
-
- HY-16748
-
|
ABT-126
|
nAChR
|
Neurological Disease
|
|
Nelonicline (ABT-126) is an orally active and selective α7 nicotinic receptor agonist with high affinity to α7 nAChRs in human brain (Ki=12.3 nM). Nelonicline is used for the research of shizophrenia and Alzheimer's disease [1] .
|
-
- HY-10019S
-
|
CP 526555-d4
|
Isotope-Labeled Compounds
nAChR
|
Neurological Disease
|
|
Varenicline-d4 is deuterium labeled Varenicline. Varenicline (CP 526555) is a potent partial agonist for α4β2 nicotinic acetylcholine receptor (nAChR) with an EC50 value of 2.3 μM. Varenicline is a full agonist for α3β4 and α7 nAChRs with EC50 values of 55 μM and 18 μM, respectively[1]. Varenicline is a nicotinic ligand based on the structure of cytisine, has the potential for smoking cessation treatment[2].
|
-
- HY-10019AS1
-
|
|
Isotope-Labeled Compounds
nAChR
|
Inflammation/Immunology
|
|
Varenicline-d4 hydrochloride is a deuterium labeled Varenicline (dihydrochloride) (HY-10019A) [1]. Varenicline (CP 526555) dihydrochloride is a potent partial agonist for α4β2 nicotinic acetylcholine receptor (nAChR) with an EC50 value of 2.3 μM. Varenicline dihydrochloride is a full agonist for α3β4 and α7 nAChRs with EC50 values of 55 μM and 18 μM, respectively . Varenicline dihydrochloride is a nicotinic ligand based on the structure of cytosine, and has the potential for smoking cessation treatment .
|
-
- HY-P10223
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
Cyclo CRVIIF is a dual inhibitor for hypoxia inducible factor (HIF) 1 and 2, which disrupts the interaction of both HIF1-α and HIF2-α with HIF1-β, with affinity for HIF1-α and HIF2-α PAS-B domains KD of 65 and 123 μM, respectively [1].
|
-
- HY-113602
-
|
Antibiotic 273 A1-beta
|
Antibiotic
Bacterial
|
Infection
|
|
Paldimycin B (Antibiotic 273 A1-beta) is a powerful semi-synthetic antibiotic with antibacterial activity against S. aureus and coagulase-negative staphylococci [1].
|
-
- HY-113960
-
|
|
Estrogen Receptor/ERR
|
Cancer
|
|
ERRα antagonist-1 (Compound A) is a selective and high affinity agonist for estrogen-related receptor α (ERRα). ERRα antagonist-1 inhibits interaction of ERRα with Proliferator-activated Receptor γ Coactivator-1α (PGC-1α) and PGC-1β, the IC50 values are 170 nM and 180 nM, respectively [1].
|
-
- HY-113068S
-
|
|
Isotope-Labeled Compounds
Tyrosinase
|
Metabolic Disease
|
|
β-Tocopherol-d3 is the deuterium labeled β-Tocopherol. β-Tocopherol is an analogue of vitamin E, exhibits antioxidant properties. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol can also prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol[1][2][3].
|
-
- HY-133680S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
β-Tocopherol-d4 is a deuterium labeled β-Tocopherol (HY-133680). β-Tocopherol is an analogue of vitamin E, exhibits antioxidant properties. β-Tocopherol can inhibit tyrosinase activity and melanin synthesis. β-Tocopherol also can prevent the inhibition of cell growth and of PKC activity caused by d-alpha-tocopherol [1].
|
-
- HY-N8100
-
|
|
Others
|
Others
|
|
2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone 3-O-α-rhamnosyl-(1→2)-β-glucoside is anthraquinone glycoside found in the dried roots of Rubia cordifolia [1].
|
-
- HY-117921
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
DA-E 5090 is an orally effective inhibitor of IL-1 production that can be converted into a pharmacologically active deacetylated form (DA-E5090) in vivo. In this study, the effects of DA-E5090 on IL-1 production in vitro were examined by LPS-stimulated human monocytes. The results showed that DA-E5090 could dose-dependently inhibit the production of IL-1α and IL-1β (1-10 μM) by LPS-stimulated human monocytes, as determined by LAF assay and ELISA. Northern blotting analysis showed that DA-E5090 inhibited the transcription of IL-1α and IL-1β mRNA.
|
-
- HY-136735
-
|
|
IRE1
|
Neurological Disease
Cancer
|
|
IRE1α kinase-IN-1 is a highly selective IRE1α (ERN1) inhibitor, with an IC50 of 77 nM. IRE1α kinase-IN-1 displays 100-fold selectivity for IRE1α over the IRE1β isoform. IRE1α kinase-IN-1 inhibits ER stress-induced IRE1α oligomerization and autophosphorylation, and also inhibits IRE1α RNase activity (IC50=80 nM) [1].
|
-
- HY-102073
-
|
|
Glutaminase
Integrin
FAK
Src
|
Cancer
|
|
TG53 is a potent inhibitor of tissue transglutaminase (TG2) and fibronectin (FN) protein-protein interaction. TG53 inhibits formation of a complex with integrin β1 and activation of FAK and c-Src during SKOV3 cell attachment onto FN. TG53 can be used for ovarian cancer research [1].
|
-
- HY-149344
-
|
|
Apoptosis
Autophagy
EGFR
|
Cancer
|
|
Anticancer agent 133 (compound Rh2) is an anti-cancer agent with cytotoxic and antimetastatic activities. Anticancer agent 133 induces cell cycle arrest, apoptosis, and autophagy. Anticancer agent 133 also inhibits cell metastasis via suppression of EGFR expression mediated by FAK-regulated integrin β1 [1].
|
-
- HY-P10222
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
Cyclo CRLLIF is a dual inhibitor for hypoxia inducible factor (HIF) 1 and 2, which disrupts the interaction of both HIF1-α and HIF2-α with HIF1-β, with affinity for HIF1-α and HIF2-α PAS-B domains KD of 14.5 and 10.2 μM, respectively [1].
|
-
- HY-P10221A
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
Cyclo CKLIIF is a dual inhibitor for hypoxia inducible factor (HIF) 1 and 2, which disrupts the interaction of both HIF1-α and HIF2-α with HIF1-β, with affinity for HIF1-α and HIF2-α PAS-B domains KD of 2.6 and 2.2 μM, respectively [1].
|
-
- HY-P990643
-
|
|
Integrin
|
Inflammation/Immunology
|
|
OS-2966 is a humanized antibody expressed in CHO cells, targeting Integrin b1/ITGB1/CD29. OS-2966 carries a huIgG1 type heavy chain and a huκ type light chain, with a predicted molecular weight (MW) of 145.5 kDa. The isotype control for OS-2966 can be referenced as Human IgG1 kappa, Isotype Control (HY-P99001).
|
-
- HY-149218
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
Inflammation/Immunology
|
|
THR-β agonist 6 is an orally active, selective thyroid hormone receptor β (THR-β) agonist with EC50s of 0.03 μM and 0.22 μM for THR-β and THR-α, respectively. THR-β agonist 6 exhibits an xcellent liver-to-serum ratio of 93:1 in mice. THR-β agonist 6 has the potential for nonalcoholic steatohepatitis (NASH) research [1].
|
-
- HY-156297
-
|
|
Proteasome
|
Inflammation/Immunology
|
|
β5i-IN-1 is a potent and selective inhibitor of β5i with a IC50 of 8.463 nM. β5i-IN-1 releases TNF-α and IL-6 and influences the transcriptional activity of NF-κB. β5i-IN-1 can be used in study idiopathic pulmonary fibrosis [1].
|
-
- HY-18060A
-
|
TC-5619 hydrochloride
|
nAChR
|
Neurological Disease
|
|
Bradanicline hydrochloride (TC-5619 hydrochloride) is the hydrochloride salt form of Bradanicline (HY-18060). Bradanicline hydrochloride is a selective agonist for α7 nicotinic acetylcholine receptor (nAChR), with EC50 of 17 nM for human α7 nAChR and Ki of 1.4 nM. Bradanicline hydrochloride is used for the research of cognitive disorders and schizophrenia [1] .
|
-
- HY-18039
-
|
SEN15924
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
WAY-361789 (SEN15924) is an orally active agonist for α7 nicotinic acetylcholine receptor (α7 nAChR) with an EC50 of 0.18 μM. WAY-361789 improves the cognitive function, exhibits potential in ameliorating Alzheimer’s Disease and schizophrenia [1].
|
-
- HY-16748A
-
|
ABT-126 citrate
|
nAChR
|
Neurological Disease
|
|
Nelonicline (ABT-126) citrate is an orally active and selective α7 nicotinic receptor agonist with high affinity to α7 nAChRs in human brain (Ki=12.3 nM). Nelonicline citrate is used for the research of shizophrenia and Alzheimer's disease [1] .
|
-
- HY-155027
-
|
|
Dipeptidyl Peptidase
TNF Receptor
Interleukin Related
|
Inflammation/Immunology
Cancer
|
|
DPP-4-IN-8 (compound 27) is a potent and selective DPP4 (dipeptidyl peptidase 4) inhibitor, with a Ki of 0.96 μM. DPP-4-IN-8 blocks the dipeptidase activity of DPP4 in both Caco-2 and HepG-2 cells. DPP-4-IN-8 also dose-dependently suppresses the expression levels of the chemokines tumor necrosis factor-α (TNF-α), interleukin-6 (IL-6), and interleukin-1β (IL-1β) .
|
-
- HY-163360
-
|
|
PI3K
|
Cancer
|
|
PI3Kα-IN-19 (Compound 1) is a PI3Kα inhibitor with a targeted binding site at the p110α catalytic subunit. PI3Kα is one of the most common dysregulated kinases used in cancer research [1].
|
-
- HY-120337
-
|
|
Choline Kinase
|
Cancer
|
|
V-11-0711 is a potent and selective choline kinase alpha (ChoKα) inhibitor with an IC50 of 20 nM. V-11-0711 causes a reversible growth arrest in HeLa cells [1].
|
-
- HY-15483
-
DY131
3 Publications Verification
GSK 9089
|
Estrogen Receptor/ERR
Smo
|
Endocrinology
Cancer
|
|
DY131 (GSK 9089) is a potent and selective ERRγ and ERRβ agonist. DY131displays inactive against ERRα, ERα and ERβ . DY131 also inhibits Smo signaling .
|
-
- HY-P99645
-
-
- HY-N1501
-
|
|
α-synuclein
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
Beta-asarone is an orally active and BBB-penetrable anti-inflammatory agent and neuroprotective agent, which is the major ingredient of Acorus tatarinowii Schott. Beta-asarone can protect nerve cells from apoptosis and autophagy, inhibit expression of α-synuclein, as well as myocardial protection. Beta-asarone can be used in the study of neurological and cardiovascular diseases [1] .
|
-
- HY-E70068
-
|
|
Others
|
Others
|
|
Endo-β-N-acetylglucosaminidase (Endo S) is a family 18 glycosyl hydrolase secreted by Streptococcus pyogenes. Endo-β-N-acetylglucosaminidase (Endo S) exclusively hydrolyzes the β-1,4-di-N-acetylchitobiose core of the asparagine-linked complex-type glycan on Asn-297 of the γ-chains of IgG antibody [1].
|
-
- HY-E70058
-
|
α-1-3,4 FucT; Hp3/4FT
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-1,3/4-Fucosyltransferase (α1,3/4FucT) (EC 2.4.1.65) (Hp3/4FT) can be found in Helicobacter pylori. alpha-1,3/4-Fucosyltransferase (α1,3/4FucT) catalyzes fucose transfer from donor GDP-beta-l-fucose to the GlcNAc [1].
|
-
- HY-14412
-
|
|
p38 MAPK
|
Cancer
|
|
p38α inhibitor 4 (compound 10) is a selective and allosteric p38α inhibitor with an IC50 value of 1.2 μM. p38α inhibitor 4 exhibits no activity against p38β, p38γ, and p38δ [1].
|
-
- HY-106769C
-
|
GR50360 hydrochloride
|
Adrenergic Receptor
|
Neurological Disease
|
|
Fluparoxan hydrochloride is an orally active, selective and competitive alpha 2-adrenoceptor antagonist. Fluparoxan hydrochloride is an anti-depressant agent [1] .
|
-
- HY-106769
-
-
- HY-147518
-
|
|
p38 MAPK
|
Inflammation/Immunology
|
|
p38-α MAPK-IN-5 (compound 4e) is a potent p38α inhibitor with IC50s of 0.1 nM, 0.2 nM, 944 nM, 4100 nM for p38α, p38 β, p38γ, p38δ, respectively. p38-α MAPK-IN-5 has anti-inflammatory effect. p38-α MAPK-IN-5 has the potential for asthma and chronic obstructive pulmonary disease (COPD) research [1].
|
-
- HY-150692
-
|
|
Estrogen Receptor/ERR
|
Cancer
|
|
Estrogen receptor α antagonist 1 (compound 35) is a highly selective antagonist of estrogen receptor α, with IC50s of 0.02, 6.55 and 7.73 μM for estrogen receptor α, estrogen receptor β and MCF-7 cells, respectively. Estrogen receptor α antagonist 1 can be used for the research of cancer [1].
|
-
- HY-107672
-
|
Stilonium iodide
|
nAChR
|
Neurological Disease
|
|
MG624 is a potent and selective neuronal α7 nAChR antagonist with a Ki of 106 nM [1].
|
-
- HY-U00250
-
-
- HY-N1501R
-
|
|
α-synuclein
Reference Standards
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
Beta-asarone (Standard) is the analytical standard of Beta-asarone. This product is intended for research and analytical applications. Beta-asarone is an orally active and BBB-penetrable anti-inflammatory agent and neuroprotective agent, which is the major ingredient of Acorus tatarinowii Schott. Beta-asarone can protect nerve cells from apoptosis and autophagy, inhibit expression of α-synuclein, as well as myocardial protection. Beta-asarone can be used in the study of neurological and cardiovascular diseases [1].
|
-
- HY-N12837
-
|
|
Others
|
Inflammation/Immunology
|
|
8-Epiloganin can be isolated from Castilleja rubra and has anti-inflammatory properties. 8-Epiloganin inhibits LPS-induced release of pro-inflammatory cytokines, namely tumor necrosis factor-α and interleukin-1β .
|
-
- HY-N2056
-
|
11-Keto-β-boswellic acid
|
Lipoxygenase
Leukotriene Receptor
NF-κB
|
Metabolic Disease
Cancer
|
|
11-Keto-beta-boswellic acid (11-Keto-β-boswellic acid) is a pentacyclic triterpenic acid of the oleogum resin from the bark of the Boswellia serrate tree, popularly known as Indian Frankincense. 11-Keto-beta-boswellic acid has the anti-inflammatory activity is primarily due to inhibit 5-lipoxygenase (5-LOX) and subsequent leukotriene and nuclear factor-kappa B (NF-κB) activation and tumor necrosis factor alpha generation production [1].
|
-
- HY-126039
-
|
|
Integrin
|
Cardiovascular Disease
|
|
L-739758 is an antagonist for αIIbβ3 integrin (platelet glycoprotein IIb/IIIa). L-739758 acts as a peptidomimetic, binds to αIIbβ3 integrin by mimicking the interaction of the RGD (arginine-glycine-aspartic acid) motif, and is involved in the blood coagulation process. L-739758 inhibits platelet aggregation, and is used for thrombosis research [1].
|
-
- HY-W698498
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Benzyl 2-Acetamido-2-deoxy-3-O-(β-D-galactopyranosyl)-α-D-glucopyranoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-138111
-
|
p-Nitopheyl β-D-cellotetaoside
|
Fluorescent Dye
|
Others
|
|
4-Nitrophenyl β-D-cellotetraoside (p-Nitopheyl β-D-cellotetaoside) is a small molecule cellulose mimetic consisting of a tetramer of D-glucose units linked by β-1-4 glycosidic bonds. The fragmentation pattern of 4-Nitrophenyl β-D-cellotetraoside after enzymatic hydrolysis can be analyzed by TLC or by the release of 4-nitrophenol, which has a strong absorbance at 395 nm in alkaline solutions. 4-Nitrophenyl β-D-cellotetraoside can be used in cellulose degradation studies to determine the specificity of cellulases [1].
|
-
- HY-B0522B
-
|
D-(-)-α-Aminobenzylpenicillin trihydrate
|
Bacterial
Antibiotic
|
Infection
|
|
Ampicillin trihydrate (D-(-)-α-Aminobenzylpenicillin trihydrate) is a broad-spectrum beta-lactam antibiotic against a variety of gram-positive and gram-negative bacteria.
|
-
- HY-N7389B
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
GDP-α-D-mannose disodium is the donor substrate for mannosyltransferases and the precursor of GDP-β-L-fucose. GDP-α-D-mannose disodium gives a competitive inhibition with respect to GTP (Ki 14.7 μM) and an uncompetitive inhibition with respect to mannose-1-P (Ki 115 μM) [1].
|
-
- HY-P3448
-
|
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors [1] .
|
-
- HY-N2990
-
|
3β,16α-Dihydroxylanosta-7,9(11),24-trien-21-oic acid
|
Others
|
Inflammation/Immunology
|
|
16α-Hydroxydehydrotrametenolic acid is a triterpene Acid in fermented mycelia of edible fungus Poria cocos [1].
|
-
- HY-10401
-
-
- HY-149509
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein inhibitor 9 (Compound 20C) is an α-Synuclein inhibitor. α-Synuclein inhibitor 9 binds to cavities in mature α-synuclein fibrils and reduces the β-sheet structure. α-Synuclein inhibitor 9 inhibits A53T α-Syn aggregation. α-Synuclein inhibitor 9 has neuroprotective effect, improves brain functional connection and relieves motor dysfunction.α-Synuclein inhibitor 9 can be used for Parkinson’s disease (PD) research. [1].
|
-
- HY-W698516
-
|
|
Biochemical Assay Reagents
|
|
|
Benzyl 2-acetamido-2-deoxy-6-O-(β-D-galactopyranosyl) -α-D-Galactopyranoside is a class of biochemical reagents used in the study of glycobiology. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It deals with carbohydrate chemistry, glycan formation and degradation enzymology, protein-glycan recognition, and the role of glycans in biological systems. The field is closely related to basic research, biomedicine and biotechnology [1].
|
-
- HY-N8093
-
|
|
Others
|
Others
|
|
2-Methyl-1,3,6-trihydroxy-9,10-anthraquinone-3-O-α-rhamnosyl-(1→2)-β-D-glucoside is a natural product that can be isolated from the roots of Rubia cordifolia [1].
|
-
- HY-149136
-
|
|
Integrin
TGF-beta/Smad
|
Inflammation/Immunology
|
|
MORF-627 is a selective, orally active inhibitor for integrin αvβ6 with an IC50 of 9.2 nM measuring by human serum ligand binding assay. MORF-627 inhibits αvβ6-mediated TGF-β1 activation with an IC50 of 2.63 nM, inhibits SMAD2/3 phosphorylation with an IC50 of 8.3 nM. MORF-627 ameliorates the Bleomycin (HY-108345)-induced mouse lung fibrosis [1].
|
-
- HY-E70062
-
|
Fh8-PmST3
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-2,3-Sialyltransferase (PmST3) (EC 2.4.99.4) is a beta-galactoside. alpha-2,3-Sialyltransferase (PmST3) catalyzes the transfer of sialic acid to carbohydrate groups of glycoproteins and glycolipids [1].
|
-
- HY-146404
-
-
- HY-123277
-
|
|
Integrin
|
Inflammation/Immunology
|
|
IMB-10 is an αMβ2 integrin ligand. IMB-10 inhibits αMβ2-dependent migration and inflammation-induced neutrophil emigration [1].
|
-
- HY-P6351
-
|
|
Integrin
|
Cancer
|
|
c(avb6)-DOTA TFA is a conjugate of the αvβ6 integrin selective peptide ring modified with DOTA chelator. The Lu(III) complex of c(avb6)-DOTA TFA has a comparable affinity for αvβ6 integrin (IC50=0.8 nM) and can be used as a tumor diagnostic [1].
|
-
- HY-164429
-
|
|
Integrin
Elastase
|
Cancer
|
|
VIP236 is a small-molecule-drug conjugates (SMDCs) consisting of an αvβ3 integrin binder linked to an optimized Camptothecin (HY-16560) topoisomerase I (TOP1) inhibitor payload. VIP236 exerts anticancer activity by targeting αvβ3 integrins, and it can release payload upon cleavage by neutrophil elastase in the tumor microenvironment [1].
|
-
- HY-119515
-
|
(R)-(-)-Denopamine; TA-064
|
Adrenergic Receptor
|
Cardiovascular Disease
Cancer
|
|
Denopamine ((R)-(-)-Denopamine) is an orally active, selective β1-adrenergic agonist. Denopamine prolongs survival in a murine model of congestive heart failure induced by viral myocarditis: suppression of tumor necrosis factor-α production in the heart. Cardiovascular effects [1].
|
-
- HY-108057
-
|
RG3487 free base
|
nAChR
5-HT Receptor
|
Neurological Disease
|
|
Facinicline (RG3487) is an orally active nicotinic α7 receptor partial agonist, with a Ki of 6 nM for α7 human nAChR. Facinicline improves cognition and sensorimotor gating in rodents. Facinicline hydrochloride shows high affinity (antagonist) to 5-HT3Rs with a Ki value of 1.2 nM [1].
|
-
- HY-N3864
-
|
|
Others
|
Others
|
|
Erythro-Guaiacylglycerol beta-coniferyl ether (compound 22) can be isolated from the stems and leaves of mung beans. Erythro-Guaiacylglycerol beta-coniferyl ether inhibits α-Glycosidase activity with EC50 value of 18.71 μM [1].
|
-
- HY-13715
-
-
- HY-13715A
-
-
- HY-161674
-
|
|
Monoamine Oxidase
|
Neurological Disease
|
|
Monoamine Oxidase B inhibitor 4 (compound 1l) is a selective inhibitor of human monoamine oxidase-B (hMAO-B) (IC50=8.3 nM). Monoamine Oxidase B inhibitor 4 also has anti-neuroinflammatory and low neurotoxicity. Monoamine Oxidase B inhibitor 4 can inhibit the release of NO, TNF-α and IL-1β stimulated by LPS and Aβ1-42, and can also attenuate Aβ(1-42)-induced cytotoxicity [1].
|
-
- HY-A0144A
-
|
|
Adrenergic Receptor
AMPK
Akt
|
Cardiovascular Disease
|
|
Etilefrine hydrochloride is a sympathetic nerve agonist and AMPK activator that selectively targets α1/β1 adrenergic receptors. Etilefrine hydrochloride stimulates α1 adrenergic receptors, leading to contraction of vascular smooth muscle and increased peripheral resistance. Etilefrine hydrochloride also stimulates β1 receptors to enhance myocardial contractility and increase heart rate, thereby increasing blood pressure and improving cardiac output. Etilefrine hydrochloride also bidirectionally regulates the AMPK/Akt pathway and modulates the phosphorylation levels. Etilefrine hydrochloride can be used in cardiovascular research, such as postural hypotension, chylothorax, and improving low cardiac output [1] .
|
-
- HY-A0144
-
|
|
Adrenergic Receptor
AMPK
Akt
|
Cardiovascular Disease
|
|
Etilefrine is a sympathetic nerve agonist and AMPK activator that selectively targets α1/β1 adrenergic receptors. Etilefrine stimulates α1 adrenergic receptors, leading to contraction of vascular smooth muscle and increased peripheral resistance. Etilefrine also stimulates β1 receptors to enhance myocardial contractility and increase heart rate, thereby increasing blood pressure and improving cardiac output. Etilefrine also bidirectionally regulates the AMPK/Akt pathway and modulates the phosphorylation levels. Etilefrine can be used in cardiovascular research, such as postural hypotension, chylothorax, and improving low cardiac output [1] .
|
-
- HY-P1187
-
|
|
Integrin
|
Cancer
|
HSDVHK-NH2 is an antagonist of the integrin αvβ3-vitronectin interaction, with an IC50 of 1.74 pg/mL (2.414 pM) [1] .
|
-
- HY-103683
-
|
|
AMPK
|
Metabolic Disease
|
|
PF-06409577 is a potent and selective allosteric activator of AMPK α1β1γ1 isoform with an EC50 of 7 nM.
|
-
- HY-N2168
-
|
(+)-Pinoresinol 4-O-β-D-glucopyranoside
|
Glycosidase
Estrogen Receptor/ERR
Phosphodiesterase (PDE)
|
Neurological Disease
Metabolic Disease
Cancer
|
|
Pinoresinol 4-O-β-D-glucopyranoside ((+)-Pinoresinol 4-O-β-D-glucopyranoside) is an orally active α-glucosidase inhibitor, with an IC50 of 48.13 μg/mL. Pinoresinol 4-O-β-D-glucopyranoside binds to estrogen receptors. Pinoresinol 4-O-β-D-glucopyranoside inhibits phosphodiesterase. Pinoresinol 4-O-β-D-glucopyranoside exhibits various activities such as antioxidant, anti-inflammatory, anti-hyperglycemic, hepatoprotective and anti-epileptic effects [1] [7] .
|
-
- HY-137231B
-
|
|
nAChR
|
Neurological Disease
|
|
(S)-UFR2709 (hydrochloride) is a competitive nAChR antagonist?and displays higher affinity for α4β2 nAChRs than for α7 nAChRs. (S)-UFR2709 (hydrochloride) decreases anxiety and reduces ethanol consumption and ethanol preference in alcohol-preferring rats. (S)-UFR2709 (hydrochloride) acts as an anxiolytic agent and can be used for the study of nicotine addiction [1] .
|
-
- HY-137231A
-
|
|
nAChR
|
Neurological Disease
|
|
(S)-UFR2709 is a competitive nAChR antagonist and displays higher affinity for α4β2 nAChRs than for α7 nAChRs. (S)-UFR2709 decreases anxiety and reduces ethanol consumption and ethanol preference in alcohol-preferring rats. (S)-UFR2709 acts as an anxiolytic agent and can be used for the study of nicotine addiction [1] .
|
-
- HY-B0942
-
|
|
nAChR
Bacterial
Apoptosis
Caspase
|
Infection
Neurological Disease
Cancer
|
|
Benzethonium chloride inhibits nicotinic acetylcholine receptors in human recombinant α7 and α4β2 neurons in Xenopus laevis oocytes, which has antibacterial, anticancer, antisepsis and disinfection activity. Benzethonium chloride induced Apoptosis and activated caspases in cancer cell lines. Benzethonium chloride ablates the tumor-forming ability of FaDu cells, delays the growth of xenograft tumors in vivo [1] .
|
-
- HY-138089
-
|
|
Androgen Receptor
Estrogen Receptor/ERR
LDLR
|
Metabolic Disease
Cancer
|
|
17β-Hydroxy exemestane (17-H-EXE) is the primary active metabolite of Exemestane (HY-13632). 17β-Hydroxy exemestane is an aromatase inhibitor (IC50 = 69 nM) and an androgen receptor (AR) agonist (IC50 = 39.6 nM) that is selective for AR over estrogen receptor α (ERα; IC50 = 21.2 μM). 17β-Hydroxy exemestane stimulates growth of AR- and ERα-positive MCF-7 (EC50= 2.7 μM) and T47D breast cancer cells (EC50s = 0.43 and 1500 nM for AR- and ER-mediated growth, respectively) and inhibits proliferation of testosterone-treated aromatase-overexpressing MCF-7 cells. 17β-Hydroxy exemestane inhibits increases in serum cholesterol and LDL levels and prevents decreases in bone mineral density in the lumbar vertebrae and femur, as well as femoral bending strength and compressive strength of the fifth lumbar vertebrae in ovariectomized rats [1] .
|
-
- HY-110266
-
GN44028
5 Publications Verification
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
GN44028 is a potent and orally active hypoxia inducible factor (HIF)-1α inhibitor, with an IC50 of 14 nM. GN44028 inhibits hypoxia-induced HIF-1α transcriptional activity without suppressing HIF-1α mRNA expression, HIF-1α protein accumulation, or HIF-1α/HIF-1β heterodimerization. GN44028 can be used in the research of cancers [1] .
|
-
- HY-E70131
-
|
Endo-β-N-acetylglucosaminidase H
|
Others
|
Metabolic Disease
|
|
Endo H, Streptomyces picatus (Endo-β-N-acetylglucosaminidase H), isolated from Streptomyces plicatus, hydrolyzes the central glycosidic bond of the β1, 4-di-N-acetylchitobiose core in asparagine-linked oligosaccharides [1].
|
-
- HY-13715B
-
-
- HY-N3994
-
|
|
Drug Intermediate
|
Others
|
|
16α,17α-Epoxyprogesterone is an important steroid, serving as an intermediate for many hormonal drugs such as Hydrocortisone (HY-N0583) and Megestrol (HY-B1834). 16α,17α-Epoxyprogesterone can further biotransform into another significant intermediate, 11α-hydroxy-16α,17α-epoxyprogesterone, to manufacture additional compounds [1].
|
-
- HY-100554
-
|
|
Adrenergic Receptor
5-HT Receptor
|
Cardiovascular Disease
|
|
BMY 7378 is a selective antagonist of α1D-adrenoceptor (α1D-AR). BMY 7378 binds to membranes expressing the cloned rat α1D-AR with a >100-fold higher affinity (Ki=2 nM) than binding to either the cloned rat α1A-AR (Ki=800 nM) or the hamster α1B-AR (Ki=600 nM). BMY 7378 is a 5-HT1A receptor partial agonist [1] .
|
-
- HY-N7683
-
|
|
Glycosidase
|
Metabolic Disease
|
|
Prunetin 5-O-β-D-glucopyranoside is an isoflavone isolated from extracts of Potentilla astracanica. Prunetin 5-O-β-D-glucopyranoside is a potent and uncompetitive inhibitor of α-glucosidase, with an IC50 of 56.05 μg/mL. Prunetin 5-O-β-D-glucopyranoside can be used for the research of type-2 diabetes [1].
|
-
- HY-P1187A
-
|
|
Integrin
|
Cancer
|
HSDVHK-NH2 TFA is an antagonist of the integrin αvβ3-vitronectin interaction, with an IC50 of 1.74 pg/mL (2.414 pM) [1] .
|
-
- HY-159945
-
|
|
α-synuclein
|
Neurological Disease
|
|
Tau Protein/α-synuclein-IN-2 (Compound 14T) is a blood-brain barrier penetrating tau and α-syn inhibitor. Through its thiourea linker structure, Tau Protein/α-synuclein-IN-2 dose-dependently reduces α-syn oligomerization. In biosensor cells, Tau Protein/α-synuclein-IN-2 prevents the seeding effect of tau aggregation. In the M17D neuroblastoma model, Tau Protein/α-synuclein-IN-2 exhibits anti-inclusion effects. Additionally, Tau Protein/α-synuclein-IN-2 reduces Aβ plaque formation. Tau Protein/α-synuclein-IN-2 holds promise for Alzheimer's disease and Parkinson's disease research. [1]
|
-
- HY-137785
-
|
|
Biochemical Assay Reagents
|
Others
|
|
2-Chloro-4-nitrophenyl-β-D-maltotrioside is a chromogenic substrate used in bioluminescent and fluorescent assays to detect α-amylase.
|
-
- HY-13715C
-
-
- HY-15430A
-
|
EVP-6124 hydrochloride
|
nAChR
|
Neurological Disease
|
|
Encenicline hydrochloride (EVP-6124 hydrochloride) is a novel partial agonist of α7 neuronal nicotinic acetylcholine receptors (nAChRs).
|
-
- HY-15430
-
|
EVP-6124
|
nAChR
|
Neurological Disease
|
|
Encenicline (EVP-6124) is a novel partial agonist of α7 neuronal nicotinic acetylcholine receptors (nAChRs).
|
-
- HY-169742
-
|
|
nAChR
|
Neurological Disease
|
|
Epibatidine is a α7nACh agonist with a Kd of 100 nM. Epibatidine can be used in the study of Alzheimer's, Parkinson's and schizophrenia [1].
|
-
- HY-N9000
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
Loganic acid 6′-O-β-D-glucoside, a iridoidal glucoside, is isolated from the whole plant of Gentiana rhodantha (Gentianaceae). Loganic acid 6′-O-β-D-glucoside inhibits LPS-induced NO and TNF-α production in macrophage RAW264.7 cells [1].
|
-
- HY-E70134
-
|
Endo F3
|
Others
|
Metabolic Disease
|
|
Endo-β-N-acetylglucosaminidase D (Endo F3) cleaves free or Asparagine-linked triantennary oligosaccharides or α1-6 fucosylated biantennary oligosaccharides, as well as triamnnosyl chitobiose core structures [1].
|
-
- HY-P3017
-
|
CtXyn11A; EC 3.2.1.8
|
Poly(ADP-ribose) Glycohydrolase (PARG)
|
Others
|
|
Endo-1,4-β-xylanase (Xylanase) is an arabinoxylan (AX) degrading enzyme and a glycoside hydrolase, is often used in biochemical studies. Endo-1,4-β-xylanase cleaves the β-xylosidic bond between two d-xylopyranosyl residues linked in β-(1,4) [1].
|
-
- HY-107850A
-
|
Allopregnanediol
|
GnRH Receptor
|
Endocrinology
|
|
5α-Pregnane-3α,20α-diol (Allopregnanediol) is a derivative of progesterone and is one of the various steroids secreted by the ovaries of rats. 5α-Pregnane-3α,20α-diol can significantly stimulate the release of luteinizing hormone (LH) in castrated rats that have been pre-treated with estrogen, while simultaneously inhibiting the secretion of follicle-stimulating hormone (FSH) [1].
|
-
- HY-131001
-
|
|
nAChR
|
Neurological Disease
|
|
DPNB-ABT594 is a nitrobenzyl-caged ABT594 (HY-14316A) and activates nAChRs containing the α4β2 subunits with good selectivity than the α7 subunit. DPNB-ABT594 can be used to map the distribution of nAChRs on neurons of the medial habenula (MHb) and helps to gain a deeper understanding of the nAChR-mediated Ca 2+ signalling in the MHb [1].
|
-
- HY-W721582
-
|
|
Glycosidase
|
Others
|
|
β,β-Trehalose is a analog of trehalose. β,β-Trehalose can support the growth of shoot tips of Cuscuta. β,β-Trehalose can be cleaved by nonspecific β-glucosidase [1].
|
-
- HY-101955
-
|
(2S,6S)-HNK hydrochloride
|
mTOR
nAChR
|
Neurological Disease
|
|
(2S,6S)-Hydroxynorketamine hydrochloride is a neurorelaxant with potential antidepressant and analgesic effects. (2S,6S)-Hydroxynorketamine hydrochloride can activate the mTOR pathway, increase the phosphorylation level of downstream targets, and antagonize α7-nicotinic acetylcholine receptor (nAChR) to exert neuroactive properties [1].
|
-
- HY-108057A
-
|
RG3487 hydrochloride
|
nAChR
5-HT Receptor
|
Neurological Disease
|
Facinicline hydrochloride (RG3487 hydrochloride) is an orally active nicotinic α7 receptor partial agonist, with a Ki of 6 nM for α7 human nAChR. Facinicline hydrochloride (RG3487 hydrochloride) improves cognition and sensorimotor gating in rodents. Facinicline hydrochloride (RG3487 hydrochloride) shows high affinity (antagonist) to 5-HT3Rs with a Ki value of 1.2 nM [1].
|
-
- HY-N15305
-
|
|
FXR
|
Inflammation/Immunology
|
|
Ferolin is the agonist for farnesoid X receptor (FXR) with an EC50 of 0.56 µM. Ferolin inhibits the expression of inflammatory genes (such as iNOS, IL-1β and TNFα) upon the FXR activation [1].
|
-
- HY-19307
-
|
|
Integrin
|
Inflammation/Immunology
|
|
SB-273005 is a potent nonpeptide and orally active integrin antagonist with Kis of 1.2 nM and 0.3 nM for αvβ3 receptor and αvβ5 receptor, respectively [1].
|
-
- HY-139043
-
|
|
Integrin
|
Inflammation/Immunology
|
|
6-B345TTQ is an α4 integrin inhibitor that inhibits α4-Leupaxin interaction. 6-B345TTQ can be used in inflammation research [1].
|
-
- HY-N5112
-
|
(Rac)-β,β-Dimethylacrylalkannin; (Rac)-β,β-Dimethylacrylshikonin
|
HIF/HIF Prolyl-Hydroxylase
|
Others
Cancer
|
|
(Rac)-Arnebin 1 ((Rac)-β,β-Dimethylacrylalkannin) is the racemate of β,β-Dimethylacrylalkannin and/or β,β-Dimethylacrylshikonin. β,β-Dimethylacrylalkannin and β,β-Dimethylacrylshikonin are napthoquinones isolated from Arnebia nobilis. β,β-Dimethylacrylshikonin has anti-tumor activity [1].
|
-
- HY-N8161
-
|
Kaempferol 3,7-diglucoside
|
Glycosidase
Cholinesterase (ChE)
|
Neurological Disease
|
|
Kaempferol-3,7-di-O-β-glucoside (Kaempferol 3,7-diglucoside), a flavonol, possesses enzyme inhibition property towards α-amylase, α-glucosidase and Acetylcholinesterase. Kaempferol-3,7-di-O-β-glucoside protects differentiating neuronal cells, SH-SY5Y from Amyloid β peptide-induced injury. Kaempferol-3,7-di-O-β-glucoside has the potential for Alzheimer's research [1].
|
-
- HY-W703826
-
|
|
Biochemical Assay Reagents
|
|
|
Benzyl 2-acetamido-2, 6-dideoxy-3-o-β-D-Galactopyranosyl-α-d-Galactopyranoside is a class of biochemical reagents used in glycobiology studies. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It deals with carbohydrate chemistry, glycan formation and degradation enzymology, protein-glycan recognition, and the role of glycans in biological systems. The field is closely related to basic research, biomedicine and biotechnology [1].
|
-
- HY-108473
-
|
TLR3-IN-1
|
Toll-like Receptor (TLR)
|
Cancer
|
|
CU-CPT 4a (TLR3-IN-1) is a potent, highly selective TLR3 signaling inhibitor. CU-CPT 4a represses the expression of downstream signaling pathways mediated by the TLR3/dsRNA complex, including TNF-α and IL-1β .
|
-
- HY-107509
-
|
|
mGluR
|
Neurological Disease
|
|
LY2389575 hydrochloride is a selective and noncompetitive mGlu3 negative allosteric modulator (NAM), with an IC50 value of 190 nM. LY2389575 hydrochloride induces an increase in Mrc1 levels. LY2389575 hydrochloride also independently amplifies Amyloid beta (Aβ) toxicity and can be used in study of Alzheimer's disease [1] .
|
-
- HY-N2509
-
|
Iristectrigenin B
|
LXR
|
Cardiovascular Disease
|
|
Iristectorigenin B (Iristectrigenin B) is a liver X receptor (LXR) modulator. Iristectrigenin B stimulates the transcriptional activity of both LXR-α and LXR-β .
|
-
- HY-N7661
-
|
|
PPAR
|
Metabolic Disease
|
|
4β-Hydroxywithanolide E, isolated from Physalis peruviana L., inhibits adipocyte differentiation of 3T3-L1 cells through modulation of mitotic clonal expansion. 4β-Hydroxywithanolide E is an adipogenesis inhibitor and inhibits PPARγ, C/EBPα, and the adipocyte-specific molecule aP2 mRNA expression [1].
|
-
- HY-N0176A
-
|
α-Dihydroqinghaosu; α-Artenimol
|
Drug Metabolite
Parasite
|
Infection
|
|
α-Dihydroartemisinin (α-Dihydroqinghaosu; α-Artenimol) is a antimalarial agent that can be found in Artemisia annua L [1].
|
-
- HY-117611
-
-
- HY-N2056R
-
|
|
Lipoxygenase
Leukotriene Receptor
NF-κB
|
Metabolic Disease
Cancer
|
|
11-Keto-beta-boswellic acid (Standard) is the analytical standard of 11-?Keto-?beta-?boswellic acid. This product is intended for research and analytical applications. 11-Keto-beta-boswellic acid (11-Keto-β-boswellic acid) is a pentacyclic triterpenic acid of the oleogum resin from the bark of the Boswellia serrate tree, popularly known as Indian Frankincense. 11-Keto-beta-boswellic acid has the anti-inflammatory activity is primarily due to inhibit 5-lipoxygenase (5-LOX) and subsequent leukotriene and nuclear factor-kappa B (NF-κB) activation and tumor necrosis factor alpha generation production [1].
|
-
- HY-133971
-
|
5α,6α-Epoxycholesterol
|
Liposome
|
Others
|
|
Cholesterol-5α,6α-epoxide is an epoxide derivative of cholesterol formed by the enzymatic oxidation of cholesterol in the liver and other tissues. Cholesterol-5α,6α-epoxide has unique chemical properties that make it an important intermediate in the biosynthesis of bile acids, which play a key role in the digestion and absorption of dietary fats. It also has a potential physiological role in regulating cholesterol metabolism and transport, although its biological function is not fully understood.
|
-
- HY-N0042
-
-
- HY-126414
-
|
|
Others
|
Inflammation/Immunology
|
|
Methylenedihydrotanshinquinone is a natural product that can be isolated from the dried root of S. miltiorrhiza. Methylenedihydrotanshinquinone has anti-inflammatory effect by inhibiting expression of TNF-α, IL-1β, and IL-8 [1].
|
-
- HY-152990
-
|
|
Nucleoside Antimetabolite/Analog
|
Others
|
|
Methyl 1,2,3,4-tetrahydro-α-hydroxy-2,4-dioxo-1-β-D-ribofuranosyl-5-pyrimidineacetate is a pyrimidine nucleoside analog. Pyrimidine nucleoside analogs have a wide range of biochemical and anticancer activities. These include DNA synthesis inhibition, RNA synthesis inhibition, antiviral effects, and immunomodulatory effects [1].
|
-
- HY-15536A
-
|
GRT6005 (1α,4α)stereoisomer
|
Opioid Receptor
|
Neurological Disease
|
|
Cebranopadol ((1α,4α)stereoisomer) is a stereoisomer of cebranopadol. Cebranopadol is a potent agonist activity on ORL-1.
|
-
- HY-138879B
-
|
(1S,5R)-CP-601927
|
nAChR
|
Neurological Disease
|
|
CP-601932 ((1S,5R)-CP-601927) is a high-affinity partial agonist at α3β4 nAChR (Ki=21 nM; EC50=~ 3 μM). CP-601932 has the same high-binding affinity at α4β2 nAChR (Ki=21 nM) and an order of magnitude lower affinity for α6 and α7 nAChR subtypes. CP-601932 selectively decreases ethanol but not sucrose consumption and operant self-administration following long-term exposure. CP-601932 can penetrate the CNS [1].
|
-
- HY-W703425
-
|
delta-5(6)-Norethindrone
|
Progesterone Receptor
|
Endocrinology
|
|
17α-Ethynyl-19-nor-Δ-5(6)-androsten-17β-ol-3-one (delta-5(6)-Norethindrone), an impurity of Norethindrone, is an anabolic agent. Norethindrone is a progestin athat can be used for endometriosis research [1].
|
-
- HY-A0144AR
-
|
|
Reference Standards
AMPK
Adrenergic Receptor
Akt
|
Cardiovascular Disease
|
|
Etilefrine hydrochloride (Standard) is the analytical standard of Etilefrine hydrochloride (HY-A0144A). This product is intended for research and analytical applications. Etilefrine hydrochloride is a sympathetic nerve agonist and AMPK activator that selectively targets α1/β1 adrenergic receptors. Etilefrine hydrochloride stimulates α1 adrenergic receptors, leading to contraction of vascular smooth muscle and increased peripheral resistance. Etilefrine hydrochloride also stimulates β1 receptors to enhance myocardial contractility and increase heart rate, thereby increasing blood pressure and improving cardiac output. Etilefrine hydrochloride also bidirectionally regulates the AMPK/Akt pathway and modulates the phosphorylation levels. Etilefrine hydrochloride can be used in cardiovascular research, such as postural hypotension, chylothorax, and improving low cardiac output [1] .
|
-
- HY-137393
-
-
- HY-W129394
-
|
|
Biochemical Assay Reagents
|
Others
|
|
6-Amino-6-deoxy-β-cyclodextrin is a cyclodextrin derivative that can be used to prepare other cyclodextrin derivatives. 6-Amino-6-deoxy-β-cyclodextrin can also be used as a chiral selector for chiral separation of α-amino acid derivatives by capillary electrophoresis [1].
|
-
- HY-P1047
-
|
[Pro18, Asp21] β-Amyloid (17-21)
|
Amyloid-β
|
Neurological Disease
|
|
β-Sheet Breaker Peptide iAβ5 is an effective brain amyloid-β (Abeta) degrader. Abeta deposits are associated with Alzheimer's disease (AD), and the related toxicity arises from its β-sheet conformation and aggregation. β-Sheet Breaker Peptide iAβ5 can repeatedly induce the degradation of fibrillary amyloid deposits in vivo. Therefore, β-Sheet Breaker Peptide iAβ5 can prevent and/or reverse neuronal contraction caused by Abeta and reduce the range of interleukin IL-1beta positive microglial-like cells around Abeta deposits. β-Sheet Breaker Peptide iAβ5 can reduce the size and/or number of brain amyloid plaques in AD. β-Sheet Breaker Peptide iAβ5 is labeled with a hydrophobic benzyl alcohol (HBA) tag and shows a bright blue color under acidic conditions, which can be used for quantitative determination.
|
-
- HY-146225
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-2 (compound 5) is a potent α-amylase and α-glucosidase dual inhibitor with IC50 values of 13.02, 13.09 µM for α-amylase and α-glucosidase, respectively. α-Amylase/α-Glucosidase-IN-2 has the potential for the research of diabetic complications [1].
|
-
- HY-N10163
-
|
(+)-1β,10β-Epoxydesacetoxymatricarin
|
Others
|
Others
|
|
1β,10β-Epoxydesacetoxymatricarin is a sesquiterpenoids that can be isolated from Carthamus oxycantha [1].
|
-
- HY-N2853
-
|
α-Tocopherylquinone
|
Others
|
Cancer
|
|
D-α-Tocopherylquinone (α-Tocopherylquinone) is a quinone, can be isolated from Phaeodactylum tricornutum. D-α-Tocopherylquinone is a oxidation product of α-Tocopherol (vitamin E). D-α-Tocopherylquinone can act as an anticoagulant and as an antioxidant [1] .
|
-
- HY-147711
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-1 (compound 33) is a potent α-amylase/α-glucosidase inhibitor with IC50s of 2.01, 2.09 µM for α-amylase and α-glucosidase, respectively. Kinetic studies predict that α-Amylase/α-Glucosidase-IN-1 has the potential of anti hyperglycemia [1].
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
|
-
- HY-101393A
-
|
(±)-CGP 12177 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
CGP 12177 ((±)-CGP 12177) hydrochloride is a β Adrenergic Receptor Ligand. CGP 12177 hydrochloride is a high affinity antagonist of β1- and β2-AR. CGP 12177 hydrochloride is also shown to interact, with a lower affinity, with the β3-AR and to exhibit a partial agonist activity on rodent and human β3-AR. CGP 12177 hydrochloride exhibits partial agonist properties for α1-AR in rat pulmonary artery [1].
|
-
- HY-131368A
-
|
Tre6P
|
Endogenous Metabolite
|
Others
|
|
α,α-Trehalose 6-phosphate (T6P) is an endogenous metabolite. α,α-Trehalose 6-phosphate is a 6-phosphate derivative of α,α′-trehalose. α,α-Trehalose 6-phosphate is rapidly converted to the pathway end product, α,α′-trehalose, through the action of Tre6P phosphatase (T6PP) [1].
|
-
- HY-131368
-
|
Tre6P potassium
|
Endogenous Metabolite
|
Others
|
|
α,α-Trehalose 6-phosphate (Tre6P) potassium is an endogenous metabolite. α,α-Trehalose 6-phosphate is a 6-phosphate derivative of α,α′-trehalose. α,α-Trehalose 6-phosphate is rapidly converted to the pathway end product, α,α′-trehalose, through the action of Tre6P phosphatase (T6PP) [1].
|
-
- HY-168522
-
|
|
Integrin
|
Inflammation/Immunology
|
|
αvβ6-IN-2 (compound 20) is a potent and orally active αvβ6 integrin inhibitor with a pIC50 value of 7.8. αvβ6-IN-2 has the potential for the research of idiopathic pulmonary fibrosis [1].
|
-
- HY-168521
-
|
|
Integrin
|
Inflammation/Immunology
|
|
αvβ6-IN-1 (compound 28) is a potent and orally active αvβ6 integrin inhibitor with a pIC50 value of 8.1. αvβ6-IN-1 has the potential for the research of idiopathic pulmonary fibrosis [1].
|
-
- HY-P990667
-
|
|
Integrin
|
Inflammation/Immunology
|
|
STX-100 is a humanized antibody expressed in CHO cells, targeting Integrin aVb6 (ITGAV & ITGB6). STX-100 has a huIgG1 heavy chain and a huκ light chain, with a predicted molecular weight (MW) of 145.12 kDa. The isotype control for STX-100 can be referenced as Human IgG1 kappa, Isotype Control (HY-P99001).
|
-
- HY-133971S
-
-
- HY-147423
-
-
- HY-121186
-
-
- HY-15310
-
|
MK-933; CD-5024; K-237
|
Flavivirus
Dengue Virus
Parasite
HIV
Mitophagy
HSV
SARS-CoV
Antibiotic
Autophagy
Bacterial
|
Infection
Cancer
|
|
Ivermectin (MK-933) is a broad-spectrum anti-parasite agent. Ivermectin (MK-933) is a specific inhibitor of Impα/β1-mediated nuclear import and has potent antiviral activity towards both HIV-1 and dengue virus. It is a positive allosteric effector of P2X4 and the α7 neuronal nicotinic acetylcholine receptor (nAChRs). Ivermectin also inhibits bovine herpesvirus1 (BoHV-1) replication and inhibits BoHV-1 DNA polymerase nuclear import [1] . Ivermectin is a candidate therapeutic against SARS-CoV-2/COVID-19 .
|
-
- HY-120783
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Lu AF58801 is a potent, orally available, brain-penetrant positive allosteric modulator of α7 nicotinic acetylcholine receptors with efficacy in a novel object recognition task in mice. Lu AF58801 was shown to selectively enhance the activity of α7 nicotinic acetylcholine receptors. Lu AF58801 was able to improve cognitive function in mice treated with subchronic fluchlorothiazol (PCP) [1].
|
-
- HY-173049
-
|
|
α-synuclein
|
Neurological Disease
|
|
2N4R Tau/α-Syn against-1 (Compound 4d) targets α-synuclein and tau protein, inhibits the fibrillation and oligomer formation of α-synuclein and tau proteins, exhibits disaggregation activity on Aβ fibers. 2N4R Tau/α-Syn against-1 can be used in research of Parkinson's disease and Alzheimer's disease [1].
|
-
- HY-150857S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
Thymine-α,α,α,6-d4 Glycol (mixture of diastereomers)-d4 is the deuterium labeled Thymine-α,α,α,6-d4 Glycol (mixture of diastereomers)[1].
|
-
- HY-168961
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-18 (Compound 9g) is the inhibitor for α-Amylase and α-Glucosidase with IC50 of 49.17 nM and 10.71 nM. α-Amylase/α-Glucosidase-IN-18 can be used in research of type 2 diabetes mellitus [1].
|
-
- HY-172211
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
Cancer
|
|
α-Amylase/α-Glucosidase-IN-17 (Compound 3) is an inhibitor of α-amylase and α-glucosidase, with IC50 values of 14.61 μM and 25.38 μM, respectively. α-Amylase/α-Glucosidase-IN-17 has certain inhibitory activity against A549 cancer cells. α-Amylase/α-Glucosidase-IN-17 has anti-tumor and anti-diabetic effects [1].
|
-
- HY-153416
-
|
|
Amyloid-β
|
Neurological Disease
|
|
QR-0217 is a potent Aβ1-40 aggregation inhibitor with an IC50 value of 7.5 µM. QR-0217 inhibits α-synuclein aggregation. QR-0217 reduces memory impairments caused by Aβ neurotoxicity [1].
|
-
- HY-N9487
-
|
(-)-α-Phellandrene
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
(R)-(-)-α-Phellandrene ((-)-α-Phellandrene) is an the (R)-(-)-stereoisomer of α-phellandrene. α-phellandrene is an orally active cyclic monoterpene that attenuates inflammatory response, and induces DNA damage [1] .
|
-
- HY-100608
-
BMS453
1 Publications Verification
BMS-189453
|
RAR/RXR
|
Cancer
|
|
BMS453 (BMS-189453), a synthetic retinoid, is a RARβ agonist and a RARα/RARγ antagonist. BMS453 inhibits breast cell growth predominantly through the induction of active TGFβ .
|
-
- HY-121615
-
|
Alpha-Phellandrene
|
Insecticide
Apoptosis
Autophagy
NO Synthase
|
Infection
Neurological Disease
Inflammation/Immunology
Cancer
|
|
α-Phellandrene (alpha-Phellandrene) is an orally active monoterpenoid and insecticide. α-Phellandrene can be isolated from plant essential oils. α-Phellandrene induces Apoptosis and Autophagy. α-Phellandrene promotes cAMP signaling pathway and increases NO production. α-Phellandrene has anti-inflammatory and anticancer (sarcoma) activities. α-Phellandrene shows insecticidal activity against Lucilia cuprina L3. α-Phellandrene reduces mechanical hyperalgesia [1] [7] .
|
-
- HY-E70524
-
|
|
PAI-1
|
Cardiovascular Disease
|
|
Alpha 2 Antiplasmin, Human Plasma is Alpha-2 antiplasmin from human plasma. Alpha-2 antiplasmin is the major circulating inhibitor of plasmin. Alpha-2 antiplasmin plays a determining role in the regulation of intravascular fibrinolysis [1].
|
-
- HY-135483A
-
|
|
nAChR
|
Neurological Disease
|
|
AR-R17779 hydrochloride is a potent and selective full agonist of nAChR, with Kis of 92 and 16000 nM for α7 and α4β2 subtype, respectively. AR-R17779 hydrochloride can improve learning and memory in rats. AR-R17779 hydrochloride also has anxiolytic activity. AR-R17779 hydrochloride can reduce inflammation by activating antiinflammatory cholinergic (vagal) pathways [1] .
|
-
- HY-162390
-
|
|
Amylases
Glycosidase
|
Endocrinology
|
|
α-Amylase/α-Glucosidase-IN-11 (Compound 5d) is a isoxazolidine-isatin hybrid with significant antidiabetic activity. α-Amylase/α-Glucosidase-IN-11 competitively inhibits α-amylase (IC50 = 30.39 μM) and α-glucosidase (IC50 = 65.1 μM), two key digestive enzymes. α-Amylase/α-Glucosidase-IN-11 does not cross the blood-brain barrier [1].
|
-
- HY-162169
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-8 (Compound 7p) is a potent dual inhibitor of α-amylase and α-glucosidase, with IC50s of 10.19 and 10.33 μM, respectively. α-Amylase/α-Glucosidase-IN-8 has good anti-oxidant activity(IC50 = 14.93 μM). α-Amylase/α-Glucosidase-IN-8 can be used for the research of diabetes [1].
|
-
- HY-131997
-
|
|
GABA Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
2'MeO6MF is a brain-penetrant positive allosteric modulator at α2β1γ2L and all α1-containing GABAA receptors. 2'MeO6MF also can directly activate α2β2/3 and α2β2/3γ2L GABAA receptors. 2'MeO6MF has anxiolytic and psychomotor stabilizing properties. 2'MeO6MF offers neuroprotection and improved functional recovery and dampens the stroke-induced inflammatory response [1] .
|
-
- HY-161469
-
-
- HY-N2168R
-
|
(+)-Pinoresinol 4-O-β-D-glucopyranoside (Standard)
|
Glycosidase
Estrogen Receptor/ERR
Phosphodiesterase (PDE)
|
Neurological Disease
Metabolic Disease
Cancer
|
|
Pinoresinol 4-O-β-D-glucopyranoside (Standard) is the analytical standard of Pinoresinol 4-O-β-D-glucopyranoside (HY-N2168). This product is intended for research and analytical applications. Pinoresinol 4-O-β-D-glucopyranoside is an orally active α-glucosidase inhibitor, with an IC50 of 48.13 μg/mL. Pinoresinol 4-O-β-D-glucopyranoside binds to estrogen receptors. Pinoresinol 4-O-β-D-glucopyranoside inhibits phosphodiesterase. Pinoresinol 4-O-β-D-glucopyranoside exhibits various activities such as antioxidant, anti-inflammatory, anti-hyperglycemic, hepatoprotective and anti-epileptic effects [1] [7] .
|
-
- HY-154972
-
|
|
Glycosidase
Amylases
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-3 (Compound 17) is an α-Amylase/α-Glucosidase dual inhibitor, with IC50s of 0.70 μM and 1.10 μM. α-Amylase/α-Glucosidase-IN-3 can be used for research of type-II diabetes mellitus [1].
|
-
- HY-149557
-
|
|
Glycosidase
Amylases
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-5 (compound 4l) is a dual inhibitor of α-glucosidase (Glucosidase) and α-amylase (Amylases) with IC50s of 5.96 μM and 1.62 μM, respectively. α-Amylase/α-Glucosidase-IN-4 has potential antidiabetic activity [1].
|
-
- HY-162673
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-16 (compound 15) is a potent dual inhibitor of α-amylase and α-Glucosidase with IC50 values of 0.8 and 1.2 μM, respectively. α-Amylase/α-Glucosidase-IN-16 can be used in the study of diabetes mellitus (DM) [1].
|
-
- HY-156380
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-6 (compound 5j) is a potent dual inhibitor of α-amylase and α-glucosidase, with IC50s of 17.0 and 40.1 µM, respectively. α-Amylase/α-Glucosidase-IN-6 exhibits anti-hyperglycemic activities [1].
|
-
- HY-155241
-
|
|
Glycosidase
Amylases
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-4 (compound 5) is a dual inhibitor of α-glucosidase (Glucosidase) and α-amylase (Amylases) with IC50s of 0.15 μM and 1.10 μM, respectively. α-Amylase/α-Glucosidase-IN-4 has potential antidiabetic activity [1].
|
-
- HY-B0892S
-
-
- HY-N10564
-
|
|
P-glycoprotein
|
Cancer
|
|
8α,9α-Epoxycoleon-U-quinone (compound 3) is a p-glycoprotein (P-gp) regulator that is selective for cancer cells (SI=2.0). 8α,9α-Epoxycoleon-U-quinone effectively inhibits P-gp activity in NCI-H460/R cells. 8α,9α-Epoxycoleon-U-quinone also reverses the resistance of cancer cells to Doxorubicin (DOX) (HY-15142A) and enhances the anticancer effect of DOX [1].
|
-
- HY-W127508
-
|
|
Biochemical Assay Reagents
|
Others
|
|
α,α'-Dilaurin is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-W052144
-
|
|
Endogenous Metabolite
|
Others
|
|
(±) Anabasine is the racemate of Anabasine (HY-B1532). Anabasine is an agonist of α7nAChR and exhibits anti-inflammatory and insecticidal activities [1].
|
-
- HY-107682
-
-
- HY-162036
-
|
|
Glycosidase
Amylases
Cholinesterase (ChE)
|
Neurological Disease
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-7 (Compound 3f) is a competitive α-glucosidase and α-amylase enzyme inhibitor with IC50 values of 18.52 and 20.25 µM, respectively. α-Amylase/α-Glucosidase-IN-7 can also effectively inhibit AChE and BChE, with IC50 values of 9.25 and 10.06 µM respectively. α-Amylase/α-Glucosidase-IN-7 can be used in diabetes and Alzheimer’s research [1].
|
-
- HY-160831
-
|
PQQ-TME
|
α-synuclein
|
Neurological Disease
|
|
PQQ-trimethylester (PQQ-TME) is a synthetic compound that is a trimethylester derivative of pyrroloquinoline quinone (PQQ). PQQ-trimethylester has twice the blood-brain barrier permeability of PQQ (HY-100196) in vitro. In addition, PQQ-trimethylester shows strong inhibitory activity against α-synuclein, amyloid β1-42 (Aβ1-42) and prion protein fibrillation. PQQ-trimethylester can be used in the study of neurodegenerative diseases [1].
|
-
- HY-B1615
-
|
NAB-365
|
Adrenergic Receptor
|
Inflammation/Immunology
|
|
Clenbuterol (NAB-365) is a β2-adrenergic receptor agonist with an EC50 of 31.9 nM [1]. Clenbuterol is a very potent inhibitor of the lipopolysaccharide (LPS)-induced release of TNF-α and IL-1β. Clenbuterol can inhibit the inflammatory process. Clenbuterol is a bronchodilator .
|
-
- HY-130529
-
|
OH-α-Pyrrolidinovalerophenone TFA
|
Endogenous Metabolite
|
Metabolic Disease
|
|
OH-α-PVP (OH-α-Pyrrolidinovalerophenone ) TFA is a metabolite of α-pyrrolidinovalerophenone. α-pyrrolidinovalerophenone is a synthetic stimulant of the cathinone class [1] .
|
-
- HY-172622
-
-
- HY-146776S
-
-
- HY-N1163
-
-
- HY-P5859
-
|
α-PMTX
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
α-Pompilidotoxin (α-PMTX) is a neurotoxin that can be obtained from the venom of Anoplius safnariensis. α-Pompilidotoxin reversibly and dose-dependently enhances excitatory postsynaptic currents (EPSCs). α-Pompilidotoxin is a useful tool in the field of neuroscience research [1].
|
-
- HY-170056
-
-
- HY-112642
-
|
|
TNF Receptor
|
Cancer
|
|
9-Methoxycanthin-6-one, a canthin-6-one alkaloid, is present in intact plant parts and in callus tissues of different explants. 9-Methoxycanthin-6-one shows anti-tumor activity, inhibits LPS-induced TNF-α and IL-1β .
|
-
- HY-107324
-
|
(-)-β-Elemene; Levo-β-elemene
|
Apoptosis
|
Cancer
|
|
β-Elemene ((-)-β-Elemene; Levo-β-elemene) is isolated from natural plant Curcuma aromatica with an antitumor activity. β-Elemene can induce cell apoptosis.
|
-
- HY-114656
-
-
- HY-130502
-
|
Cholesterol 5beta,6beta-epoxide
|
Biochemical Assay Reagents
|
Others
|
|
5β,6β-epoxycholestanol is an oxidative metabolite of cholesterol formed by free-radical and non-radical oxidation of cholesterol at the 5,6 double bond. Induces lactate dehydrogenase (LDH) release and apoptosis in macrophage-differentiated U937 cells. Cholesterol 5beta,6beta-epoxide has been found in human fatty streaks and advanced atherosclerotic lesions, but not in normal aortic tissue [1] .
|
-
- HY-N1646
-
|
2β,16α-dihydroxy-ent-kaurane 2-O-β-D-allopyranoside
|
Others
|
Others
|
|
2,16-Kauranediol 2-O-β-D-allopyranoside (compound 26) is a natural product that can be isolated from the air-dried fronds of Pteris cretica [1].
|
-
- HY-N1467
-
|
(S)-α-Terpineol
|
Others
|
Others
|
|
(-)-α-Terpineol ((S)-α-Terpineol), a monoterpene compound, is one of compounds in Melaleuca alternifolia. (-)-α-Terpineol has antioxidant and anti-inflammatory activities [1] .
|
-
- HY-P9970A
-
|
Avakine (Anti-TNF-α); CT-P13 (Anti-TNF-α)
|
TNF Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Infliximab (Anti-TNF-α) (Avakine (Anti-TNF-α)) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α. Infliximab (Anti-TNF-α) prevents the interaction of TNF-α with TNF-α receptor (TNFR1 and TNFR2). Infliximab (Anti-TNF-α) has the potential for autoimmune, chronic inflammatory diseases and diabetic neuropathy research [1] .
|
-
- HY-162634
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-15 (compound 6C) is an oral bioactive inhibitor of α-Glucosidase and α-amylase, with the IC50s of 21 μM and 61 μM, respectively [1].
|
-
- HY-N0611
-
|
α-Boswellic acid
|
Others
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
alpha-Boswellic acid (α-Boswellic acid) is an orally active pentacyclic triterpenoid compound that can be extracted from frankincense. alpha-Boswellic acid has anti-inflammatory and antitumor activities. alpha-Boswellic acid can be used in Alzheimer's disease (AD) research [1] .
|
-
- HY-N8459
-
|
α-CBD
|
EBV
|
Cancer
|
|
α-Cembrenediol is a potent inhibitor of EBV.α-Cembrenediol inhibits the early antigen of the Epstein-Bar virus. α-Cembrenediol also has anti-tumour activity [1].
|
-
- HY-19667
-
|
DPC 333
|
TNF Receptor
|
Inflammation/Immunology
|
|
BMS-561392 is a TNF alpha-converting enzyme (TACE) inhibitor. BMS-561392 is also an ADAM17 blocker. BMS-561392 can be used for research of inflammatory bowel disease [1] .
|
-
- HY-N9960
-
-
- HY-N2766
-
|
|
Others
|
Others
|
|
8alpha-Hydroxy-alpha-gurjunene is a Sesquiterpenoids product that can be isolated from the herbs of Sarcandra glabra [1].
|
-
- HY-161355
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-9 (compound 5h) is a dual inhibitor for both α-amylase (IC50 = 16.4 μM) and α-glucosidase (IC50 = 31.6 μM) enzymes [1].
|
-
- HY-114269
-
|
|
nAChR
|
Neurological Disease
|
|
(-)-(S)-B-973B is a potent allosteric agonist and positive allosteric modulator of α7 nAChR, with antinociceptive activity [1].
|
-
- HY-11053
-
|
|
nAChR
|
Neurological Disease
|
|
S 24795 is a partial agonist of α7 nAChR and improves mnemonic function in aged mice for the research of aging-related memory disturbances [1].
|
-
- HY-133966S
-
-
- HY-162373
-
|
|
Amylases
Glycosidase
P-glycoprotein
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-10 (compound 5d) is an α-amylase and α-glucosidase inhibitor (IC50: 30.39 μM and 65.1 μM) with potential diabetes inhibitory effects. α-Amylase/α-Glucosidase-IN-10 exhibits high gastrointestinal (GI) absorption in ADMET (Absorption, Distribution, Metabolism, Excretion and Toxicity) prediction. While α-Amylase/α-Glucosidase-IN-10 acts as a substrate for P-gp and does not cross the blood-brain barrier (BBB), there may be a risk of central nervous system side effects [1].
|
-
- HY-162635
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-14 (compound 6E) is an oral bioactive inhibitor of α-amylase and α-glucosidase, with the IC50s of 45.53 μM and 27.73 μM, respectively [1].
|
-
- HY-N0803
-
|
β-Myrcene
|
NF-κB
|
Others
|
|
Myrcene (β-Myrcene) is a type of aromatic compound that inhibits TNFα and NF-κB activity. Myrcene has anti-invasive action, inhibits cell cycle, and leads to cancer cell apoptosis. Myrcene has strong blood protection effect, anti-inflammation, and anti-inflammatory activity.
|
-
- HY-163439
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase/α-Glucosidase-IN-12 (compound 10k) is a dual inhibitor targeting α-glucosidase and α-amylase with IC50 of 34.52 nM and 24.62 nM, respectively. α-Amylase/α-Glucosidase-IN-12 is an inhibitor designed based on triazolo[4,3-b][1,2,4]triazine and has the potential to be used in diabetes research [1].
|
-
- HY-N9083
-
|
|
Others
|
Others
|
|
8α-Hydroxy-α-gurjunene is a Flavonoids product that can be isolated from the aerial parts of Sophora tomentosa L. [1].
|
-
- HY-14857
-
|
HCA2969
|
Integrin
|
Inflammation/Immunology
|
|
Carotegrast (HCA2969) is an orally active α4 integrin inhibitor with anti-inflammatory activity. Carotegrast can be used in the research of inflammation-related diseases, such as ulcerative colitis [1] .
|
-
- HY-12153
-
|
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
JNJ-1930942 is a selective and blood-brain barrier (BBB) penetrant α(7) nAChR positive allosteric modulator.JNJ-1930942 enhances the Choline (HY-B0282)-evoked rise in intracellular Ca 2+ levels and neurotransmission at hippocampal dentate gyrus synapses. JNJ-1930942 reverses the naturally occurring sensory gating deficit in DBA/2 mice [1].
|
-
- HY-B0072
-
-
- HY-N15128
-
-
- HY-34738
-
|
3-(Boc-amino)-1-propanol
|
Amino Acid Derivatives
|
Others
|
|
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity [1].
|
-
- HY-N9960R
-
|
α-IPM (Standard)
|
Others
|
Others
|
|
α-Isopropylmalate (Standard) is the analytical standard of α-Isopropylmalate. This product is intended for research and analytical applications. α-Isopropylmalate (α-IPM) is the leucine biosynthetic precursor in Yeast [1].
|
-
- HY-N9145
-
|
|
Others
|
Others
|
|
1beta,10beta-Epoxydehydroleucodin is a Sesquiterpenoids product that can be isolated from the roots of Scorzonera latifolia [1].
|
-
- HY-N13295
-
|
Ethyl α-(β-D-glucopyranosyloxy)-1H-indole-3-propanoate
|
Endogenous Metabolite
|
Others
|
|
Indole-3-lactate-O-β-D-glucopyranoside is an endogenous metabolite that acts as a plant growth regulator [1].
|
-
- HY-E70525
-
|
|
Ser/Thr Protease
|
Infection
Neurological Disease
Inflammation/Immunology
|
|
Alpha 2 Macroglobulin, Human Plasma is an alpha 2 macroglobulin from human Plasma. Alpha 2 Macroglobulin is a broad-spectrum protease inhibitor. Alpha 2 Macroglobulin is also a regulator of extracellular proteolysis. Alpha 2 Macroglobulin switchs proteolysis towards small substrates. Alpha 2 Macroglobulin can be used in Alzheimer's disease, inflammation, immunity and infection research [1] .
|
-
- HY-N8847
-
|
Alpha-Ionone
|
Hippo (MST)
YAP
Olfactory Receptor
Apoptosis
|
Cancer
|
|
α-Ionone (alpha-Ionone) is an activator of the olfactory receptor OR10A6. α-Ionone induces apoptosis by activating OR10A6 and increasing the phosphorylation of the LATS-YAP-TAZ signaling axis in the Hippo pathway. α-Ionone can inhibit tumor formation both in vivo and in vitro [1].
|
-
- HY-N0683
-
-
- HY-110246
-
|
|
Formyl Peptide Receptor (FPR)
|
Inflammation/Immunology
|
|
Quin C1 is a highly specific and potent agonist for formyl peptide receptor 2 (FPR2/ALX). Quin-C1 significantly reduces the neutrophil and lymphocyte counts in BALF, diminishes expression of TNF-α, IL-1β, KC, and TGF-β1, and decreases collagen deposition in lung tissue. Quin C1 has the potential for the research of lung injury [1].
|
-
- HY-N0506
-
|
|
Interleukin Related
|
Neurological Disease
|
|
Rosarin is a cinnamyl alcohol?glycoside isolated from?Rhodiola rosea. Rosarin has anti-inflammatory and neuroprotective effects. Rosarin supresses the expression of the proinflammatory factors iNOS, IL-1?β, and TNF- α in the kidney and prefrontal cortex of brain in mice? [1].
|
-
- HY-133890A
-
|
T-α-MCA sodium
|
Endogenous Metabolite
FXR
|
Others
|
|
Tauro-α-muricholic acid (T-α-MCA) sodium is a FXR (Farnesoid X receptor) antagonist (IC50=28μM). Tauro-α-muricholic acid sodium is also a endogenous metabolite that can be found in cecal [1] .
|
-
- HY-133890
-
|
T-α-MCA
|
Endogenous Metabolite
FXR
|
Cardiovascular Disease
Others
Metabolic Disease
|
|
Tauro-alpha-muricholic acid (T-alpha-MCA) is a bile acid that belongs to a class of compounds that are synthesized in the liver and play an important role in the digestive process. Tauro-α-muricholic acid activates Farni X receptors (FXR) which are involved in the regulation of bile acid synthesis, metabolism and transport. Tauro-alpha-muricholic acid can be used in the study of metabolic syndrome and cardiovascular disease [1].
|
-
- HY-123076
-
|
PFN-α
|
MDM-2/p53
|
Neurological Disease
|
|
Pifithrin-α, p-Nitro, Cyclic (PFN-α) is cell-permeable and active-form p53 inhibitor. Pifithrin-α, p-Nitro, Cyclic is one order magnitude more active than Pifithrin-α in protecting cortical neurons exposed to Etoposide (ED50=30 nM). Pifithrin-α, p-Nitro, Cyclic behaves as a p53 posttranscriptional activity inhibitor. Pifithrin-α, p-Nitro, Cyclic do not prevent p53 phosphorylation on the S15 residue [1] .
|
-
- HY-103066
-
|
|
nAChR
|
Neurological Disease
|
|
Br-PBTC is a potent, 2/4 subtype-selective positive allosteric modulator of nAChRs (nicotinic acetylcholine receptors) with α2β2, α2β4, α4β2, α4β4, (α4β2)2α4 and (α4β2)2β2 EC50 ranges from 0.1-0.6 μM. Br-PBTC acts from the c-tail of an α subunit [1].
|
-
- HY-12753A
-
|
SR35021 hydrochloride
|
Thyroid Hormone Receptor
|
Cardiovascular Disease
|
|
Debutyldronedarone (SR35021) hydrochloride, the main metabolite of Dronedarone, is a selective thyroid hormone receptor α1 (TRα1) inhibitor. Debutyldronedarone hydrochloride inhibits T3 binding to TRα1 and TRβ1 by 77% and 25%, respectively. Debutyldronedarone hydrochloride can be used for the research of arrhythmic [1].
|
-
- HY-122585
-
|
|
MMP
Src
FAK
|
Cancer
|
|
proMMP-9 inhibitor-3c (compound 3c) is a potent proMMP-9 inhibitor. proMMP-9 inhibitor-3c is specific for binding to the proMMP-9 hemopexin-like domain (Kd=320 nM). proMMP-9 inhibitor-3c disruption of MMP-9 homodimerization prevents association of proMMP-9 with both α4β1 integrin and CD44 and results in the dissociation of EGFR. This disruption results in decreased phosphorylation of Src and its downstream target proteins focal adhesion kinase (FAK) and paxillin (PAX) [1].
|
-
- HY-W145496
-
|
β-D-Glc-(1-3)-D-Glc
|
Biochemical Assay Reagents
|
Others
|
|
Laminaribiose is a disaccharide consisting of two glucose molecules linked by a β-1,3-glycosidic bond. It is ubiquitous in the cell walls of various plants and is a hydrolyzate of the polysaccharide laminarin. Laminaribiose has various applications in biochemical research, especially as a substrate for enzymes involved in carbohydrate metabolism. In addition, it can be used as a carbon source and dietary supplement for certain microorganisms.
|
-
- HY-N1720
-
|
|
Others
|
Others
|
|
2α,3α,24-Trihydroxyolean-12-en-28-oic acid (compound 5) is a terpenoid that is isolated from the branches and leaves of Pyrus pashia. 2α,3α,24-Trihydroxyolean-12-en-28-oic acid shows cytotoxic activity [1].
|
-
- HY-N7768
-
-
- HY-N11598
-
|
|
Others
|
Metabolic Disease
|
|
α-GLU stands for α-glucosidase. α-GLU hydrolyzes starch and disaccharides via targeting to terminal, non-reducing (1→4)-linked α-D-glucose residues to produce α-glucose. α-GLU is substrate selective [1].
|
-
- HY-115854
-
|
|
GABA Receptor
|
Neurological Disease
|
|
Ro 15-1310 is an imidazobenzodiazepine that exhibits high affinity and selectivity for alpha 5-containing GABAA receptors. Ro 15-1310 is promising for research of convulsions [1].
|
-
- HY-107678
-
|
WAY-317538
|
nAChR
|
Neurological Disease
|
|
SEN 12333 (WAY-317538) is a potent, selective and orally active α7 nAChR agonist. SEN12333 displays high affinity for the rat α7 nAChRs expressed in GH4C1 cells (K>i=260 nM) and acts as full agonist in functional Ca 2+ flux studies (EC50=1.6 μM). SEN 12333 is used for AD and schizophrenia research [1].
|
-
- HY-B0446
-
|
Naphthazoline hydrochloride
|
Adrenergic Receptor
TNF Receptor
Interleukin Related
VEGFR
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Naphazoline (Naphthazoline) hydrochloride is a potent α-adrenergic receptor agonist. Naphazoline hydrochloride reduces vascular hyperpermeability and promotes vasoconstriction. Naphazoline hydrochloride reduces the levels of inflammatory factors (TNF-α, IL-1β and IL-6), cytokines (IFN-γ and IL-4), IgE, GMCSF, and NGF. Naphazoline hydrochloride can be used for non-bacterial conjunctivitis research [1] .
|
-
- HY-111326
-
-
- HY-P3976
-
|
|
Angiotensin-converting Enzyme (ACE)
|
Cardiovascular Disease
|
|
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure [1].
|
-
![Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine](//file.medchemexpress.com/product_pic/hy-p3976.gif)
- HY-P99447
-
|
|
Bacterial
|
Infection
|
|
Atidortoxumab is a human IgG1κ monoclonal antibody that targets Staph aureus alpha toxin [1].
|
-
- HY-N0604R
-
|
Prosapogenin A2 (Standard); Sanchinoside B2 (Standard); Sanchinoside Rh1 (Standard)
|
Interleukin Related
PPAR
TNF Receptor
Endogenous Metabolite
|
Inflammation/Immunology
|
|
Ginsenoside Rh1 (Standard) is the analytical standard of Ginsenoside Rh1. This product is intended for research and analytical applications. Ginsenoside Rh1 (Prosapogenin A2) inhibits the expression of PPAR-γ, TNF-α, IL-6, and IL-1β.
|
-
- HY-168087
-
|
|
Integrin
|
Cardiovascular Disease
|
|
GSK3335103 is an orally active, non-peptide αvβ6 integrin inhibitor (pIC50=8). GSK3335103 can be used in the study of pulmonary fibrosis [1].
|
-
- HY-103687
-
|
3β-OH-5α-Abi
|
Drug Metabolite
|
Cancer
|
|
Abiraterone metabolite 1 is a 5β-reduced metabolite of abiraterone. Abiraterone, a steroidal agent, inhibits CYP17A1, blocks androgen synthesis and prolongs survival in prostate cancer.
|
-
- HY-N9040
-
|
|
Others
|
Others
|
|
6β-Angeloyloxy-1β,10β-epoxy-9-oxo-furaneremophilane is a Sesquiterpenoids product that can be isolated from the herbs of Ligularia songarica. [1].
|
-
- HY-W039849
-
|
Ethyl α-thioglucopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
Ethyl-α-D-thioglucopyranoside (Ethyl α-Thioglucopyranoside) is a glycoside present in sake, Japanese rice wine. Ethyl-α-D-thioglucopyranoside is a glycosyl donor [1].
|
-
- HY-150536
-
|
|
HIV
HIV Protease
|
Infection
|
|
EP39 is a potent HIV-1 maturation inhibitor. EP39 interacts with the SP1 domain of Gag. EP39 decreases the dynamics of CA-SP1 junction, by binding to the QVT motif of the SP1 domain, and perturbs the natural coil-helix equilibrium on both sides of the SP1 domain by stabilizing the transient alpha helical structure. EP39 acts by arresting maturation of HIV-1 thereby blocking its infectivity [1].
|
-
- HY-147295
-
|
BTH 1677; Imprime PGG
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
|
Odetiglucan is a novel β-glucan that is a potent immunostimulant and a Dectin-1 (CLEC7A) agonist. Odetiglucan activates innate immune effector cells and triggers a coordinated anti-cancer immune response [1] .
|
-
- HY-P5796
-
|
|
Calcium Channel
|
Neurological Disease
|
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells [1].
|
-
- HY-151954
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
TGFβ1-IN-2 is a diarylacylhydrazones derivative that effectively suppresses the activation and proliferation of fibroblasts. TGFβ1-IN-2 can be used for idiopathic pulmonary fibrosis (IPF) research [1].
|
-
- HY-151955
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
TGFβ1-IN-3 is a diarylacylhydrazones derivative that effectively suppresses the activation and proliferation of fibroblasts. TGFβ1-IN-3 can be used for idiopathic pulmonary fibrosis (IPF) research [1].
|
-
- HY-119418
-
|
|
Estrogen Receptor/ERR
|
Cancer
|
|
Desketoraloxifene is an estrogen receptors alpha (ERα) activator at an AP-1 site. Desketoraloxifene can be used for the research of osteoporosis and breast cancer [1].
|
-
- HY-E70059
-
|
|
Glucosylceramide Synthase (GCS)
|
Cancer
|
|
alpha-1,2-Fucosyltransferase (α1,2FucT), i.e., alpha 1, 2-fucosyltransferase, is often used in biochemical studies. alpha-1,2-Fucosyltransferase is a rate-limiting enzyme, can catalyze the synthesis of Lewis y (a cell membrane-associated carbohydrate antigen) [1].
|
-
- HY-129764
-
|
PGF3α
|
P-glycoprotein
|
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
Prostaglandin F3α (PGF3α) is an eicosapentaenoic acid (EPA)-derived bioactive lipid mediator that has anti-cancer and anti-inflammatory effects. Prostaglandin F3α is a substrate of ABCC4 with a Km of 12.1 μM. Prostaglandin F3α can be used for the research of diabetes [1] .
|
-
- HY-13715S
-
-
- HY-13715R
-
-
- HY-P2707
-
|
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research [1].
|
-
- HY-W052144S
-
|
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Others
|
|
(±) Anabasine-d4 dihydrochloride is deuterium labeled (±) Anabasine dihydrochloride. (±) Anabasine dihydrochloride is the racemate of Anabasine dihydrochloride. Anabasine dihydrochloride is an agonist of α7nAChR and exhibits anti-inflammatory and insecticidal activities [1].
|
-
- HY-10814
-
|
|
nAChR
|
Neurological Disease
|
|
CP-810123 is a brain-permeable agonist of α7 nAChR for the research of cognitive impairment associated with psychiatric or neurological disorders such as schizophrenia and Alzheimer's disease [1].
|
-
- HY-170045
-
-
- HY-W015084A
-
|
β-Lonone
|
Apoptosis
|
Cancer
|
|
(E)-β-Ionone is the isomer of β-Ionone (HY-W015084). β-Ionone is effective in the induction of apoptosis in gastric adenocarcinoma SGC7901 cells. β-Ionone has anti-cancer activity [1].
|
-
- HY-P3726
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Lys-Gln-Ala-Gly-Asp-Val (KQAGDV) is the six most carboxyl-terminal amino acids in the fibrinogen γ-chain sequence. Lys-Gln-Ala-Gly-Asp-Val is a cell adhesion peptide which is mediated through the α2bβ3 integrin. Lys-Gln-Ala-Gly-Asp-Val is a potent adhesion ligand for smooth muscle cells (SMCs) [1] .
|
-
- HY-W342092
-
|
|
Biochemical Assay Reagents
Endogenous Metabolite
|
|
|
1,3,4,6-Tetrachloro-3α,6α-diphenylglycouril is a chemical agent that has the property of inhibiting enzyme activity in organisms. 1,3,4,6-Tetrachloro-3α,6α-diphenylglycouril is used as a potential anti-tumor agent in compound development. 1,3,4,6-Tetrachloro-3α,6α-diphenylglycouril has the effect of regulating cell signaling pathways and can be used to study cell biology. 1,3,4,6-Tetrachloro-3α,6α-diphenylglycouril is considered to be a potent compound that can exert biological activity under specific conditions.
|
-
- HY-116549
-
|
PGF2α alcohol
|
Prostaglandin Receptor
|
Inflammation/Immunology
|
|
Prostaglandin F2α alcohol (PGF2α alcohol) is an analog of PGF2α. Dinoprost (Prostaglandin F2α) is an orally active, potent prostaglandin F (PGF) receptor (FP receptor) agonist [1].
|
-
- HY-170050
-
-
- HY-E70053
-
|
Alpha 1,3GT
|
Endogenous Metabolite
|
Metabolic Disease
|
|
alpha-1,3-Galactosyltransferase (GTB) (alpha 1,3GT) catalyzes the synthesis of the xenoantigen or α-galactose (α-Gal) epitope. alpha-1,3-Galactosyltransferase (GTB) transfers galactose from UDP-Gal to type 1 or type 2, αFuc1→2βGal-R (H)-terminating acceptors [1].
|
-
- HY-W587800
-
-
- HY-N3552
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
Catalposide, an iridoid glycoside that could be isolated from Catalpa ovate G. Don (Bignoniaceae), inhibits TNF-α, IL-1β, and IL-6 productions and NF-κB (p65) activation in lipopolysaccharide-activated RAW 264.7 macrophages [1].
|
-
- HY-127144
-
|
α-Dihydrosaxitoxin
|
Drug Derivative
|
Neurological Disease
|
|
α-Saxitoxinol is an epimer of Dihydtosaxitoxin and a derivative of saxitoxin. α-Saxitoxinol represents approximately 3.7% of the biological activity of Saxitoxin (a neurotoxin) [1].
|
-
- HY-W726076
-
|
|
Biochemical Assay Reagents
|
Others
|
|
3α,6α-Mannopentaose is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-17498B
-
|
(RS)-Atenolol hydrochloride; Tenormin hydrochloride; ICI 66082 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
Endocrinology
Cancer
|
|
Atenolol hydrochloride is a cardioselective β1-adrenergic receptor blocker, with a Ki of 697 nM at β1-adrenoceptor in guine pig left ventricle membrane. Atenolol hydrochloride can be used for the research of hypertension and angina pectoris [1] .
|
-
- HY-101318
-
|
β-FNA hydrochloride
|
Opioid Receptor
NO Synthase
|
Neurological Disease
Inflammation/Immunology
|
|
β-Funaltrexamine (β-FNA) hydrochloride is a selective μ opioid receptor antagonist. β-Funaltrexamine hydrochloride also inhibits cytokine-induced iNOS activation. β-Funaltrexamine hydrochloride inhibits neuroinflammation and ameliorated neuronal degeneration. β-Funaltrexamine hydrochloride has anti-inflammatory and neuroprotective effects and can be used for research of neurodegenerative diseases (eg: stroke) [1] [2]
|
-
- HY-W677042
-
|
5α-Androst-16-en-3α-ol
|
GABA Receptor
|
Neurological Disease
|
|
α-Androstenol (5α-Androst-16-en-3α-ol) is a steroid pheromone that has been found in boar testes and human male axillary sweat. α-Androstenol is also a positive modulator of GABAA receptors, which enhances GABA-activated currents in primary mouse cerebellar granule cells (EC50=0.4 μM). α-Androstenol decreases immobility time in the forced swim test and increases time spent in the open arms of the elevated plus maze in mice. α-Androstenol protects against seizures induced by Pentylenetetrazole or electroshock with anxiolytic-like activity in mice [1] .
|
-
- HY-144307
-
|
|
Aurora Kinase
PKC
|
Cancer
|
|
Aurora A/PKC-IN-1 (Compound 2e) is a potent dual inhibitor of Aurora A (AurA) and PKC (α, β1, β2, and θ) kinases with IC50s of 6.9 nM and 16.9 nM for AurA and PKCα, respectively. Aurora A/PKC-IN-1 has antiproliferative activity in breast cancer cells and antimetastatic activity [1].
|
-
- HY-N15129
-
-
- HY-149331
-
|
|
TNF Receptor
Caspase
NF-κB
|
Inflammation/Immunology
|
|
TNF-α-IN-11 (Compound 10) is a TNF-α inhibitor with a KD value of 12.06 μM. TNF-α-IN-11 binds to TNF-α and blocks the activation of TNF-α-trigged caspase and NF-κB signaling pathway. TNF-α-IN-11 inhibits the phosphorylation of IκBα, as well as the nuclear translocation of NF κB p65. TNF-α-IN-11 can be used for research of TNF-α-mediated autoimmune diseases [1].
|
-
- HY-13715AR
-
|
Levarterenol hydrochloride (Standard); L-Noradrenaline hydrochloride (Standard)
|
Adrenergic Receptor
Autophagy
Endogenous Metabolite
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Norepinephrine (hydrochloride) (Standard) is the analytical standard of Norepinephrine (hydrochloride). This product is intended for research and analytical applications. Norepinephrine (Levarterenol; L-Noradrenaline) hydrochloride is a potent adrenergic receptor (AR) agonist. Norepinephrine activates α1, α2, β1 receptors[1][2][3][4].
|
-
- HY-112813
-
-
- HY-W020044
-
|
DL-α-Tocopherol
|
Ferroptosis
DNA/RNA Synthesis
Apoptosis
|
Cancer
|
|
DL-alpha-Tocopherol is a synthetic vitamin E, with antioxidation effect. DL-alpha-Tocopherol protects human skin fibroblasts against the cytotoxic effect of UVB [1].
|
-
- HY-160436
-
-
- HY-101461
-
|
Methyl-beta-cyclodextrin
|
Biochemical Assay Reagents
|
Cancer
|
|
Methyl-β-cyclodextrin (Methyl-beta-cyclodextrin) is a cyclic heptasaccharide used to deliver hydrophobic agents based on its property of solubilizing non-polar substances. Methyl-β-cyclodextrin is also extensively used as a cholesterol-depleting reagent [1]. Methyl-β-cyclodextrin strongly reduces clathrin-dependent endocytosis . Methyl-β-cyclodextrin blocks cell migrasome formation .
|
-
- HY-P2802
-
|
α-D-Glucosidase, Yeast
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase, Yeast (α-D-Glucosidase, Yeast), a carbohydrate hydrolyzing enzyme, catalyzes the liberation of α-glucose from the non-reducing end of the substrate. α-Glucosidase can facilitate the absorption of glucose by the small intestine. Inhibition of α-Glucosidase is an effective management of non-insulin-dependent diabetes mellitus (NIDDM) [1] .
|
-
- HY-W127431
-
|
5α-Cholanic acid-3α-ol-6-one 3-acetate methyl ester
|
Biochemical Assay Reagents
|
Others
|
|
Methyl (3α,5α)-3-(acetyloxy)-6-oxocholan-24-oate is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-N9916
-
|
|
Amylases
|
Metabolic Disease
|
|
8,3′,4′-Trihydroxyflavone-7-O-β-D-glucopyranoside (Compound 3) is natural product that can be isolated from Bidens bipinnata. 8,3′,4′-Trihydroxyflavone-7-O-β-D-glucopyranoside shows 22% inhibition against α-amylase at 0.556 mg/mL [1].
|
-
- HY-W039911
-
|
PNP-Alpha-D-Gal; PNP-α-D-Gal
|
Biochemical Assay Reagents
|
Others
|
|
4-Nitrophenyl α-D-galactopyranoside (PNP-alpha-D-Gal) is an artificial substrate of 4-nitrophenyl (pNP) glycopyranoside for detecting α-galactosidase activity. The amount of released pNP is significantly increased when 4-Nitrophenyl α-D-galactopyranoside is used as substrates [1].
|
-
- HY-P2975
-
|
Mouse laminin (Engelbreth-Holm-Swarm murine sarcoma basement membrane)
|
Endogenous Metabolite
Biochemical Assay Reagents
|
Neurological Disease
|
|
Laminin β2 (Engelbreth-Holm-Swarm murine sarcoma basement membrane) is a crucial structural element in animal tissues, forming part of the scaffolding that supports tissue architecture. It interacts with type IV collagen through entactin and perlecan, connects to cell membranes via integrin receptors, dystroglycan complexes, and Lutheran blood group glycoproteins, and contains functional domains that facilitate collagen binding, cell adhesion, heparin interaction, and promote neurite outgrowth.
|
-
- HY-118710
-
-
- HY-116757
-
-
- HY-W113965
-
|
Octaacetyl-β-maltose; β-D-Maltopyranose octaacetate
|
Biochemical Assay Reagents
|
Others
|
|
β-D-Maltose octaacetate (Octaacetyl-β-maltose; β-D-Maltopyranose octaacetate) is a synthetic sugar compound.
|
-
- HY-110087
-
|
|
nAChR
|
Neurological Disease
|
|
4BP-TQS is a potent allosteric agonist of α7 nAChR. 4BP-TQS activates nAChRs via an allosteric transmembrane site [1].
|
-
- HY-111051
-
|
|
nAChR
|
Neurological Disease
|
|
JN403 is an orally active and selective α7 nicotinic acetylcholine receptor agonist. JN403 can be used in the study of central nervous system disorders [1].
|
-
- HY-P1189
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 [1] .
|
-
- HY-P1189A
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 [1] .
|
-
- HY-141468
-
|
β-CNA dihydrochloride
|
Opioid Receptor
|
Neurological Disease
|
|
β-Chlornaltrexamine dihydrochloride (β-CNA dihydrochloride) is a potent long-term opioid receptor blocker. β-Chlornaltrexamine dihydrochloride can effectively block the inhibitory effect of κ opioid receptor agonists on dopamine release. β-Chlornaltrexamine dihydrochloride can be used to study the mechanism of pain perception [1].
|
-
- HY-17498
-
-
- HY-N0683A
-
-
- HY-N1615
-
|
|
Others
|
Others
|
|
1beta-Hydroxy-beta-eudesmol is a Sesquiterpenoids product that can be isolated from the herbs of Cymbopogon proximus STAPF. [1].
|
-
- HY-102022
-
|
α-GalCer; KRN7000
|
Transmembrane Glycoprotein
Interleukin Related
|
Inflammation/Immunology
Cancer
|
|
α-Galactosylceramide (α-GalCer) is a synthetic glycolipid with antitumorial and immunostimulatory. α-Galactosylceramide is a very potent NKT cell agonist and binds effectively to CD1d. The complex of α-Galactosylceramide plus CD1d binds the NKT cell TCR (T cell antigen receptor) [1] .
|
-
- HY-N2018
-
|
α-D-Xylopyranose
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α-D-Xylose (α-D-Xylopyranose) is a basic component of the five-carbon fraction of biomass and a precursor of hemicellulose. α-D-Xylose participates in a variety of enzyme-catalyzed reactions, which in turn participate in a variety of metabolic pathways. In addition, α-D-Xylose is also used in tanning, dyeing and as a diabetic food [1].
|
-
- HY-E70104
-
|
α-L-Rhamnosidase
|
Glycosidase
|
Others
|
|
α-Rhamnosidase is a glycoside hydrolase. α-Rhamnosidase is able to finish the enzymatic de-glycosylation of many nature flavone glycosides [1].
|
-
- HY-Y0149S
-
-
- HY-P2901
-
|
3α-HSD
|
Endogenous Metabolite
|
Endocrinology
|
|
3α-Hydroxysteroid Dehydrogenase, Microorganism (3α-HSD) is an enzyme encoded by the AKR1C4 gene, which can catalyze the conversion of 3-ketosteroids into 3α-hydroxy compounds. 3α-Hydroxysteroid dehydrogenase plays an important role in the inactivation of androgen DHT, and can convert DHT into 3α-androstanediol with weak androgen activity, which can be used in the research of hirsutism [1].
|
-
- HY-134420
-
-
- HY-126236
-
-
- HY-110142
-
|
CC4
|
nAChR
|
Neurological Disease
|
|
Thermopsidine (CC4) is a selective partial agonist at α4β2/α6β2 nAChR with EC50 values of 2.2 μM target α4β2 [1].
|
-
- HY-N9699
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
8α-Hydroxyhirsutinolide is a sesquiterpene lactone. 8α-Hydroxyhirsutinolide inhibits TNF-α-induced NF-κB activity (IC50: 1.9 μM) and NO production. 8α-Hydroxyhirsutinolide can be isolated from Vernonia cinerea [1].
|
-
- HY-P2978
-
|
|
Ser/Thr Protease
|
Neurological Disease
|
|
Alpha 1 Antichymotrypsin, Human Plasma is a serine protease inhibitor. Alpha 1 Antichymotrypsin, Human Plasma appears in the amyloid lesions of Alzheimer's disease. Alpha 1 Antichymotrypsin, Human Plasma can be used in Alzheimer's disease research [1].
|
-
- HY-161701
-
|
|
Androgen Receptor
|
Cancer
|
|
(3β,4β,17β)-17-(2-Pyridinylmethyl)androst-5-ene-3,4,17-triol is an androstane derivative with anticancer activity [1].
|
-
- HY-W615671
-
|
|
Estrogen Receptor/ERR
|
Others
|
|
4,4'-(Cyclohexylidenemethylene)diphenol (Compound 2) is a symmetric cyclic nonsteroidal estrogen. 4,4'-(Cyclohexylidenemethylene)diphenol has high binding affinity for estrogen receptors ERα and ERβ .
|
-
- HY-N0700
-
|
α-Asarone; trans-Asarone
|
GABA Receptor
|
Neurological Disease
|
|
alpha-Asarone (α-Asarone) is one of the main psychoactive compounds, and possesses an antidepressant-like activity in mice.
|
-
- HY-101337
-
-
- HY-N8745
-
|
|
Fungal
|
Others
|
|
α-Peltatin is an aryl lignan. α-Peltatin has anticancer and antifungal activity. α-Peltatin inhibits DNA topoisomerase and tubulin polymerization [1].
|
-
- HY-118135
-
|
4MU-α-Gal
|
Fluorescent Dye
|
Others
|
|
4-Methylumbelliferyl-α-D-galactopyranoside (4MU-α-Gal), a substrate for α-galactosidase A (GLA), is a blue pro-fluorogenic substrate. 4-Methylumbelliferyl-α-D-galactopyranoside forms two products, galactose and fluorescent 4MU, upon cleavage by GLA [1].
|
-
- HY-160433
-
-
- HY-W142080
-
|
α-Methyltryptophan
|
mTOR
Autophagy
Apoptosis
Amino Acid Derivatives
|
Metabolic Disease
Cancer
|
|
α-Methyl-DL-tryptophan (α-Methyltryptophan), a tryptophan derivative, is a selective SLC6A14 blocker. In estrogen receptor (ER)-positive breast cancer cells, α-Methyl-DL-tryptophan inhibits mTOR and activates autophagy and apoptosis. α-Methyl-DL-tryptophan also has the effect of reducing weight [1] .
|
-
- HY-13335
-
|
|
PKC
Apoptosis
|
Cancer
|
|
PKCβ inhibitor 1 is a potent, ATP-competitive, and selective PKCβ inhibitor with IC50s of 21 and 5 nM for human PKCβ1 and PKCβ2, respectively. PKCβ inhibitor 1 exhibits selectivity of more than 60-fold in favor of PKCβ2 relative to other PKC isozymes (PKCα, PKCγ, and PKCε) [1] .
|
-
- HY-164997
-
|
15-keto PGF1α
|
Endogenous Metabolite
|
Metabolic Disease
|
|
15-keto Prostaglandin F1α (15-keto PGF1α) is a prostaglandin F1α metabolite. 15-keto Prostaglandin F1α (15-keto PGF1α) is an effective substrate for PGR-2. 15-keto Prostaglandin F1α (15-keto PGF1α) can be used to study physiological processes such as prostaglandin metabolism and lipogenesis [1].
|
-
- HY-B1513
-
|
|
Microtubule/Tubulin
SARS-CoV
|
Infection
Metabolic Disease
Cancer
|
|
α-Cyclodextrin (α-CD) is a soluble fiber derived from corn. α-Cyclodextrin can deplete sphingolipids and phospholipids from cell membranes. α-Cyclodextrin interacts with tubulin. α-Cyclodextrin improves defenses against SARS-CoV-2 infection. α-Cyclodextrin enhances the anticancer efficacy of Crcumin (HY-N0005) against breast, lung and cervical cancer. α-Cyclodextrin has beneficial effects on body weight and blood lipids [1] .
|
-
- HY-N0255
-
|
α-Hederin
|
Apoptosis
|
Others
Cancer
|
|
alpha-Hederin (α-Hederin), a monodesmosidic triterpenoid saponin, exhibits promising antitumor potential against a variety of human cancer cell lines. alpha-Hederin could inhibit the proliferation and induce apoptosis of gastric cancer accompanied by glutathione decrement and reactive oxygen species generation via activating mitochondrial dependent pathway [1].
|
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) [1].
|
-
- HY-111326A
-
-
- HY-N8908
-
|
|
Others
|
Infection
|
|
2α,9α,11-Trihydroxy-6-oxodrim-7-ene is a natural product that can be isolated from the culture medium of the marine-derived fungus Aspergillus insuetus [1].
|
-
- HY-W743870
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
5α-Dihydrodeoxycorticosterone is an intermediate product of Deoxycorticosterone (HY-113414) catalyzed by 5α-reductase. 5α-Dihydrodeoxycorticosteron levels associated with depression [1].
|
-
- HY-P1420
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM [1].
|
-
- HY-N4285
-
-
- HY-113269
-
|
|
Drug Metabolite
|
Others
|
|
alpha-CEHC is a water-soluble metabolite of alpha-tocopherol (α-TOH) with potential antioxidant activity. alpha-CEHC slightly inhibits macrophage-induced low-density lipoprotein (LDL) oxidation, and its inhibitory potency is concentration-dependent [1] .
|
-
- HY-113962
-
|
7α,25-OHC
|
EBI2/GPR183
Endogenous Metabolite
|
Inflammation/Immunology
|
|
7α, 25-dihydroxycholesterol (7α,25-OHC) is a potent and selective agonist and endogenous ligand of the orphan GPCR receptor EBI2 (GPR183). 7α, 25-dihydroxycholesterol is highly potent at activating EBI2 (EC50=140 pM; Kd=450 pM). 7α, 25-dihydroxycholesterol can serve as a chemokine directing migration of B cells, T cells and dendritic cells [1] .
|
-
- HY-N10439
-
|
|
Glycosidase
|
Inflammation/Immunology
|
|
3β-Acetoxy-hop-22(29)-ene (compound 1) is a potent anti-inflammatory agent. 3β-Acetoxy-hop-22(29)-ene shows high inhibitory activity of yeast α-glucosidase, with an IC50 of 5.74 μM. 3β-Acetoxy-hop-22(29)-ene inhibits MPO (myeloperoxidase) activity in a dose-dependent manner in mouse ear edema model induced by 12-O-tetradecanoylphorbol acetate (TPA), with an IC50 of 0.23 μmol/ear [1].
|
-
- HY-N2931
-
|
(+)-β-Rotunol
|
Others
|
Others
|
|
β-Rotunol ((+)-β-Rotunol) is a natural product, that can be isolated from Cyperus rotundus [1].
|
-
- HY-144388
-
|
|
Cholinesterase (ChE)
Amyloid-β
|
Neurological Disease
|
|
ChE/Aβ1-42-IN-1 (compound 28) is a potent ChE and Aβ1-42 aggregation inhibitor with IC50s of 0.062, 0.767 and 1.227 µM for AChE, BuChE and Aβ1-42 aggregation, respectively. ChE/β1-42-IN-1 shows excellent BBB penetration. ChE/Aβ1-42-IN-1 is a potent multi-targeted anti-Alzheimer's agent [1].
|
-
- HY-W739491
-
-
- HY-P0295
-
|
GRGDS
|
Integrin
|
Others
|
|
Gly-Arg-Gly-Asp-Ser (GRGDS) is a pentapeptide that forms the cell-binding domain of a glycoprotein, osteopontin. Gly-Arg-Gly-Asp-Ser binds to integrin receptors αvβ3 and αvβ5 with estimated IC50 of ～5 and ～6.5 μM [1]
|
-
- HY-N0492
-
|
Thioctic acid; (±)-α-Lipoic acid; DL-α-Lipoic acid
|
NF-κB
HIV
Mitochondrial Metabolism
Endogenous Metabolite
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
|
α-Lipoic Acid (Thioctic acid) is an antioxidant, which is an essential cofactor of mitochondrial enzyme complexes. α-Lipoic Acid inhibits NF-κB-dependent HIV-1 LTR activation [1] . α-Lipoic Acid induces endoplasmic reticulum (ER) stress-mediated apoptosis in hepatoma cells . α-Lipoic Acid can be used with CPUL1 (HY-151802) to construct the self-assembled nanoaggregate CPUL1-LA NA, which has improved antitumor efficacy than CPUL1 .
|
-
- HY-N0492A
-
|
Thioctic acid sodium; (±)-α-Lipoic acid sodium; DL-α-Lipoic acid sodium
|
NF-κB
HIV
Mitochondrial Metabolism
Endogenous Metabolite
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
|
α-Lipoic Acid (Thioctic acid) sodium is an antioxidant, which is an essential cofactor of mitochondrial enzyme complexes. α-Lipoic Acid sodium inhibits NF-κB-dependent HIV-1 LTR activation [1] . α-Lipoic Acid sodium induces endoplasmic reticulum (ER) stress-mediated apoptosis in hepatoma cells . α-Lipoic Acid sodium can be used with CPUL1 (HY-151802) to construct the self-assembled nanoaggregate CPUL1-LA NA, which has improved antitumor efficacy than CPUL1 .
|
-
- HY-B2193
-
|
|
Amylases
|
Others
|
|
α-Amylase is a hydrolase enzyme that catalyses the hydrolysis of internal α-1, 4-glycosidic linkages in starch to yield products like glucose and maltose.
|
-
- HY-N10893
-
|
|
Others
|
Others
|
|
(-)-β-Peltatin-5-O-beta-D-glucopyranoside is an active compound. (-)-β-Peltatin-5-O-beta-D-glucopyranoside can be isolated from P. peltatum L [1].
|
-
- HY-173210
-
|
|
Apoptosis
TNF Receptor
|
Cancer
|
|
TNF-α-IN-22 (Compound 30) is a TNFα inhibitor. It can induce Apoptosis by inhibiting the downregulation of IkBα induced by TNFα and blocking the cell cycle. TNF-α-IN-22 can be used in the research of triple-negative breast cancer [1].
|
-
- HY-N0941
-
|
β-Mangostin
|
Bacterial
Parasite
Apoptosis
|
Infection
Cancer
|
|
beta-Mangostin (β-Mangostin) is a xanthone compound present in Cratoxylum arborescens, with antibacterial and antimalarial activities. beta-Mangostin exhibits antimycobacterial activity against Mycobacterium tuberculosis with an MIC of 6.25 μg/mL. beta-Mangostin possesses in vitro antimalarial activity against Plasmodium falciparum, with an IC50 of 3.00 μg/mL. beta-Mangostin has potent anticancer activity against various cancers (such as hepatocellular carcinoma, leukaemic) [1] .
|
-
- HY-N2920
-
|
11-Oxo-β-amyrin
|
Cytochrome P450
|
Inflammation/Immunology
Cancer
|
|
β-Amyrenonol (11-Oxo-β-amyrin), an oleanolic-type triterpenoid in licorice roots, is a precursor of Glycyrrhetinic acid. β-Amyrenonol has anti-proliferative and anti-inflammatory activities, and β-Amyrenonol could function as the skeleton for the synthesis of many triterpenoids [1] .
|
-
- HY-B1278BR
-
|
|
Biochemical Assay Reagents
|
Infection
|
|
(±)-α-Tocopherol acetate (Standard) is the analytical standard of (±)-α-Tocopherol acetate. This product is intended for research and analytical applications. (±)-α-Tocopherol acetate ((±)-Vitamin E acetate), is a orally active synthetic form of vitamin E. (±)-α-Tocopherol acetate is the ester of acetic acid and α-tocopherol. (±)-α-Tocopherol acetate can be used for the research of the susceptibility of farmed fish to infectious diseases [1].
|
-
- HY-10401R
-
|
|
p38 MAPK
Autophagy
|
Inflammation/Immunology
|
|
VX-702 (Standard) is the analytical standard of VX-702. This product is intended for research and analytical applications. VX-702 is a highly selective inhibitor of p38α MAPK, 14-fold higher potency against the p38α versus p38β .
|
-
- HY-13715BR
-
|
|
Adrenergic Receptor
Autophagy
Endogenous Metabolite
|
Cardiovascular Disease
Endocrinology
Cancer
|
|
Norepinephrine (bitartrate monohydrate) (Standard) is the analytical standard of Norepinephrine (bitartrate monohydrate). This product is intended for research and analytical applications. Norepinephrine (Levarterenol; L-Noradrenaline) bitartrate monohydrate is a potent adrenergic receptor (AR) agonist. Norepinephrine activates α1, α2, β1 receptors [1] .
|
-
- HY-136828
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
LL-BM123α is a basic antibiotic isolated from Nocardia sp. LL-BM123α exhibits moderate activity against Gram-negative bacteria.
|
-
- HY-15310R
-
|
|
Dengue Virus
Flavivirus
Parasite
HIV
Mitophagy
HSV
SARS-CoV
Antibiotic
Autophagy
Bacterial
|
Infection
Cancer
|
|
Ivermectin (Standard) is the analytical standard of Ivermectin. This product is intended for research and analytical applications. Ivermectin (MK-933) is a broad-spectrum anti-parasite agent. Ivermectin (MK-933) is a specific inhibitor of Impα/β1-mediated nuclear import and has potent antiviral activity towards both HIV-1 and dengue virus. It is a positive allosteric effector of P2X4 and the α7 neuronal nicotinic acetylcholine receptor (nAChRs). Ivermectin also inhibits bovine herpesvirus1 (BoHV-1) replication and inhibits BoHV-1 DNA polymerase nuclear import [1] . Ivermectin is a candidate therapeutic against SARS-CoV-2/COVID-19 .
|
-
- HY-164360
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
αVβ8-IN-1 is a αVβ8 integrin inhibitor. αVβ8-IN-1 has been shown to inhibit the growth of tumors such as EMT6, CT26, KPC, and TKCC-10. αVβ8-IN-1 can be used in research related to idiopathic pulmonary fibrosis (IPF), non-specific interstitial pneumonia (NSIP), and tumors [1].
|
-
- HY-118648
-
|
PGF2α methyl ester; Dinoprost methyl
|
Prostaglandin Receptor
|
Others
|
|
Prostaglandin F2α methyl ester (PGF2α methyl ester; Dinoprost methyl) is a PGF2α analog with more lipid solubility. Prostaglandin F2α methyl ester exhibits efficacy in maintaining the ocular hypotensive [1].
|
-
- HY-N2277
-
-
- HY-N7563
-
|
|
EBV
|
Infection
Cancer
|
|
α-Toxicarol is a potent inhibitor of EBV.α-Toxicarol significantly inhibits mouse skin tumor in vivo. α-Toxicarol inhibits the TPA-induced EBV-EA activation [1].
|
-
- HY-P1819
-
-
- HY-167922
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
(R,R,S)-GAT107 is a fully agonistic positive modulator of α7 nicotinic receptors with significant biological activity. Its activity is entirely present in its (+)-isomer 1b, while (-)-isomer 1a does not affect its activity when used together. Studies have shown that (R,R,S)-GAT107 is the most potent ago-PAM for α7 nicotinic receptors currently known and has the potential for further in vivo evaluation [1].
|
-
- HY-P0252
-
-
- HY-116051
-
|
16,16-Dimethyl-PGF2α
|
Prostaglandin Receptor
|
Cardiovascular Disease
|
|
16,16-Dimethylprostaglandin F2α (16,16-Dimethyl-PGF2α) is a potent analog of PGF2α (HY-12956), which exhibits similar binding potency as PGF2α does. 16,16-Dimethylprostaglandin F2α serves as a bronchoconstrictor [1] .
|
-
- HY-N13537
-
|
|
Others
|
Others
|
|
11β,13-Dihydrotaraxinic acid β-D-glucopyranosyl ester is a natural product that can be isolated from Punica granatum [1].
|
-
- HY-134471
-
|
|
TNF Receptor
|
Inflammation/Immunology
Cancer
|
|
TNF-α-IN-2 is a potent and orally active inhibitor of tumor necrosis factor alpha (TNFα), with an IC50 of 25 nM in the HTRF assay. TNF-α-IN-2 distorts the TNFα trimer upon binding, leading to aberrant signaling when the trimer binds to TNFR1. TNF-α-IN-2 can be used for the research of rheumatoid arthritis [1].
|
-
- HY-N0492R
-
|
Thioctic acid (Standard); (±)-α-Lipoic acid (Standard); DL-α-Lipoic acid (Standard)
|
NF-κB
HIV
Mitochondrial Metabolism
Endogenous Metabolite
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
|
α-Lipoic Acid (Standard) is the analytical standard of α-Lipoic Acid. This product is intended for research and analytical applications. α-Lipoic Acid (Thioctic acid) is an antioxidant, which is an essential cofactor of mitochondrial enzyme complexes. α-Lipoic Acid inhibits NF-κB-dependent HIV-1 LTR activation [1] . α-Lipoic Acid induces endoplasmic reticulum (ER) stress-mediated apoptosis in hepatoma cells . α-Lipoic Acid can be used with CPUL1 (HY-151802) to construct the self-assembled nanoaggregate CPUL1-LA NA, which has improved antitumor efficacy than CPUL1 .
|
-
- HY-130553
-
|
β-NAAG; β-N-Acetylaspartylglutamic acid
|
Aminopeptidase
mGluR
|
Neurological Disease
|
|
β-Spaglumic acid (β-NAAG) is a competitive NAAG peptidase inhibitor (Ki=1 µM) that protects spinal cord neurons from excitotoxicity and hypoxic damage. β-Spaglumic acid is also a selective mGluR3 antagonist (mGluR3 receptor functions to regulate activity-dependent synaptic potentiation in the hippocampus). β-Spaglumic acid can be used in neuroprotection-related studies [1] .
|
-
- HY-N10634S
-
|
N-ω-CD3-Hexadecaoyl-glucopsychosie; GluCe(d18:1/16:0-d3); Glucosylceamide-d3 (d18:1/16:0-d3)
|
Isotope-Labeled Compounds
Others
|
Inflammation/Immunology
|
|
D-Glucosyl-β-N-palmitoylsphingosine-d3 (N-ω-Cd3-Hexadecaoyl-glucopsychosie) is deuterium labeled D-Glucosyl-β-1,1′-N-palmitoylsphingosine. D-Glucosyl-β-1,1′-N-palmitoylsphingosine (C16 Glucosyl(β) Ceramide (d18:1/16:0)) is an endogenous Mincle ligand possessing immunostimulatory activity [1] [1] .
|
-
- HY-129764A
-
|
17-trans-PGF3α
|
P-glycoprotein
Drug Isomer
|
Inflammation/Immunology
|
|
(17E)-Prostaglandin F3α (17-trans-PGF3α) is a double bond isomer of Prostaglandin F3α (HY-129764) and a potential metabolite of trans dietary fatty acids. (17E)-Prostaglandin F3α has anti-inflammatory activity [1].
|
-
- HY-N0710
-
|
α-Cyperone; (+)-α-Cyperone
|
Endogenous Metabolite
|
Inflammation/Immunology
|
|
alpha-Cyperone (α-Cyperone) is associated with the down-regulation of COX-2, IL-6, Nck-2, Cdc42 and Rac1, resulting in reduction of inflammation, which would be highly beneficial for treatment of inflammatory diseases such as AD.
|
-
- HY-N7364
-
|
trans-β-Farnesene
|
Fungal
CDK
|
Infection
Cancer
|
|
(E)-β-Farnesene (trans-β-Farnesene) is an aphid alarm pheromone, which can be found in Phlomis aurea Decne essential oil. (E)-β-Farnesene shows good binding score with a value of -30.64 kcal/mol to the CDK2 receptor. (E)-β-Farnesene also exhibits good affinity to odorant-binding protein 3 (OBP3). (E)-β-Farnesene can be used as a feeding stimulant for the sand fly Lutzomyia longipalpis [1] .
|
-
- HY-P10796
-
|
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
YARA peptide, a cell-penetrating peptide, is a MK2 inhibitor. YARA-loaded nanoparticles decreases the levels of inflammatory cytokines (IL-1β, IL-6, and TNF-α) in an ex vivo skin culture model. YARA peptide is promising for research of atopic dermatitis (AD) [1].
|
-
- HY-N0569
-
-
- HY-156060
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
NCI126224 is a TLR4 signaling inhibitor. NCI126224 suppress LPS (HY-D1056)-induced production of NF-κB, TNF-α, IL-1β, and NO in the nanomolar-low micromolar range. NCI126224 can be used for the research of inflammatory diseases [1].
|
-
- HY-W414548
-
|
|
Others
|
Neurological Disease
Metabolic Disease
|
|
7α,27-Dihydroxycholesterol is an oxysterol characterized by its oxidized side chains and is produced through the hydroxylation of 27-Hydroxycholesterol (27-OHC); it serves as a metabolite of interest in lipidomic analyses of various pathological conditions, including neurological diseases, Smith-Lemli-Opitz syndrome, obesity metabolic syndrome, and diabetes. Notably, levels of 7α,27-di-OHC decrease following lipopolysaccharide activation, and it also functions as a ligand for Epstein-Barr virus-induced gene 2 (EBI2). Additionally, 7α,27-di-OHC exists as a structural isomer of 7α,25-dihydroxycholesterol (7α25-OHC).
|
-
- HY-N0328R
-
|
α-Mangostin (Standard)
|
Fungal
Reactive Oxygen Species
Bacterial
Apoptosis
Virus Protease
|
Cancer
|
|
alpha-Mangostin (Standard) is the analytical standard of alpha-Mangostin. This product is intended for research and analytical applications. alpha-Mangostin (α-Mangostin) is a dietary xanthone with broad biological activities, such as antioxidant, anti-allergic, antiviral, antibacterial, anti-inflammatory and anticancer effects. It is an inhibitor of mutant IDH1 (IDH1-R132H) with a Ki of 2.85 μM.
|
-
- HY-19949
-
-
- HY-113962S
-
-
- HY-N10364
-
|
|
Others
|
Cancer
|
|
6β,7β-Epoxyasteriscunolide A, a sesquiterpenoid, shows cytotoxicity against the HL-60 and MOLT-3 leukemia cell lines, with IC50s range 4.1-5.4 μM [1].
|
-
- HY-P4911
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research [1] .
|
-
- HY-N0611R
-
|
|
Others
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
alpha-Boswellic acid (Standard) is the analytical standard of alpha-Boswellic acid. This product is intended for research and analytical applications. alpha-Boswellic acid (α-Boswellic acid) is an orally active pentacyclic triterpenoid compound that can be extracted from frankincense. alpha-Boswellic acid has anti-inflammatory and antitumor activities. alpha-Boswellic acid can be used in Alzheimer's disease (AD) research [1] .
|
-
- HY-W698499
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Benzyl 2-acetamido-3-O-(2,3,4,6-tetra-O-acetyl-β-D-galactopyranosyl-2-deoxy-α-D-glucopyranoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-W699294
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Benzyl 2-acetamido-2-deoxy-3-O-(2',3',4',6'-tetra- O-acetyl-β-D-galactopyranosyl)-α-D-galactopyranoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-Glycan recognition and the role of glycans in biological systems. This field is closely related to basic research, biomedicine and biotechnology.
|
-
- HY-W009122
-
-
- HY-P0295A
-
|
GRGDS TFA
|
Integrin
|
Inflammation/Immunology
|
|
Gly-Arg-Gly-Asp-Ser (TFA) is a pentapeptide that forms the cell-binding domain of a glycoprotein, osteopontin [1]. Gly-Arg-Gly-Asp-Ser binds to integrin receptors αvβ3 and αvβ5 with estimated IC50 of ∼5 and ∼6.5 μM .
|
-
- HY-117845
-
|
LL-E19085α
|
Bacterial
Antibiotic
|
Infection
|
|
Citreamicin alpha (LL-E 19085-alpha) is an antibiotic whose in vitro antimicrobial activity against 429 clinical isolates of Gram-positive cocci has been tested by the agar dilution method. These microorganisms included 313 strains of Staphylococci and 116 strains of Streptococci. The in vitro activity of Citreamicin alpha was compared with that of ampicillin, amoxicillin, ceftriaxone, erythromycin, and vancomycin. For Staphylococci, the MIC values of Citreamicin alpha ranged from 0.12-4.0 μg/ml, and for Streptococcus pyogenes of the genus Streptococcus, it was 0.03-0.12 μg/ml. However, enterococci were relatively resistant, requiring 2.0 μg/ml of the agent to inhibit 64% of the 62 tested strains. The in vitro activity of this antibiotic was much better than that of ampicillin, amoxicillin, ceftriaxone, and erythromycin, but comparable or slightly inferior to that of vancomycin.
|
-
- HY-108059
-
|
(3R)-β-Cryptoxanthin
|
Endogenous Metabolite
|
Neurological Disease
|
|
β-Cryptoxanthin ((3R)-β-Cryptoxanthin), isolated from tangerines, red peppers, and pumpkin, is an oxygenated carotenoid and a potent antioxidant. β-Cryptoxanthin has an anti-stress effect [1].
|
-
- HY-W743021
-
-
- HY-136748
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-2α-IN-4 is a potent inhibitor of hypoxia inducible factor-2α (HIF-2α) translation, with an IC50 of 5 μM. HIF-2α-IN-4 decreases both constitutive and hypoxia-induced HIF-2α protein expression. HIF-2α-IN-4 links its 5'UTR iron-responsive element to oxygen sensing [1].
|
-
- HY-N9170
-
|
|
Others
|
Cancer
|
|
Lup-20(29)-ene-3β,11β-diol is a natural triterpenoid with anticancer effects. Lup-20(29)-ene-3β,11β-diol exhibits significant cytotoxic activity against HeLa with an IC50 value of 28.5 μM [1].
|
-
- HY-N1222
-
|
|
Others
|
Others
|
|
Stigmast-4-ene-3β,6β-diol is a stigmasterol, that can be isolated from Nux Prinsepiae [1].
|
-
- HY-116472
-
|
α-RA-F
|
Endogenous Metabolite
|
Others
|
|
alpha-RA-F (α-RA-F) is a compound that can promote collagen synthesis and has the activity of reducing the expression level of matrix metalloproteinases (MMPs). alpha-RA-F enhances collagen synthesis in human fibroblasts without causing cytotoxicity. alpha-RA-F has demonstrated its important potential in the pharmaceutical, pharmaceutical and cosmetic industries by regulating collagen synthesis and MMPs expression levels [1].
|
-
- HY-P2802B
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α-Glucosidase, rice is a carbohydrase enzyme that catalyzes the release of α-glucose molecules. α-Glucosidase, rice retains exoglycosidases, which hydrolyze α-glucosidic linkage at the nonreducing end of a substrate [1] .
|
-
- HY-N0700R
-
|
|
GABA Receptor
|
Neurological Disease
|
|
alpha-Asarone (Standard) is the analytical standard of alpha-Asarone. This product is intended for research and analytical applications. alpha-Asarone (α-Asarone) is one of the main psychoactive compounds, and possesses an antidepressant-like activity in mice.
|
-
- HY-N0492AR
-
|
Thioctic acid sodium (Standard); (±)-α-Lipoic acid sodium (Standard); DL-α-Lipoic acid sodium (Standard)
|
NF-κB
HIV
Mitochondrial Metabolism
Endogenous Metabolite
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
|
α-Lipoic Acid (sodium) (Standard) is the analytical standard of α-Lipoic Acid (sodium). This product is intended for research and analytical applications. α-Lipoic Acid (Thioctic acid) sodium is an antioxidant, which is an essential cofactor of mitochondrial enzyme complexes. α-Lipoic Acid sodium inhibits NF-κB-dependent HIV-1 LTR activation[1][2][3]. α-Lipoic Acid sodium induces endoplasmic reticulum (ER) stress-mediated apoptosis in hepatoma cells[4]. α-Lipoic Acid sodium can be used with CPUL1 (HY-151802) to construct the self-assembled nanoaggregate CPUL1-LA NA, which has improved antitumor efficacy than CPUL1[5].
|
-
- HY-P5694
-
|
|
HPV
Parasite
|
Infection
|
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity [1].
|
-
- HY-132723AS
-
-
- HY-132723S
-
-
- HY-149635
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1α-IN-6 (compound 3s) is a HIF-1α inhibitor with IC50 values of 0.6 and 53.3 nM observed in MiaPaCa-2 and MDA-MB-231 cells. HIF-1α-IN-6 can inhibit HIF-1α expression by decreasing the level of HIF-1α mRNA [1].
|
-
- HY-130660
-
|
Prostamide F2α
|
Prostaglandin Receptor
|
Endocrinology
|
|
Prostaglandin F2α ethanolamide (Prostamide F2α) is an ethanolamide-like G protein-coupled receptor. Prostaglandin F2α is also a luteinizing hormone in sheep and may be a nociceptive mediator in the spinal cord [1] .
|
-
- HY-B1615R
-
|
|
Adrenergic Receptor
|
Inflammation/Immunology
|
|
Clenbuterol (Standard) is the analytical standard of Clenbuterol. This product is intended for research and analytical applications. Clenbuterol (NAB-365) is a β2-adrenergic receptor agonist with an EC50 of 31.9 nM [1]. Clenbuterol is a very potent inhibitor of the lipopolysaccharide (LPS)-induced release of TNF-α and IL-1β. Clenbuterol can inhibit the inflammatory process. Clenbuterol is a bronchodilator .
|
-
- HY-108229
-
|
6β-Hydroxynaltrexone
|
Drug Metabolite
Opioid Receptor
|
Neurological Disease
|
|
6β-Naltrexol (6β-Hydroxynaltrexone), the primary metabolite of Naltrexone, is a peripherally selective opioid antagonist. 6β-Naltrexol selectively inhibits gastrointestinal opioid effects in human subjects and inhibits Morphine-induced slowing of gastrointestinal transit [1].
|
-
- HY-W011655
-
|
p-Nitrophenyl Alpha-D-xylopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
p-Nitrophenyl α-D-xylopyranoside (p-Nitrophenyl alpha-D-xylopyranoside) is a chromogenic substrate for α-xylosidase [1].
|
-
- HY-153256
-
|
|
Prostaglandin Receptor
|
Metabolic Disease
|
|
EP3 antagonist 4 (Compound 28) is an EP3 antagonist, with a Ki value of 2 nM for hEP. EP3 antagonist 4 shows low in vivo clearance, high oral AUC, and good bioavailability in the rat full PK studies. EP3 antagonist 4 can be used for research of beta cell dysfunction in diabetes [1].
|
-
- HY-P5968
-
|
β(25-35)KA
|
Amyloid-β
|
Neurological Disease
|
|
[Ala28]-β Amyloid(25-35) (β(25-35)KA) is an electrically neutral mutant peptide of Aβ(25-35) that accelerates the aggregation of Firefly Luciferase [1].
|
-
![[Ala28]-β Amyloid(25-35)](//file.medchemexpress.com/product_pic/hy-p5968.gif)
- HY-Y0191R
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α-Pyridone (Standard) is the analytical standard of α-Pyridone. This product is intended for research and analytical applications. α-Pyridone is an endogenous metabolite.
|
-
- HY-W414824
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
3β,7β-Dihydroxy-5-cholestenoic acid is a C27 acid that displays elevated levels in Niemann-Pick type C and Niemann-Pick type B diseases, contributing to toxicity in oculomotor neurons. It is synthesized from 3β-hydroxy-7-oxocholest-5-en-(25R)26-oic acid (3βH,7O-CA) through the enzymatic action of hydroxysteroid 11-β dehydrogenase 1.
|
-
- HY-W709830
-
|
|
Drug Derivative
|
Neurological Disease
|
|
α-Propylaminopentiophenone hydrochloride is a substituted cathinone that has propyl groups both at the α position of the cathinone structure and at the amine.
|
-
- HY-W706595
-
|
|
Drug Derivative
|
Neurological Disease
|
|
N,α-Diethylphenethylamine hydrochloride is an N-substituted amphetamine with an ethyl group attached to the amine. N,α-Diethylphenethylamine hydrochloride is an anorectic.
|
-
- HY-124499
-
|
|
Integrin
|
Cardiovascular Disease
|
|
RUC-1 (Compound 1) is an inhibitor for αIIbβ3 integrin. RUC-1 inhibits fibrin deposition and platelet aggregation in hybrid hαIIb/mβ3 receptors expressing mice. RUC-1 exhibits antithrombotic effect in hαIIb/mβ3 receptor expressing mice [1].
|
-
- HY-N0683S6
-
-
- HY-P1084
-
|
β-PMTX
|
Sodium Channel
|
Neurological Disease
|
|
β-Pompilidotoxin (β-PMTX), a wasp venom, can slow sodium channel inactivation and increases steady-state sodium current in cells [1].
|
-
- HY-17031
-
|
Sulfobutylether-β-Cyclodextrin
|
Biochemical Assay Reagents
|
Others
|
|
SBE-β-CD is a sulfobutylether β-cyclodextrin derivative used as an excipient or a formulating agent to increase the solubility of poorly soluble agents [1].
|
-
- HY-126049
-
|
(S)-(-)-Oxiracetam; (S)-ISF2522
|
Apoptosis
|
Neurological Disease
|
|
(S)-oxiracetam (S-ORC) is an inhibitor targeting apoptosis. S-ORC reduces brain infarct size and lessens neurological dysfunction in middle cerebral artery occlusion/reperfusion (MCAO/R) models. S-ORC prevents neuronal apoptosis via activating PI3K/Akt/GSK3β signaling pathway via α7 nAChR after ischemic stroke. S-ORC can prevent neuronal death after ischemic stroke [1].
|
-
- HY-145463
-
|
|
5-HT Receptor
|
Cardiovascular Disease
|
|
α-Methylserotonin is a potent and selective agonist of 5-HT2 receptor. α-Methylserotonin is an analogue of serotonin formed in vivo from α-methyltryptophan. α-Methylserotonin mediates the lymphatic smooth muscle contraction and prevents the up-regulation of serotonin-receptor-mediated phosphoinositide hydrolysis [1] .
|
-
- HY-100993
-
|
|
5-HT Receptor
|
Cardiovascular Disease
|
|
α-Methylserotonin maleate is a potent and selective agonist of 5-HT2 receptor. α-Methylserotonin maleate is an analogue of serotonin formed in vivo from α-Methyltryptophan. α-Methylserotonin maleate mediates the lymphatic smooth muscle contraction and prevents the up-regulation of serotonin-receptor-mediated phosphoinositide hydrolysis [1] .
|
-
- HY-N13374
-
|
|
Others
|
Others
|
|
Stigmasta-4,22-diene-3beta,6beta-diol is a natural product [1].
|
-
- HY-W014118R
-
|
|
Others
|
Cancer
|
|
α-Hexylcinnamaldehyde (Standard) is the analytical standard of α-Hexylcinnamaldehyde. This product is intended for research and analytical applications. α-Hexylcinnamaldehyde, a compound derived from Cinnamaldehyde. α-Hexylcinnamaldehyde has the potential antimutagenic and chemosensitizing properties. α-Hexylcinnamaldehyde is widely used as an ingredient in many personal care, and as an additive in food and the pharmaceutical industry [1].
|
-
- HY-N7606
-
|
|
Others
|
Others
|
|
(Rac)-β-Chamigrenic acid is a racemate of β-Chamigrenic acid. β-Chamigrenic acid is a sesquiterpenoid isolated from S.chinensis [1]
|
-
- HY-P2998
-
-
- HY-P1482
-
|
Mating Factor α
|
Sex Pheromone
|
Endocrinology
|
|
α-Factor Mating Pheromone, yeast is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor.
|
-
- HY-N0722
-
|
trans-5-O-Caffeoylquinic acid
|
NF-κB
Interleukin Related
TNF Receptor
COX
|
Inflammation/Immunology
Cancer
|
|
Neochlorogenic acid is a natural polyphenolic compound found in dried fruits and other plants. Neochlorogenic acid inhibits the production of TNF-α and IL-1β. Neochlorogenic acid suppresses iNOS and COX-2 protein expression. Neochlorogenic acid also inhibits phosphorylated NF-κB p65 and p38 MAPK activation.
|
-
- HY-P1420A
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM [1].
|
-
- HY-N0633
-
-
- HY-19717
-
|
S-[(1E)-1,2-Dichloroethenyl]-L-cysteine
|
TNF Receptor
|
Inflammation/Immunology
|
|
DCVC (S-[(1E)-1,2-Dichloroethenyl]-L-cysteine) is a bioactive metabolite of trichloroethylene (TCE). DCVC inhibits pathogen-stimulated pro-inflammatory cytokines IL-1β, IL-8, and TNF-α release from tissue cultures [1] .
|
-
- HY-N3146
-
|
(3β,4β)-Olean-12-ene-3,23-diol; 3β,24-Dihydroxyolean-12-ene
|
Others
|
Others
|
|
Olean-12-ene-3β,24-diol ((3β,4β)-Olean-12-ene-3,23-diol) is a product that can be isolated from [1].
|
-
- HY-137781
-
-
- HY-163777
-
|
|
Phosphodiesterase (PDE)
|
Others
Inflammation/Immunology
|
|
Talaroterphenyl A (compound 1) is a p-terphenyl derivative present in the mangrove sediment-derived fungus Talaromyces sp. SCSIO 41412, which exhibits phosphodiesterase 4 (PDE4) inhibitory activity (IC50=1.2 μM). Talaroterphenyl A also exhibits anti-inflammatory and anti-fibrotic activities, significantly reducing the mRNA levels of pro-inflammatory cytokines IL-6, TNF-α, and IL-1β .
|
-
- HY-158805
-
-
- HY-172032
-
-
- HY-119593
-
-
- HY-W776875
-
-
- HY-137873
-
|
4-Methylumbelliferyl-α-D-Glucose; 4-Methylumbelliferyl-α-D-Glucoside; 4-MU-α-D-Glucopyranoside
|
Fluorescent Dye
Glycosidase
|
Others
|
|
4-Methylumbelliferyl-α-D-Glucopyranoside (4-Methylumbelliferyl-α-D-Glucose) is a fluorescent substrate for α-glucosidase, which releases the fluorescent moiety 4-methylumbelliferyl (4-MU) upon cleavage. 4-MU has pH-dependent fluorescence excitation activity, with excitation wavelengths of 320 nm at low pH (1.97-6.72) and 360 nm at high pH (7.12-10.3), respectively. The emission wavelength of 4-Methylumbelliferyl-α-D-Glucopyranoside increases with decreasing pH, ranging from 445-455 nm. 4-Methylumbelliferyl-α-D-Glucopyranoside can be used as a biomarker for Fabry and Pompe diseases to quantify α-glucosidase activity in infant blood spot samples.
|
-
- HY-144389
-
|
|
Cholinesterase (ChE)
Amyloid-β
|
Neurological Disease
|
|
hAChE/Aβ1-42-IN-1 (Compound 16) is a potent inhibitor of hAChE and Aβ1-42 aggregation. hAChE/Aβ1-42-IN-1 shows acceptable relative safety upon hepG2 cell line and excellent BBB penetration with wide safety margin. hAChE/Aβ1-42-IN-1 has the potential for the research of Alzheimer disease (AD) [1].
|
-
- HY-150003
-
|
|
Cholinesterase (ChE)
Amyloid-β
|
Neurological Disease
|
|
Aβ1-42 aggregation inhibitor 1 inhibits AChE (acetylcholinesterase) and BuChE (butyrylcholinesterase) with the IC50 value of 2.64 μM and 1.29 μM, respectively. Aβ1-42 aggregation inhibitor 1 inhibits self-mediated Aβ1-42 aggregation by 51.29% at a concentration of 25 μM. Aβ1-42 aggregation inhibitor 1 has the potential for the research of anti-Alzheimer's disease [1].
|
-
- HY-N8847R
-
|
|
Hippo (MST)
YAP
|
Cancer
|
|
α-Ionone (Standard) is the analytical standard of α-Ionone. This product is intended for research and analytical applications. α-Ionone (alpha-Ionone) is an activator of the olfactory receptor OR10A6. α-Ionone induces apoptosis by activating OR10A6 and increasing the phosphorylation of the LATS-YAP-TAZ signaling axis in the Hippo pathway. α-Ionone can inhibit tumor formation both in vivo and in vitro [1].
|
-
- HY-W014118
-
|
|
Drug Derivative
|
Cancer
|
|
α-Hexylcinnamaldehyde, a compound derived from Cinnamaldehyde. α-Hexylcinnamaldehyde has the potential antimutagenic and chemosensitizing properties. α-Hexylcinnamaldehyde is widely used as an ingredient in many personal care, and as an additive in food and the pharmaceutical industry [1].
|
-
- HY-162558
-
|
|
Factor Xa
|
Cardiovascular Disease
|
|
NCGC00351170 is an antiplatelet agent that disrupts the calcium and integrin-binding protein 1 (CIB1)-αIIbβ3 interaction. NCGC00351170 inhibits thrombin-induced human platelet aggregation [1].
|
-
- HY-W699164
-
|
Benzyl β-D-galactopyranosyl-(1→4)-β-D-N-acetylglucosamine
|
Biochemical Assay Reagents
|
Others
|
|
Gal1-β-4GlcNAc-β-Bn (Benzyl β-D-galactopyranosyl-(1→4)-β-D-N-acetylglucosamine) is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-114771
-
-
- HY-W719025
-
|
|
Drug Derivative
|
Neurological Disease
|
|
α-Ethylaminopentiophenone hydrochloride is a substituted Cathinone that is an analog to ethcathinone, differing by having propyl rather than methyl at the α position.
|
-
- HY-153329
-
|
|
TNF Receptor
|
Others
|
|
TNF-α-IN-9 (compound 48) is a analog of NDM-1 inhibitor-3 (HY-150758). TNF-α-IN-9 is a TNF-α inhibitor. TNF-α-IN-9 shows low inhibitory activity [1].
|
-
- HY-P9967
-
|
BIIB037
|
Amyloid-β
|
Neurological Disease
|
|
Aducanumab (BIIB037) is a human monoclonal antibody that selectively targets aggregated amyloid-beta (Aβ). Aducanumab shows brain penetration, and can be used for Alzheimer's disease (AD) research [1].
|
-
- HY-153330
-
-
- HY-18370
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-2α-IN-3, an allosteric inhibitor of hypoxia inducible factor-2α (HIF-2α), exhibits an IC50 of 0.4 µM and a KD of 1.1 µM. Anticancer agent [1].
|
-
- HY-10426
-
|
|
Estrogen Receptor/ERR
Autophagy
|
Cancer
|
|
XCT-790 is a potent and selective inverse agonist for ERRα with an IC50 value of 0.37 μM. XCT-790 induces cell death in chemotherapeutic resistant cancer cells. XCT-790 (Compound 12) is inactive against ERRγ and the estrogen receptors ERα and ERβ .
|
-
- HY-121186R
-
|
|
Adrenergic Receptor
Calcium Channel
|
Neurological Disease
Metabolic Disease
|
|
Bevantolol (hydrochloride) (Standard) is the analytical standard of Bevantolol (hydrochloride). This product is intended for research and analytical applications. Bevantolol hydrochloride is a selective β1 and α1-adrenergic receptor antagonist with pKi values of 7.83, 6.9 in rat cerebral cortex, respectively. Bevantolol hydrochloride is a potent Ca 2+ antagonist [1] .
|
-
- HY-101355
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
CGP 20712 is a highly selective β1-adrenoceptor antagonist (Ki=0.3 nmol/L). CGP 20712’s primary mechanism of action is through competitively binding to β1-receptors, thereby blocking the positive chronotropic effects of adrenaline and noradrenaline [1].
|
-
- HY-17498S
-
|
(RS)-Atenolol-d7
|
Adrenergic Receptor
|
Neurological Disease
Endocrinology
|
|
Atenolol-d7 is the deuterium labeled Atenolol. Atenolol ((RS)-Atenolol) is a cardioselective β1-adrenergic receptor blocker, with a Ki of 697 nM atβ1-adrenoceptor in guine pig left ventricle membrane. Atenolol can be used for the research of hypertension and angina pectoris[1][2].
|
-
- HY-N12876
-
|
(18α)-Oleanic acid; (18α)-Caryophyllin
|
Others
|
Cancer
|
|
18α-Oleanolic acid is a natural pentacyclic triterpenic acid that can be isolated from plants [1].
|
-
- HY-P2602
-
|
|
GABA Receptor
|
Neurological Disease
|
|
α-Casozepine is a bioactive peptide derived from the α protein S1 casein in milk and has an affinity for γ-aminobutyric acid (GABA) receptors in the brain. α-Casozepine has anti-anxiety effects [1] .
|
-
- HY-B1837A
-
|
beta-Cyfluthrin
|
Calcium Channel
SOD
|
Neurological Disease
|
|
β-Cyfluthrin (beta-Cyfluthrin) is a type II synthetic pyrethroid and also an active ingredient of many insecticide products used for pestsin agriculture. β-Cyfluthrin is a neurotoxicant and affects calcium concentration in nervous tissue by inhibiting Ca 2+ ATPase involved in calcium transport [1].
|
-
- HY-N2794
-
|
α-Dihydrocaryopterone
|
NO Synthase
|
Inflammation/Immunology
|
|
9-Hydroxy-α-lapachone (α-Dihydrocaryopterone) is a natural phenol, exhibits potent inhibitory effects with an IC50 of 4.64 µM on LPS-induced NO production in RAW 264.7 cells [1].
|
-
- HY-N3002R
-
|
|
Tyrosinase
|
Metabolic Disease
|
|
α-Arbutin (Standard) is the analytical standard of α-Arbutin. This product is intended for research and analytical applications. α-Arbutin (4-Hydroxyphenyl α-D-glucopyranoside) is emerging as popular and effective skin whiteners, acting as tyrosinase inhibitor [1].
|
-
- HY-B1837AR
-
|
beta-Cyfluthrin (Standard)
|
Calcium Channel
SOD
|
Neurological Disease
|
|
β-Cyfluthrin (Standard) is the analytical standard of β-Cyfluthrin. This product is intended for research and analytical applications. β-Cyfluthrin (beta-Cyfluthrin) is a type II synthetic pyrethroid and also an active ingredient of many insecticide products used for pestsin agriculture. β-Cyfluthrin is a neurotoxicant and affects calcium concentration in nervous tissue by inhibiting Ca 2+ ATPase involved in calcium transport [1].
|
-
- HY-168641
-
|
|
PROTACs
Apoptosis
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
PROTAC HIF-1α degrader-1 (compound V2) is a potent hypoxia-inducible factor-1α (HIF-1α) PROTAC degrader with an IC50 value of 7.54 µM. PROTAC HIF-1α degrader-1 shows anti-proliferative activity. PROTAC HIF-1α degrader-1 decreases the HIF-1α protein expression. PROTAC HIF-1α degrader-1 induces apoptosis. (Pink: ligand for target protein (HY-111387); black: linker (HY-W013731); Blue: E3 ligase ligand (HY-112078)) [1].
|
-
- HY-165023
-
|
4-Bromo-α-PVP hydrochloride; 4-Bromo-α-Pyrrolidinopentiophenone hydrochloride
|
Biochemical Assay Reagents
|
Others
|
|
4-Bromo-α-pyrrolidinovalerophenone (hydrochloride) is a biochemical reagent.
|
-
- HY-122221
-
-
- HY-W009009
-
|
|
GABA Receptor
|
Neurological Disease
|
|
L-838417 is a selective partial agonist at the α2, α3 and α5 subtypes of the GABAA receptor and an antagonist at the α1, with binding Ki values of 0.79 nM, 0.67 nM, 1.67 nM, 267 nM, 2.25 nM and 2183 nM for α1β3γ2, α2β3γ2, α3β3γ2, α4β3γ2, α5β3γ2 and α6β3γ2 [1].
|
-
- HY-N5142
-
|
|
Bacterial
Antibiotic
NF-κB
AMPK
Fungal
|
Infection
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
α-Terpineol (with oral activity) can be found in Eucalyptus globulus Labill. α-Terpineol exhibits strong antimicrobial activity against periodontopathic and cariogenic bacteria.α-Terpineol possesses antifungal activity against T. mentagrophytes, and the activity might lead to irreversible cellular disruption. In addition, α-Terpineol exhibits antineuropathic and anti-inflammatory activities.
α-Terpineol can be utilized in research related to diarrhea, neuropathic pain, infections, and inflammation [1] [7].
|
-
- HY-121618
-
|
|
GABA Receptor
Reactive Oxygen Species
Parasite
Apoptosis
Autophagy
|
Infection
Neurological Disease
|
|
α-Thujone is a monoterpene isolated from Thuja occidentalis essential oil with potent anti-tumor activities. α-Thujone is a reversible modulator of the GABA type A receptor and the IC50 for α-Thujone is 21 μM in suppressing the GABA-induced currents. α-Thujone induces ROS accumulation-dependent cytotoxicity, also induces cell apoptosis and autophagy. α-Thujone has antinociceptive, insecticidal, and anthelmintic activity, and can cross the blood-brain barrier [1] .
|
-
- HY-165164
-
|
|
Others
|
Cancer
|
|
Methotrexate-alpha-alanine is a prodrug for activation by enzyme-monoclonal antibody conjugates. Methotrexate-alpha-alanine shows cytotoxicity [1] .
|
-
- HY-101103
-
|
(2-Hydroxypropyl)-β-cyclodextrin
|
Biochemical Assay Reagents
|
Cancer
|
|
HP-β-CD ((2-Hydroxypropyl)-β-cyclodextrin) is a widely used drug delivery vehicle to improve the stability and bioavailability.
|
-
- HY-W699023
-
|
|
Biochemical Assay Reagents
|
Others
|
|
p-Nitrophenyl 2-acetamido-2-deoxy-3-O-(2,3,4,6-tetra-O-acetyl-β-D-galactopyranosyl)-α-D-galactopyranoside is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-165277
-
|
|
Angiotensin-converting Enzyme (ACE)
|
Cardiovascular Disease
|
|
ε-Biotinamidocaproyl-β-alanyl-β-alanyl-lisinopril is an angiotensin-converting enzyme (ACE) inhibitor. Structurally, ε-Biotinamidocaproyl-β-alanyl-β-alanyl-lisinopril is a biotinylated derivative of lisinopril (HY-18206), with a chemical structure linking the biotin molecule and the lisinopril molecule composed of 19 atoms. ε-Biotinamidocaproyl-β-alanyl-β-alanyl-lisinopril can bind to both ACE and streptavidin (HY-P3152) simultaneously, making it possible to separate and purify ACE using streptavidin-agarose beads [1].
|
-
- HY-131696
-
|
11-deoxy PGF1α
|
Prostaglandin Receptor
|
Cardiovascular Disease
Others
|
|
11-deoxy Prostaglandin F1α (11-deoxy PGF1α) is an analog of prostaglandin F1α, exhibits side effects on intestines and causes the uterine contraction. 11-deoxy Prostaglandin F1α exhibits activity as vasopressor and bronchoconstrictor [1] .
|
-
- HY-N1719
-
|
2α,3α,23-Trihydroxyolean-12-en-28-oic acid
|
Others
|
Others
|
|
Isoarjunolic acid (2α,3α,23-Trihydroxyolean-12-en-28-oic acid) is a triterpenoid, can be isolated from the stems of Cornus kousa. Isoarjunolic acid could have free radical scavenging activity and elastase inhibition activity [1].
|
-
- HY-P2968
-
|
|
Amylases
|
Others
|
|
Bacterial α-Amylase catalyses the hydrolysis of internal α-1,4-glycosidic linkages in starch in low molecular weight products, such glucose, maltose and maltotriose units. Bacterial α-Amylase is often used in biochemical studies [1].
|
-
- HY-W020044R
-
|
|
Ferroptosis
DNA/RNA Synthesis
Apoptosis
|
Cancer
|
|
DL-alpha-Tocopherol (Standard) is the analytical standard of DL-alpha-Tocopherol. This product is intended for research and analytical applications. DL-alpha-Tocopherol is a synthetic vitamin E, with antioxidation effect. DL-alpha-Tocopherol protects human skin fibroblasts against the cytotoxic effect of UVB [1].
|
-
- HY-123422
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cardiovascular Disease
|
|
GSK360A is a potent and orally active HIF-PHD inhibitor with IC50 values of 10, 100, and 126 nM for PHD1, PHD2, and PHD3, respectively. GSK360A activates the HIF-1 alpha pathway and protect the failing heart after myocardial infarction (MI) [1].
|
-
- HY-144178
-
-
- HY-NP009
-
|
|
Biochemical Assay Reagents
|
Others
|
|
α-Lactalbumin is a Ca 2+-binding protein. α-Lactalbumin has a single strong Ca 2+-binding site and for this reason it frequently serves as a simple model Ca 2+-binding protein. α-Lactalbumin is a component of lactose synthase, an enzyme system, which consists of galactosyltransferase (GT) and α-Lactalbumin [1] .
|
-
- HY-120609
-
|
|
nAChR
|
Neurological Disease
|
|
BMS-902483 is a quinuclidine-containing spirooxazolidine that is a partial agonist of the α7 nicotinic acetylcholine receptor (nAChR). BMS-902483 improves cognitive ability in preclinical rodent models. [1].
|
-
- HY-137178
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
20α,22R-Dihydroxycholesterol is an endogenous metabolic intermediate. 20α,22R-Dihydroxycholesterol involved in the biosynthesis of cholesterol to steroid hormones [1].
|
-
- HY-170316
-
|
|
Ras
|
Others
|
|
Ibetazol is an inhibitor for importin β1 (KPNB1), that inhibits that binds to Cys585 of importin β1, inhibits the importin β1 mediated nuclear import with an EC50 of 6.1 µM [1].
|
-
- HY-110121
-
|
|
nAChR
|
Neurological Disease
|
|
NS3861 fumarate is an agonist of nicotinic acetylcholine receptors (nAChRs) and binds with high affinity to heteromeric α3β4 nAChR. The binding Ki values of 0.62, 25, 7.8, 55 nM for α3β4, α3β2, α4β4, α4β2, respectively [1].
|
-
- HY-110121A
-
|
|
nAChR
|
Neurological Disease
|
|
NS3861 is an agonist of nicotinic acetylcholine receptors (nAChRs) and binds with high affinity to heteromeric α3β4 nAChR. The binding Ki values of 0.62, 25, 7.8, 55 nM for α3β4, α3β2, α4β4, α4β2, respectively [1].
|
-
- HY-E70105
-
|
AxlA
|
Others
|
Others
|
|
α-Xylosidase (AxlA) belongs to the GH31 family of glycoside hydrolases and catalyzes the hydrolysis of an α1,6-linked xyloside. α-Xylosidase can effectively release terminal xylose from xyloglucan, a major plant hemicellulose [1].
|
-
- HY-167114
-
|
|
Aurora Kinase
PKC
|
Cancer
|
|
(Rac)-Aurora A/PKC-IN-1 (Compund 2e) is an orally active Aurora A and PKC (α, β1, β2 and θ) kinase inhibitor. (Rac)-Aurora A/PKC-IN-1 has antiproliferative activity in breast cancer cells in vitro and antimetastatic activity in vivo [1].
|
-
- HY-N0042R
-
-
- HY-N6927
-
|
Coleonol B
|
TNF Receptor
Interleukin Related
|
Inflammation/Immunology
|
|
Isoforskolin is the principle active component of C. forskohlii native to China. Isoforskolin reduces the secretion of lipopolysaccharide (LPS)-induced cytokines, namely TNF-α, IL-1β, IL-6 and IL-8, in human mononuclear leukocytes. Isoforskolin acts as an anti-inflammatory agent for the treatment of Lyme arthritis [1].
|
-
- HY-B0141C
-
|
β-Estradiol hemihydrate; 17β-Estradiol hemihydrate; 17β-Oestradiol hemihydrate
|
Estrogen Receptor/ERR
Endogenous Metabolite
Bacterial
|
Neurological Disease
Cancer
|
|
Estradiol (β-Estradiol) hemihydrate is a steroid hormone and the major female sex hormone. Estradiol (β-Estradiol) hemihydrate can up-regulate the expression of neural markers of human endometrial stem cells (hEnSCs) and promote their neural differentiation. Estradiol (β-Estradiol) hemihydrate can be used for the research of cancers, neurodegenerative diseases and neural tissue engineering [1] .
|
-
- HY-P0109
-
|
|
Cathepsin
|
Others
|
|
(S,S)-Z-FA-FMK is a cell-permeable, irreversible cathepsin B inhibitor. (S,S)-Z-FA-FMK blocks LPS-induced production of IL-1α and IL-1β. (S,S)-Z-FA-FMK can be used as a negative control for caspase-1 and caspase-2 inhibitors because it lacks an aspartic acid residue at the P1 position [1] .
|
-
- HY-107043
-
-
- HY-171254
-
|
|
p38 MAPK
|
Inflammation/Immunology
|
|
p38-α MAPK-IN-9 (Compound 25a) is a p38-α MAPK inhibitor (Ki: 0.057 nM). p38-α MAPK-IN-9 inhibits LPS (HY-D1056) induced TNFα production in hPBMCs (IC50: 18 nM) [1].
|
-
- HY-134163
-
|
4-Methylumbelliferyl Alpha-L-arabinopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
4-Methylumbelliferyl α-L-arabinopyranoside (4-Methylumbelliferyl alpha-L-arabinopyranoside) is a substrate for enzymes that hydrolyze arabinose-containing substrates, such as α-L-arabinopyranoside [1].
|
-
- HY-138871
-
-
- HY-142618
-
-
- HY-P10605
-
|
|
Akt
GSK-3
|
Cancer
|
|
GSK3β-peptide is a substrate mimetic peptide of glycogen synthase kinase 3-β (GSK3-β) that can bind to the active site of GSK3-β and mimic the behavior of a real substrate. GSK3β-peptide can be used to develop substrate mimetic inhibitors of Akt as potential anticancer drugs [1].
|
-
- HY-N14905
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
|
|
α-Prumycin hydrochloride is a carbohydrate antibiotic. α-Prumycin hydrochloride has anti-fungal activity and weak anti-individual bacterial activity.
|
-
- HY-122485
-
|
|
Others
|
Others
|
|
α-Copaene, a sesquiterpene hydrocarbon, is a fruit volatile. α-Copaene can be used as an oviposition promoter of Bactrocera oleae [1].
|
-
- HY-N6911A
-
|
|
Others
|
Inflammation/Immunology
|
|
18α-Glycyrrhizic acid is a derivate of Glycyrrhizic acid. 18α-Glycyrrhizic acid has weak antihepatotoxic anti-inflammatory activities [1].
|
-
- HY-P0128F1
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-β-Amyloid (25-35) is a fluorescent product labeled by FITC that can be used in Alzheimer's disease research [1].
|
-
- HY-W040294
-
|
Methyl α-D-glucopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
Methyl α-D-glucoside (Methyl α-D-glucopyranoside) can be used for protein glycosylation modification. Methyl α-D-glucoside is a kind of biological materials or organic compounds that are widely used in life science research [1].
|
-
- HY-137544
-
|
16-Phenyl tetranor PGF2α
|
Prostaglandin Receptor
Drug Metabolite
|
Metabolic Disease
|
|
16-phenyl tetranor Prostaglandin F2α (16-phenyl tetranor PGF2α) is a metabolically stable analog of PGF2α. The affinity of 16-phenyl tetranor PGF2α at the FP receptor of ovine luteal cells is poor (8.7%) compared to PGF2α.
|
-
- HY-114319
-
|
|
Others
|
Cancer
|
|
β-Cembrenediol is a potent and orally active anticancer agent. β-Cembrenediol shows phytotoxic activities. β-Cembrenediol reduces the migration and colony formation. β-Cembrenediol decreases the protein expression of TDO2, IDO1. β-Cembrenediol has the potential for the research of prostate cancer [1] .
|
-
- HY-N0347R
-
|
|
Progesterone Receptor
|
Endocrinology
|
|
17α-Hydroxyprogesterone acetate (Standard) is the analytical standard of 17α-Hydroxyprogesterone acetate. This product is intended for research and analytical applications. 17α-Hydroxyprogesterone acetate possesses progestational activity. 17α-Hydroxyprogesterone acetate has antiinflammatory effects at the murine maternal-fetal interface [1] .
|
-
- HY-N6968
-
|
Humulene; α-Caryophyllene
|
NO Synthase
COX
|
Inflammation/Immunology
|
|
α-Humulene is a main constituent of Tanacetum vulgare L. (Asteraceae) essential oil with anti-inflammation (IC50=15±2 μg/mL). α-Humulene inhibits COX-2 and iNOS expression [1].
|
-
- HY-107327
-
|
(±)-Carazolol; DL-Carazolol; Suacron
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Carazolol is a β1/β2 adrenoceptor antagonist of high potency used in the research of hypertension. Carazolol is also a potent, selective β3-adrenoceptor agonist [1].
|
-
- HY-115433R
-
|
|
Endogenous Metabolite
|
Metabolic Disease
Endocrinology
|
|
α-Muricholic acid (Standard) is the analytical standard of α-Muricholic acid. This product is intended for research and analytical applications. α-Muricholic acid is the most abundant primary bile acid in rodents [1] .
|
-
- HY-B0020
-
|
SDZ-ICS-930
|
5-HT Receptor
nAChR
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
Tropisetron Hydrochloride (SDZ-ICS-930) is an effective neuroprotective agent that acts as a 5-HT3 receptor antagonist, a calmodulin inhibitor, and an α7-nAChRreceptor agonist, with an IC50 of 70.1 nM for the 5-HT3 receptor. Tropisetron Hydrochloride has anti-inflammatory properties and immune-regulating functions, effectively alleviating symptoms associated with chemotherapy and post-surgery. Tropisetron Hydrochloride reduces Ab (HY-P4867)-induced hippocampal neuroinflammation [1] .
|
-
- HY-17498R
-
|
(RS)-Atenolol (Standard)
|
Adrenergic Receptor
|
Neurological Disease
Endocrinology
Cancer
|
|
Atenolol (Standard) is the analytical standard of Atenolol. This product is intended for research and analytical applications. Atenolol ((RS)-Atenolol) is a cardioselective β1-adrenergic receptor blocker, with a Ki of 697 nM atβ1-adrenoceptor in guine pig left ventricle membrane. Atenolol can be used for the research of hypertension and angina pectoris [1] .
|
-
- HY-N4155
-
|
|
EBV
HIV Protease
HSV
|
Infection
Cancer
|
|
2α,19α-Dihydroxy-3-oxo-urs-12-en-28-oic acid, a natural ursane-type triterpene, is a potent inhibitor of HIV protease (HIV Protease). 2α,19α-Dihydroxy-3-oxo-urs-12-en-28-oic acid is also an inhibitor of the activation of Epstein-Barr virus early antigen (EBV-EA). 2α,19α-Dihydroxy-3-oxo-urs-12-en-28-oic acid displays an inhibitory activity against nitric oxide production in Lipopolysaccharide (Lipopolysaccharides)-activated RAW 264.7 cells [1] .
|
-
- HY-P4211
-
|
|
Bacterial
|
Infection
|
|
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties [1] .
|
-
- HY-165292
-
|
α-Eudesmol
|
Calcium Channel
|
Others
|
|
(-)-α-Eudesmol is a diterpene dialdehyde that can be isolated from Porella [1].
|
-
- HY-N2922
-
|
|
Amyloid-β
NF-κB
|
Neurological Disease
Inflammation/Immunology
|
|
β-Amyrin shows effectively counteract amyloid β (Aβ)-induced impairment of long-term potentiation (LTP). β-Amyrin is a promising candidate for Alzheimer's disease (AD) research. β-Amyrin exhibits anti-inflammatory effects, protective activity against pulmonary fibrosis, and notable antibacterial capabilities. β-Amyrin is an orally active natural triterpenoid compound [1] .
|
-
- HY-N6018
-
|
|
Caspase
TNF Receptor
SOD
Reactive Oxygen Species
|
Inflammation/Immunology
Cancer
|
|
Beta-Eudesmol has anticancer and anti-inflammatory activities. Beta-Eudesmol can induce apoptosis. Beta-Eudesmol is a neostigmine antagonist. Beta-Eudesmol can antagonize neostigmine-induced neuromuscular failure. Beta-Eudesmol can be used in the study of sepsis diseases. Beta-Eudesmol is a sesquiterpene-like compound that can be extracted from the rhizome of Atractylodes lancea [1] .
|
-
- HY-N2337
-
|
11β-Hydroxyprogesterone
|
11β-HSD
|
Cardiovascular Disease
|
|
11beta-Hydroxyprogesterone is a potent inhibitors of 11β-Hydroxysteroid dehydrogenase; also activates human mineralocorticoid receptor in COS-7 cells with an ED50 of 10 nM.
|
-
- HY-116284A
-
|
Methyl β-D-glucoside hemihydrate
|
Others
|
Others
|
|
Methyl β-D-glucopyranoside (Methyl β-D-glucoside) hemihydrate is a hemihydrate compound. Methyl β-D-glucopyranoside hemihydrate less reactive at higher PH. The formation of Methyl β-D-glucopyranoside hemihydrate is stereospecific [1] .
|
-
- HY-142279S
-
-
- HY-144176
-
-
- HY-W049706
-
-
- HY-N10673
-
|
|
Others
|
Cancer
|
|
10α-Hydroxyepigambogic acid can be extracted from Garcinia hanburyi. 10α-Hydroxyepigambogic acid can be used in the research of tumors [1].
|
-
- HY-146788S
-
-
- HY-W020182R
-
|
|
Fungal
Parasite
|
Infection
|
|
α-Terpinene (Standard) is the analytical standard of α-Terpinene. This product is intended for research and analytical applications. α-Terpinene (Terpilene) is a monoterpene found in the essential oils of a large variety of foods and aromatic plants such as Mentha piperita. α-Terpinene is active against Trypanosoma evansi and has the potential for trypanosomosis treatment. α-Terpinene has antioxidant and antifungal properties [1] .
|
-
- HY-151341
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1/2α-IN-1 is an orally active HIF-2α inhibitor. HIF-1/2α-IN-1 inhibits HIF-2α activity with an IC50 value of 0.92 μM. HIF-1/2α-IN-1 also can decrease HIF-1α levels. HIF-1/2α-IN-1 can be used for the research of clear cell renal cell carcinoma (ccRCC) [1].
|
-
- HY-115903A
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1α-IN-2 hydrochloride is an effective HIF-1α inhibitor with anticancer potencies (IC50s of 28 nM and 15 nM in MDA-MB-231 and MiaPaCa-2 cells, respectively). HIF-1α-IN-2 hydrochloride suppresses HIF-1α expression by blocking transcription and protein translation [1].
|
-
- HY-113482
-
|
1β-OH-DCA
|
Endogenous Metabolite
Cytochrome P450
|
Metabolic Disease
|
|
1β-Hydroxydeoxycholic acid (1β-OH-DCA), a secondary bile acid, is a CYP3A biomarker. Deoxycholic acid is specifically metabolized into 1β-Hydroxydeoxycholic acid by CYP3A4 and CYP3A7 using recombinant human CYP450 enzymes [1].
|
-
- HY-B1803A
-
|
ICI 136753 hydrochloride
|
GABA Receptor
|
Neurological Disease
|
|
Tracazolate (ICI 136753) hydrochloride is a potent GABAA receptor modulator. Tracazolate hydrochloride has selectivity for β3 and potentiates α1β1γ2s (EC50=13.2 μM), α1β3γ2 (EC50=1.5 μM). Tracazolate hydrochloride has the potency (EC50) determined by the nature of the third subunit (γ1-3, δ, ε) within the receptor complex. Tracazolate hydrochloride possesses anxiolytic and anticonvulsant activity [1] .
|
-
- HY-N12995
-
-
- HY-400897
-
|
|
Ligands for Target Protein for PROTAC
EBI2/GPR183
|
Cancer
|
|
7α,25-Dihydroxycholesterol intermediate-1 is an intermediate in the synthesis of 7α,25-Dihydroxycholesterol (HY-113962). 7α,25-Dihydroxycholesterol (7α,25-OHC) can be used as a ligand to target the orphan GPCR receptor EBI2 (GPR183). body, used to synthesize the corresponding PROTEACs [1].
|
-
- HY-N3002
-
|
4-Hydroxyphenyl α-D-glucopyranoside
|
Tyrosinase
|
Neurological Disease
Metabolic Disease
Cancer
|
|
α-Arbutin (4-Hydroxyphenyl α-D-glucopyranoside) is a tyrosinase inhibitor, which is used as an effective skin whiteners. α-Arbutin is promising for research of various diseases such as hyperpigmentation disorders, types of cancers, central nervous system disorders, osteoporosis, diabetes [1] .
|
-
- HY-160437
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
TNF-α-IN-16 is a potent TNFα inhibitor with an IC50 of <0.6 μM. TNF-α-IN-16 has antiinflammatory properties (WO2001072735A2; example 18) [1].
|
-
- HY-160434
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
TNF-α-IN-13 is a potent TNFα inhibitor with an IC50 of <0.6 μM. TNF-α-IN-13 has antiinflammatory properties (WO2001072735A2; example 6) [1].
|
-
- HY-N7264
-
-
- HY-W106550
-
|
Pentaacetyl-α-D-galactopyranose
|
Biochemical Assay Reagents
|
Others
|
|
α-D-Galactose pentaacetate (Pentaacetyl-α-D-galactopyranose) is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-N6710R
-
|
|
Estrogen Receptor/ERR
|
Inflammation/Immunology
|
|
α-Zearalenol (Standard) is the analytical standard of α-Zearalenol. This product is intended for research and analytical applications. α-Zearalenol is a Mycotoxin with high affinity for the estrogen receptors (ER), α-Zearalenol is the derivative of zearalenone (ZEN), causes reproductive disorders in animals, due to its xenoestrogenic effects [1].
|
-
- HY-B1278S1
-
|
|
Endogenous Metabolite
|
Metabolic Disease
Cancer
|
|
α-Tocopherol-d6 (acetate) is the deuterium labeled D-α-Tocopherol acetate. D-α-Tocopherol acetate (D-Vitamin E acetate) can be hydrolyzed to d-alpha-tocopherol (VE) and absorbed in the small intestine[1].
|
-
- HY-107324R
-
|
|
Apoptosis
|
Cancer
|
|
β-Elemene (Standard) is the analytical standard of β-Elemene. This product is intended for research and analytical applications. β-Elemene ((-)-β-Elemene; Levo-β-elemene) is isolated from natural plant Curcuma aromatica with an antitumor activity. β-Elemene can induce cell apoptosis.
|
-
- HY-N2790
-
|
9,13α-Epidioxy-8(14)-abieten-18-oic acid
|
Others
|
Others
|
|
9α,13α-Epidioxyabiet-8(14)-en-18-oic acid (9,13α-Epidioxy-8(14)-abieten-18-oic acid) is a Sesquiterpenoids product that can be isolated from the rhizomes of Carpesium abrotanoides [1].
|
-
- HY-163598
-
-
- HY-N12119
-
|
|
Endogenous Metabolite
|
Others
|
|
ent-Prostaglandin F2α is the opposite enantiomer of PGF2α. ent-Prostaglandin F2α can be found in urine [1].
|
-
- HY-P10189
-
-
- HY-N13258
-
|
β-Citrylglutamic acid
|
Others
|
Others
|
|
β-Citryl-L-glutamic acid (β-Citrylglutamic acid) is a citrylglutamic acid, that can be isolated from newborn rat brain [1].
|
-
- HY-113630A
-
|
|
Biochemical Assay Reagents
|
Others
|
|
20β-22-Azacholesterol is the β-configuration of 22-Azacholesterol (HY-113630). 20β-22-Azacholesterol is an inhibitor for cholesterol side chain cleavage reactions [1].
|
-
- HY-E70525A
-
|
|
Proteasome
|
Inflammation/Immunology
|
|
Alpha 2 Macroglobulin, Human Plasma, Fast Form is a broad-spectrum protease inhibitor, representing the fast form (Fast Form) of Alpha 2 Macroglobulin. Alpha 2 Macroglobulin also has a slow form (Slow Form). The slow form of Alpha 2 Macroglobulin can lure active proteases into its molecular cage and subsequently "tag" its complex for elimination. The fast form of Alpha 2 Macroglobulin is an allosteric product of the slow form, generated when proteases are captured by A2M bait regions, leading to chemical cleavage of internal thioester bonds near the bait regions. Alpha 2 Macroglobulin also promotes cell migration and binds cytokines, growth factors, and damaged extracellular proteins. Alpha 2 Macroglobulin holds research significance in inflammation, immunity, and infection [1].
|
-
- HY-125396
-
|
11-Deoxy-PGF2β
|
Endogenous Metabolite
|
Others
|
|
11-Deoxyprostaglandin F2β (11-deoxy PGF2β) is an analog of PGF2β (HY-12956B). PGF2β is a metabolite produced by cyclooxygenase metabolism of arachidonic acid. PGF2β induces dose-dependent release of hexose containing mucin [1] .
|
-
- HY-P4911A
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research [1] .
|
-
- HY-115903
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1α-IN-2 is an effective HIF-1α inhibitor with anticancer potencies (IC50s of 28 nM and 15 nM in MDA-MB-231 and MiaPaCa-2 cells, respectively). HIF-1α-IN-2 suppresses HIF-1α expression by blocking transcription and protein translation [1].
|
-
- HY-Y0585
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
D-(-)-Mandelic acid is an orally active alpha hydroxycarboxylic acid that can be isolated from bitter almonds and Indian chestnut trees. It has antioxidant and antibacterial properties and is expected to play an important role in the treatment of rheumatoid arthritis [1][4].
|
-
- HY-113462R
-
|
|
Others
|
Cancer
|
|
α-Carotene (Standard) is the analytical standard of α-Carotene. This product is intended for research and analytical applications. α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables [1] .
|
-
- HY-130046S1
-
-
- HY-173144
-
-
- HY-161764
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-67 (compound 5k) is a potent α-Glucosidase inhibitor with IC50 values of 0.31, 4.51 µM for alpha-glucosidase and alpha-amylase, respectively. α-Glucosidase-IN-67 has the potential for the research of type-2 diabetes [1].
|
-
- HY-149668
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-41 (compound 5o) is a potent α-glucosidase inhibitor. α-Glucosidase-IN-41 can arise the changed secondary structure of α-Glu to hinder enzyme catalytic activity. α-Glucosidase-IN-41 can be used for diabetes mellitus research [1].
|
-
- HY-163370
-
-
- HY-P1875
-
-
- HY-N2854
-
-
- HY-163601
-
-
- HY-163602
-
-
- HY-162368
-
|
|
Phospholipase
|
Others
|
|
cPLA2α-IN-2 (Compound 122) is an inhibitor of cytosolic phospholipase A2α (cPLA2α) [1].
|
-
- HY-163600
-
-
- HY-163599
-
-
- HY-163597
-
-
- HY-163603
-
-
- HY-W013407
-
|
|
Tyrosine Hydroxylase
Thyroid Hormone Receptor
|
Neurological Disease
|
|
α-Methyltyrosine methyl ester hydrochloride is an orally active and competitive tyrosine hydroxylase inhibitor. α-Methyltyrosine methyl ester hydrochloride can inhibit the conversion of tyrosine to dopamine. α-Methyltyrosine methyl ester hydrochloride causes kidney damage and urethral calculi in rats. α-Methyltyrosine methyl ester hydrochloride can be used as a tool for sympathetic nervous system research [1].
|
-
- HY-108038
-
|
|
nAChR
|
Neurological Disease
|
|
ABT-107 is a selective α7 neuronal nicotinic receptor agonist. ABT-107 protects against nigrostriatal damage in rats with unilateral 6-hydroxydopamine lesions [1] .
|
-
- HY-B1178A
-
|
(+)-Cotinine; (R)-Cotinine; (R)-NIH-10498
|
nAChR
|
Neurological Disease
|
|
R-(+)-Cotinine ((+)-Cotinine), a Nicotine metabolite, lacks significant activity across a wide range of pharmacological targets. R-(+)-Cotinine can enhance the Ach-evoked current in human α7 nAChRs [1].
|
-
- HY-100806
-
-
- HY-107512
-
-
- HY-B1278B
-
|
(±)-Vitamin E acetate
|
Biochemical Assay Reagents
|
Infection
|
|
(±)-α-Tocopherol acetate ((±)-Vitamin E acetate), is a orally active synthetic form of vitamin E. (±)-α-Tocopherol acetate is the ester of acetic acid and α-tocopherol. (±)-α-Tocopherol acetate can be used for the research of the susceptibility of farmed fish to infectious diseases [1].
|
-
- HY-17498S1
-
-
- HY-P2871B
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α1-3,4,6 Galactosidase is a broad specificity exoglycosidase that catalyzes the hydrolysis of terminal, non-reducing α1-3, α1-4 and α1-6-linked galactose residues from oligosaccharides [1].
|
-
- HY-P0128
-
|
Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells [1].
|
-
- HY-P0252A
-
-
- HY-16686R
-
|
Alpha-Tocopherol phosphate (Standard); TocP (Standard); vitamin E phosphate (Standard)
|
Reactive Oxygen Species
Endogenous Metabolite
|
Cancer
|
|
α-Tocopherol (phosphate) (Standard) is the analytical standard of α-Tocopherol (phosphate). This product is intended for research and analytical applications. α-Tocopherol phosphate is a compound with the high activity of vitamin E.
|
-
- HY-160435
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
TNF-α-IN-14 is a potent and selective TNFα inhibitor with an IC50 value of 1.1 µM. TNF-α-IN-14 shows antiinflammatory properties (WO2001072735A2; compound 12) [1].
|
-
- HY-N0328
-
|
α-Mangostin
|
Reactive Oxygen Species
Apoptosis
Bacterial
Fungal
Virus Protease
|
Cancer
|
|
alpha-Mangostin (α-Mangostin) is a dietary xanthone with broad biological activities, such as antioxidant, anti-allergic, antiviral, antibacterial, anti-inflammatory and anticancer effects. It is an inhibitor of mutant IDH1 (IDH1-R132H) with a Ki of 2.85 μM.
|
-
- HY-113031S
-
-
- HY-N11697
-
|
|
P-glycoprotein
|
Cancer
|
|
α-Cryptoxanthin is a natural carotenoid with anticancer effects. α-Cryptoxanthin inhibits multidrug resistance 1 (MDR1) mediated efflux pump [1].
|
-
- HY-N0347
-
|
|
Progesterone Receptor
|
Endocrinology
|
|
17α-Hydroxyprogesterone acetate possesses progestational activity. 17α-Hydroxyprogesterone acetate has antiinflammatory effects at the murine maternal-fetal interface [1] .
|
-
- HY-B0225B
-
|
L-(-)-α-Methyldopa hydrate; MK-351 hydrate
|
Adrenergic Receptor
Endogenous Metabolite
|
Cardiovascular Disease
Endocrinology
|
|
Methyldopa hydrate (L-(-)-α-Methyldopa hydrate), a potent antihyoertensive agent, is an alpha-adrenergic agonist (selective for α2-adrenergic receptors). Methyldopa hydrate is a proagent and is metabolized (α-Methylepinephrine) in the central nervous system [1] .
|
-
- HY-B0225A
-
|
L-(-)-α-Methyldopa hydrochloride; MK-351 hydrochloride
|
Adrenergic Receptor
Endogenous Metabolite
|
Cardiovascular Disease
Endocrinology
|
|
Methyldopa hydrochloride (L-(-)-α-Methyldopa hydrochloride) hydrochloride, a potent antihyoertensive agent, is an alpha-adrenergic agonist (selective for α2-adrenergic receptors). Methyldopa hydrochloride is a proagent and is metabolized (α-Methylepinephrine) in the central nervous system [1] .
|
-
- HY-B0225
-
-
- HY-W416287
-
-
- HY-150560
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-11 is a highly permeable competitive α-glucosidase inhibitor with the IC50 value of 0.56 μM. α-Glucosidase-IN-11 binds to Trp residues in α-glucosidase and regulates protein folding. α-Glucosidase-IN-11 can be used to regulate blood glucose levels [1].
|
-
- HY-P2802A
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α-Glucosidase, bacillus stearothermophilus is a carbohydrase enzyme that catalyzes the release of α-glucose molecules. α-Glucosidase, bacillus stearothermophilus retains exoglycosidases, which hydrolyze α-glucosidic linkage at the nonreducing end of a substrate [1] .
|
-
- HY-N7830
-
|
|
ERK
|
Cancer
|
|
7α,15-Dihydroxydehydroabietic acid is a natural abietane-type diterpenoid with antiangiogenic effects [1].
|
-
- HY-130594
-
|
6α-PGI1
|
Prostaglandin Receptor
|
Others
|
|
6α-Prostaglandin I1 (6α-PGI1) is an analogue of prostacycline I2 (PGI2) and is resistant to hydrolysis in aqueous solution [1].
|
-
- HY-170035
-
|
C18 Glucosyl(β) ceramide (d18:1/18:0); D-glucosyl-β-1,1' N-stearoyl-D-erythro-sphingosine
|
Liposome
|
Neurological Disease
|
|
GlcCer (d18:1/18:0) (C18 Glucosyl(β) ceramide (d18:1/18:0)) is a glycosphingolipid. GlcCer (d18:1/18:0) is promising for research of Parkinson disease and dementia with Lewy bodies [1].
|
-
- HY-146981
-
-
- HY-B0446R
-
|
|
Adrenergic Receptor
TNF Receptor
Interleukin Related
VEGFR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Naphazoline (hydrochloride) (Standard) is the analytical standard of Naphazoline (hydrochloride). This product is intended for research and analytical applications. Naphazoline (Naphthazoline) hydrochloride is a potent α-adrenergic receptor agonist. Naphazoline hydrochloride reduces vascular hyperpermeability and promotes vasoconstriction. Naphazoline hydrochloride reduces the levels of inflammatory factors (TNF-α, IL-1β and IL-6), cytokines (IFN-γ and IL-4), IgE, GMCSF, and NGF。Naphazoline hydrochloride can be used for non-bacterial conjunctivitis research [1] .
|
-
- HY-N8573
-
|
|
Bacterial
|
Infection
|
|
β-phellandrene is an orally active monocyclic monoterpenes. β-Phellandrene is obtained from Carum petroselinum. β-phellandrene has strong ability to kill pest. β-phellandrene can be used as oil additives, natural pesticides and synthetic materials [1] .
|
-
- HY-133707
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
β-Muricholic acid is a potent and orally active biliary cholesterol-desaturating agent. β-Muricholic acid prevents cholesterol gallstones. β-Muricholic acid inhibits lipid accumulation. β-Muricholic acid has the potential for the research of nonalcoholic fatty liver disease (NAFLD) [1] .
|
-
- HY-148210
-
|
|
AMPK
|
Metabolic Disease
|
|
AMPK activator 9 (ZM-6) is a potent AMPK (α2β1γ1) activator with an EC50 value of 1.1 µM. AMPK activator 9 has the potential for the research of type 2 diabetes [1].
|
-
- HY-N7142
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
DL-Norepinephrine hydrochloride is a synthetic phenylethylamine. DL-Norepinephrine hydrochloride is a neurotransmitter targets α1 and β1 adrenoceptors. DL-Norepinephrine hydrochloride mimics the sympathomimetic actions of the endogenous norepinephrine．DL-Norepinephrine hydrochloride has an increasing effect on subendocardial oxygen tension [1].
|
-
- HY-139063
-
-
- HY-14823
-
-
- HY-160027
-
|
|
TNF Receptor
|
Inflammation/Immunology
|
|
TNF-alpha-IN-1 (compound 202) is an orally active inhibitor of TNF-alpha. TNF-alpha-IN-1 has anti-inflammatory activity which can used in study rheumatoid arthritis, psoriasis, and asthma [1].
|
-
- HY-B0874R
-
|
|
Insecticide
|
Others
|
|
Alpha-Cypermethrin (Standard) is the analytical standard of Alpha-Cypermethrin. This product is intended for research and analytical applications. Alpha-Cypermethrin (FMC 45497; Fendona; WL 85871) is an effective insecticide against house flies [1].
|
-
- HY-W243244
-
-
- HY-N6968R
-
|
|
NO Synthase
COX
|
Inflammation/Immunology
|
|
α-Humulene (Standard) is the analytical standard of α-Humulene. This product is intended for research and analytical applications. α-Humulene is a main constituent of Tanacetum vulgare L. (Asteraceae) essential oil with anti-inflammation (IC50=15±2 μg/mL). α-Humulene inhibits COX-2 and iNOS expression [1].
|
-
- HY-160416
-
-
- HY-N0255R
-
|
|
Apoptosis
|
Others
|
|
alpha-Hederin (Standard) is the analytical standard of alpha-Hederin. This product is intended for research and analytical applications. alpha-Hederin (α-Hederin), a monodesmosidic triterpenoid saponin, exhibits promising antitumor potential against a variety of human cancer cell lines. alpha-Hederin could inhibit the proliferation and induce apoptosis of gastric cancer accompanied by glutathione decrement and reactive oxygen species generation via activating mitochondrial dependent pathway [1].
|
-
- HY-N0728R
-
|
|
PI3K
Akt
|
Cardiovascular Disease
Cancer
|
|
α-Linolenic acid (Standard) is the analytical standard of α-Linolenic acid. This product is intended for research and analytical applications. α-Linolenic acid, isolated from Perilla frutescens, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer [1].
|
-
- HY-12753AS
-
|
SR35021-d7 hydrochloride
|
Thyroid Hormone Receptor
Isotope-Labeled Compounds
|
Cardiovascular Disease
|
|
Debutyldronedarone-d7 hydrochloride is deuterated labeled Debutyldronedarone hydrochloride (HY-12753A). Debutyldronedarone (SR35021) hydrochloride, the main metabolite of Dronedarone, is a selective thyroid hormone receptor α1 (TRα1) inhibitor. Debutyldronedarone hydrochloride inhibits T3 binding to TRα1 and TRβ1 by 77% and 25%, respectively. Debutyldronedarone hydrochloride can be used for the research of arrhythmic [1].
|
-
- HY-12753AR
-
|
SR35021 (hydrochloride) (Standard)
|
Thyroid Hormone Receptor
|
Cardiovascular Disease
|
|
Debutyldronedarone (hydrochloride) (Standard) is the analytical standard of Debutyldronedarone (hydrochloride). This product is intended for research and analytical applications. Debutyldronedarone (SR35021) hydrochloride, the main metabolite of Dronedarone, is a selective thyroid hormone receptor α1 (TRα1) inhibitor. Debutyldronedarone hydrochloride inhibits T3 binding to TRα1 and TRβ1 by 77% and 25%, respectively. Debutyldronedarone hydrochloride can be used for the research of arrhythmic [1].
|
-
- HY-W357155
-
|
Galactosyl-N-acetylglucosaminyl-β-p-nitrophenyl
|
Biochemical Assay Reagents
|
Others
|
|
Gal1-β-3GlcNAc-β-PNP (Galactosyl-N-acetylglucosaminyl-β-p-nitrophenyl) is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-N0683R
-
-
- HY-P3140
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-75) is the 61-75 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly enriched in presynaptic nerve terminals. α-Synuclein is a potential biomarker for Parkinson's disease (PD) [1] .
|
-
- HY-137412
-
|
Prostaglandin F2α 1,15-lactone
|
Drug Derivative
|
Endocrinology
|
|
PGF2α 1,15-lactone (Prostaglandin F2α 1,15-lactone) is a lipid-soluble internal ester of PGF2α. PGF2α 1,15-lactone decreases menstrual cycle lengths in non-pregnant rhesus monkeys. PGF2α 1,15-lactone terminates early pregnancy in the monkey [1].
|
-
- HY-W015084AR
-
|
|
Apoptosis
|
Cancer
|
|
(E)-β-Ionone (Standard) is the analytical standard of (E)-β-Ionone. This product is intended for research and analytical applications. (E)-β-Ionone is the isomer of β-Ionone (HY-W015084). β-Ionone is effective in the induction of apoptosis in gastric adenocarcinoma SGC7901 cells. β-Ionone has anti-cancer activity [1].
|
-
- HY-B0445A
-
|
β-DPN sodium; β-NAD sodium; β-Nicotinamide Adenine Dinucleotide sodium
|
Endogenous Metabolite
|
Metabolic Disease
|
|
NAD (β-Nicotinamide Adenine Dinucleotide) sodium is an analogue of NAD. NAD sodium can be reduced to β-nicotinamide adenine dinucleotide (NADH) during coupling with reactions which oxidize organic substrates. NAD sodium can be converted to β-nicotinamide adenine dinucleotide (NADH) and passes to the inside of mitochondria that indirectly generates ATP [1].
|
-
- HY-169941
-
|
|
Estrogen Receptor/ERR
|
Metabolic Disease
Cancer
|
|
ERα/ERβ antagonist-1 (Compound 10) is partial antagonists of ERα and ERβ. ERα/ERβ antagonist-1 reduces ERα and ERβ activity in a dose-dependent manner in HepG2 liver cells [1].
|
-
- HY-A0249
-
-
- HY-158460
-
|
Galactose-Alpha-1,3-galactose
|
Biochemical Assay Reagents
|
Others
|
|
Alpha-Gal (Galactose-alpha-1,3-galactose) is a N-polysaccharide protein and a multifunctional fluorescent linker. The resulting conjugates exhibit high sensitivity and specificity by mimicking the antennal elements of N-glycans [1].
|
-
- HY-W104821
-
|
|
Keap1-Nrf2
|
Metabolic Disease
|
|
Rosolic Acid is an activator of Nrf2, as well as its downstream targets. Rosolic Acid increases the levels of angiogenic factors, decreases inflammation (TNF-α and IL-1β) and apoptotic markers (CXCL10 and CCL2). Rosolic Acid restores the function of pancreatic cells and protects endothelial cells (ECs) from endoplasmic reticulum stressed [1].
|
-
- HY-112389
-
|
|
p38 MAPK
|
Inflammation/Immunology
|
|
p38 MAP Kinase Inhibitor III (compound 7h) is a p38 MAPK inhibitor with an 50 of 0.9 μM. p38 MAP Kinase Inhibitor III also inhibits IL-1β and TNF-α release with 50 values of 0.37 μM and 0.044 μM, respectively [1].
|
-
- HY-N1527
-
|
Quinovic acid 3-O-α-L-rhamnoside
|
Others
|
Others
|
|
Quinovic acid 3-O-α-L-rhamnopyranoside (Quinovic acid 3-O-α-L-rhamnoside) is glycoside derivative. Quinovic acid 3-O-α-L-rhamnopyranoside can be isolated from the root bark of Guettarda angelica [1].
|
-
- HY-113031S1
-
-
- HY-139246
-
-
- HY-170052
-
-
- HY-78263
-
|
NSC 170724; 5-(2-Nitrovinyl)benzodioxole
|
Src
Syk
NOD-like Receptor (NLR)
Integrin
|
Cancer
|
|
MNS (NSC 170724), the beta-nitrostyrene derivative, is an orally active tyrosine kinase inhibitor and a broad-spectrum antiplatelet agent. MNS inhibits Src, Syk, and FAK with IC50 of 27.3, 2.8, and 97.6 μM, respectively. MNS inhibits NLRP3 inflammasome and β1 integrin. MNS completely inhibits U46619, ADP-, arachidonic acid-, collagen-, and thrombin-induced platelet aggregation with IC50 values of 2.1, 4.1, 5.8, 7.0, and 12.7 μM, respectively. MNS is cytotoxic to a variety of cells [1] [7] .
|
-
- HY-W720313
-
|
|
Drug Derivative
|
Neurological Disease
|
|
4-Methyl-α-ethylaminobutiophenone hydrochloride is a para-methyl analog of buphedrone with an ethyl group replacing methyl at the alpha position.
|
-
- HY-U00376
-
-
- HY-151466
-
|
|
HIF/HIF Prolyl-Hydroxylase
Monoamine Oxidase
|
Cancer
|
|
HIF-1α-IN-5 is a HIF-1α inhibitor with an IC50 value of 24 nM (in HEK293T cell). HIF-1α-IN-5 also inhibits MAO-A activity. HIF-1α-IN-5 downregulates VEGF and PDK1 mRNA expressions under hypoxia. HIF-1α-IN-5 can be used in the research of cancer [1].
|
-
- HY-156078
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-32 (compound f26) is a reversible, noncompetitive and orally active α-glucosidase inhibitor with an IC50 value of 3.07 μM. α-Glucosidase-IN-32 complex with α-glucosidase through hydrogen bonds and hydrophobic interactions, led to changes in the conformation and secondary strictures of α-glucosidase and further the inhibition of the enzymatic activity. α-Glucosidase-IN-32 can be used for diabetic disease research [1].
|
-
- HY-168495
-
|
|
Amylases
Glycosidase
|
Metabolic Disease
|
|
α-Amylase-IN-12 (Compound 5e) is an α-amylase inhibitor (IC50: 0.15 mM) with a mixed inhibition. α-Amylase-IN-12 has an IC50 of 9.40 mM against α-glucosidase. α-Amylase-IN-12 promotes glucose uptake in yeast cells and exhibits significant antiglycation activity at high concentrations. α-Amylase-IN-12 can be used for the research of diabetes [1].
|
-
- HY-147813
-
-
- HY-169283
-
|
|
Carbonic Anhydrase
|
Metabolic Disease
|
|
α-Glycosidase-IN-2 (compound 8b) is a α-Glycosidase inhibitor with the Ki values of 74.16 nM and 6.09 nM for aldose reductase and α-glycosidase,respectively. α-Glycosidase-IN-2 can be used for study of
diabetes mellitus [1].
|
-
- HY-N2852
-
|
|
Reactive Oxygen Species
|
Others
|
|
α-Terthienylmethanol is a terthiophene isolated from the n-hexane fraction of E. prostrata. α-Terthienylmethanol has potent cytotoxic activity against human endometrial cancer cells (Hec1A and Ishikawa) (IC50 < 1 μM). α-Terthienylmethanol increases the intracellular level of ROS and decreases that of GSH [1].
|
-
- HY-124085
-
-
- HY-N0375R
-
|
|
Proteasome
NF-κB
Apoptosis
|
Neurological Disease
Inflammation/Immunology
Cancer
|
|
18α-Glycyrrhetinic acid (Standard) is the analytical standard of 18α-Glycyrrhetinic acid. This product is intended for research and analytical applications. 18α-Glycyrrhetinic acid, a diet-derived compound, is an inhibitor of NF-kB and an activator of proteasome, which serves as pro-longevity and anti-aggregation factor in a multicellular organism. 18α-Glycyrrhetinic acid induces apoptosis [1] .
|
-
- HY-N5112A
-
|
Arnebin 1
|
HIF/HIF Prolyl-Hydroxylase
|
Others
|
|
β,β-Dimethylacrylalkannin (Arnebin 1) is a napthoquinone isolated from Alkanna cappadocica , increases collagen and involucrin content in skin cells [1].
|
-
- HY-N13917
-
|
|
Proteasome
Bacterial
|
Infection
Cancer
|
|
Argyrin B, a natural product cyclic peptide, is a reversible, non-competitive immunoproteasome inhibitor. Argyrin B shows selective inhibition of the β5i and β1i sites of the immunoproteasome over the β5c and β1c sites of the constitutive proteasome with nearly 20-fold selective inhibition of β1i over the homologous β1c. Argyrin B has antibacterial effects [1].
|
-
- HY-17498S3
-
-
- HY-151344
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1/2α-IN-2 is an inhibitor of HIF-1/2α. HIF-1/2α-IN-2 decrease HIF-1/2α levels and induces iron starvation response by targeting Iron Sulfur Cluster Assembly 2 (ISCA2) [1].
|
-
- HY-P1863
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
α-Neoendorphin (1-8) is a 8-amino acid peptide derived from the N-terminal of α-Neoendorphin. α-Neoendorphin is an endogenous opioid peptide.
|
-
- HY-N10497
-
|
|
nAChR
|
Neurological Disease
|
|
Dihydro-β-erythroidine is a a competitive nicotinic receptor antagonist. Dihydro-β-erythroidine blocks the discriminative stimulus properties of nicotine. Dihydro-β-erythroidine inhibits the anxiolytic effect of nicotine induced [1] .
|
-
- HY-18874
-
|
|
p38 MAPK
Autophagy
|
Others
|
|
p38-α MAPK-IN-1 is an inhibitor of MAPK14 (p38-α), with IC50 of 2300 nM in EFC displacement assay, and 5500 nM in HTRF assay [1].
|
-
- HY-F0004
-
|
β-NM; NMN
|
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
β-nicotinamide mononucleotide (β-NM) is a product of the nicotinamide phosphoribosyltransferase (NAMPT) reaction and a key NAD + intermediate. The pharmacological activities of β-nicotinamide mononucleotide include its role in cellular biochemical functions, cardioprotection, diabetes, Alzheimer's disease, and complications associated with obesity [1].
|
-
- HY-W020044S1
-
|
|
Ferroptosis
|
Others
|
|
DL-alpha-Tocopherol-d9 is the deuterium labeled DL-alpha-Tocopherol[1]. DL-alpha-Tocopherol is a synthetic vitamin E, with antioxidation effect. DL-alpha-Tocopherol protects human skin fibroblasts against the cytotoxic effect of UVB[2].
|
-
- HY-P10617
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Salusin-β is an endogenous bioactive peptide with significant hemodynamic and mitogenic activity. Salusin-β can stimulate the proliferation of quiescent vascular smooth muscle cells (VSMCs) and fibroblasts, leading to a rapid and significant decrease in blood pressure and heart rate. In addition, Salusin-β can stimulate the release of arginine vasopressin from the pituitary gland in rats. This makes Salusin-β have important application potential in cardiovascular disease research [1].
|
-
- HY-151465
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-1α-IN-4 is a HIF-1α inhibitor with an IC50 value of 24 nM (in HEK293T cell). HIF-1α-IN-4 downregulates VEGF and PDK1 mRNA expressions under hypoxia. HIF-1α-IN-4 can be used in the research of cancer [1].
|
-
- HY-W019878
-
|
β-Lipotropin 61-91
|
Opioid Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats [1] .
|
-
- HY-P4865
-
-
- HY-P4870
-
-
- HY-P4868
-
-
- HY-P0252B
-
|
α-Melanocyte-Stimulating Hormone free acid
|
Melanocortin Receptor
|
Neurological Disease
|
|
α-MSH free acid (α-Melanocyte-Stimulating Hormone free acid) is an MC3R and MC4R agonist with EC50s of 0.16 nM and 5.6 nM, respectively. α-MSH free acid activates cAMP generation at MC3R and MC4R [1].
|
-
- HY-N7148S
-
-
- HY-P1522
-
-
- HY-P5333A
-
|
UB311 immunogen I acetate
|
Amyloid-β
|
Neurological Disease
|
|
Aβ1-14-εK-KKK-MvF5 Th acetate is the acetate salt form of Aβ1-14-εK-KKK-MvF5 Th (HY-P5333). Aβ1-14-εK-KKK-MvF5 Th acetate is part of UB-311 vaccine, that targets the amyloid-beta (Aβ) protein, and ameliorates the Alzheimer’s disease [1].
|
-
- HY-137119
-
|
5-iso Prostaglandin F2α-VI
|
Prostaglandin Receptor
|
Others
|
|
(±)5-iPF2α-VI (5-iso Prostaglandin F2α-VI) is the racemate of 5-iPF2α-VI. 5-iPF2α-VI is a regioisomeric isoprostane formed from arachidonic acid (AA) and is a biomarker of oxidative stress [1].
|
-
- HY-125586
-
|
|
DNA/RNA Synthesis
ADC Cytotoxin
|
Cancer
|
|
β-Amanitin is a cyclic peptide toxin in the poisonous Amanita phalloides mushroom. β-Amanitin inhibits inhibits eukaryotic RNA polymerase II and III. β-Amanitin inhibits protein synthesis. β-Amanitin can be used as a cytotoxic component of antibody-drug conjugates (ADCs) [1] .
|
-
- HY-W062702
-
|
|
nAChR
|
Neurological Disease
|
|
BMS-933043 is a potent and selective α7 nACh receptor partial agonist. BMS-933043 attenuates the cognitive impairment in mice and can be utilized in research related to cognitive dysfunction in schizophrenia [1].
|
-
- HY-118517
-
|
(E)-α-Hydroxy tamoxifen; α-OHTAM
|
Drug Metabolite
|
Cancer
|
|
α-Hydroxytamoxifen is a metabolite of tamoxifen, reacts with DNA in the absence of metabolizing enzymes, and causes formation of DNA adducts [1].
|
-
- HY-W517264
-
|
BM 51052 hydrochloride
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Carazolol (BM 51052) hydrochloride is a highly potent antagonist of β1/β2 adrenoceptor. Carazolol hydrochloride is also a potent, selective β3-adrenoceptor agonist. Carazolol hydrochloride can be used in the research of hypertension [1].
|
-
- HY-N9987
-
-
- HY-130570
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Beta-gal-nonoate is a β-galactosidase dependent nitric oxide (NO) donor that releases NO once activated by β-galactosidase. β-Gal-NONOate has bactericidal activity and can be used as a bactericide [1].
|
-
- HY-N0710R
-
|
|
Endogenous Metabolite
|
Inflammation/Immunology
|
|
alpha-Cyperone (Standard) is the analytical standard of alpha-Cyperone. This product is intended for research and analytical applications. alpha-Cyperone (α-Cyperone) is associated with the down-regulation of COX-2, IL-6, Nck-2, Cdc42 and Rac1, resulting in reduction of inflammation, which would be highly beneficial for treatment of inflammatory diseases such as AD.
|
-
- HY-N6825R
-
|
|
TRP Channel
Endogenous Metabolite
|
Neurological Disease
|
|
Hydroxy-α-sanshool (Standard) is the analytical standard of Hydroxy-α-sanshool. This product is intended for research and analytical applications. Hydroxy-α-sanshool is a transient receptor potential ankyrin 1 (TRPA1) and TRP vanilloid 1 (TRPV1) agonist with EC50s of 69 and 1.1 μM, respectively. Hydroxy-α-sanshool can be used for pain research [1] .
|
-
- HY-N5142R
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
α-Terpineol (Standard) is the analytical standard of α-Terpineol. This product is intended for research and analytical applications. α-Terpineol is isolated from Eucalyptus globulus Labill, exhibits strong antimicrobial activity against periodontopathic and cariogenic bacteria [1].
α-Terpineol possesses antifungal activity against T. mentagrophytes, and the activity might lead to irreversible cellular disruption .
|
-
- HY-160777
-
|
Galeterone 3β-imidazole
|
Molecular Glues
Androgen Receptor
MNK
|
Cancer
|
|
VNPP433-3β is a molecular glue degrader, which degrades androgen receptor (AR) and its splice variants (AR-Vs) and MAP kinase-interacting serine/threonine protein kinase Mnk1/2. VNPP433-3β inhibits proliferation of cancer cell LNCaP, C4-2B and CWR22Rv1 with GI50 of 0.2, 0.3 and 0.31 μM. VNPP433-3β exhibits good pharmacokinetic characters in CD-1 mouse and inhibits tumor growth in the CWR22Rv1 xenograft mouse model [1].
|
-
- HY-N15019
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Glycothiohexide α is a peptide antibiotic. Glycothiohexide α has strong activity against Gram-positive bacteria including methicillin-resistant Staphylococcus aureus (MRSA) and vancomycin resistant enterococcus (VREF), MIC values of 0.03-0.06 μg/mL [1].
|
-
- HY-N2921
-
|
(3β)-3-(Acetyloxy)olean-12-en-11-one; 11-Oxo-β-amyrin acetate
|
Others
|
Others
|
|
β-Amyrenonol acetate ((3β)-3-(Acetyloxy)olean-12-en-11-one) is a Triterpenoids product that can be isolated from the barks of Clausena excavata [1].
|
-
- HY-164159
-
-
- HY-N8531
-
|
|
Drug Derivative
|
Others
|
|
4α-Methylcholesterol is a Cholesterol derivative. 4α-Methylcholesterol can oxidize 3-hydroxy steroid, with the apparent Km of 12.6 μM [1] .
|
-
- HY-170796
-
|
|
Amylases
|
Metabolic Disease
|
|
α-Amylase-IN-11 (compound C5f) is an α-Amylase inhibitor (IC50=0.56 μM) that can reduce the sugar level in vivo. α-Amylase-IN-11 has a moderate inhibitory effect on α-glucosidase (α-glucosidase), with IC50=11.03 μM. α-Amylase-IN-11 can significantly reduce the glucose concentration in a mouse model and has the potential for use in diabetes research [1].
|
-
- HY-158571
-
-
- HY-W357146
-
|
Phenethyl β-D-galactoside
|
Others
|
Others
|
|
2-Phenylethyl β-D-galactopyranoside (Phenethyl β-D-galactoside) can be synthesized catalyzed by Aspergillus oryzae β-galactosidase [1].
|
-
- HY-126083
-
|
Wortmannin-17β-ol
|
PI3K
|
Others
Cancer
|
|
17β-Hydroxywortmannin (Wortmannin-17β-ol) is an orally active inhibitor for phosphatidylinositol-3-kinase (PI-3-kinase) with an IC50 of 0.5 nM, suppresses the osteoclast resorption with an IC50 of 10 nM [1]. 17β-Hydroxywortmannin exhibits antitumor activity .
|
-
- HY-146032
-
-
- HY-153016
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Inflammation/Immunology
|
|
HIF-2α agonist 2 (compound 10) is a HIF-2α agonist with an EC50 value of 1.68 μM at the dose of 20 μM. HIF-2α agonist 2 is non-cytotoxic against 786-O-HRE-Luc cells. HIF-2α agonist 2 can be used for oxygen metabolism research [1].
|
-
- HY-P1482A
-
|
Mating Factor α TFA
|
Sex Pheromone
|
Cancer
|
|
α-Factor Mating Pheromone, yeast (TFA) is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor [1].
|
-
- HY-145419
-
|
|
IRE1
|
Others
|
|
IRE1α kinase-IN-4 (compound 6) is a potent IRE1α inhibitor with an Ki of 140 nM. IRE1α kinase-IN-4 is the ATP-competitive ligands of IRE1α [1].
|
-
- HY-145420
-
|
|
IRE1
|
Others
|
|
IRE1α kinase-IN-5 (compound 7) is a potent IRE1α inhibitor with an Ki of 98 nM. IRE1α kinase-IN-5 is the ATP-competitive ligands of IRE1α [1].
|
-
- HY-145418
-
|
|
IRE1
|
Others
|
|
IRE1α kinase-IN-3 (compound 2) is a potent IRE1α inhibitor with an Ki of 480 nM. IRE1α kinase-IN-3 is the ATP-competitive ligands of IRE1α [1].
|
-
- HY-157489
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-47 (compound 8H) is a non-competitive α-glucosidase (α-glucosidase) inhibitor with IC50 value is 38.2 μM and Ki value is 38.2 μM. α-Glucosidase-IN-47 can be used in diabetes research. [1].
|
-
- HY-N6710S
-
-
- HY-138097
-
|
|
Chemerin Receptor
Aldehyde Dehydrogenase (ALDH)
Cholinesterase (ChE)
Apoptosis
|
Cancer
|
|
α-NETA is a potent and noncompetitive choline acetyltransferase (ChA) inhibitor with an IC50 of 9 μM. α-NETA is a potent ALDH1A1 (IC50=0.04 µM) and chemokine-like receptor-1 (CMKLR1) antagonist. α-NETA weakly inhibits cholinesterase (ChE; IC50=84 µM) and acetylcholinesterase (AChE; IC50=300 µM). α-NETA has anti-cancer activity [1] .
|
-
- HY-103214
-
-
- HY-W708286
-
-
- HY-168814
-
-
- HY-148616
-
-
- HY-171297
-
-
- HY-117623
-
|
PF-249
|
AMPK
|
Metabolic Disease
|
|
PF-06685249 (PF-249) is a potent and orally active allosteric AMPK activator with an EC50 of 12 nM for recombinant AMPK α1β1γ1. PF-06685249 can be used for diabetic nephropathy research [1].
|
-
- HY-103683R
-
|
|
AMPK
|
Metabolic Disease
|
|
PF-06409577 (Standard) is the analytical standard of PF-06409577. This product is intended for research and analytical applications. PF-06409577 is a potent and selective allosteric activator of AMPK α1β1γ1 isoform with an EC50 of 7 nM.
|
-
- HY-117543
-
|
AMP-53; 6-Ethoxyazonafide
|
Topoisomerase
|
Cancer
|
|
Ethonafide (AMP-53) is an anthracene-containing derivative of Amonafide that belongs to the Azonafide series of anticancer agents. Ethonafide (AMP-53) inhibits topoisomerase II activity by stabilizing the enzyme-DNA complex, involving both topoisomerase IIα and β .
|
-
- HY-133708
-
|
1-O-Galloyl-β-D-glucose
|
Aldose Reductase
Reactive Oxygen Species
NF-κB
PDGFR
SOD
|
Neurological Disease
Metabolic Disease
|
|
β-Glucogallin is an orally active and selective aldose reductase (AKR1B1) inhibitor with an IC50 value of 58 μM when using Glyceraldehyde (HY-128748) as AKR1B1 substrate. β-Glucogallin reduces ROS, PDGF, RAGE, and NF-κB. β-Glucogallin increases SOD. β-Glucogallin has antioxidant and hepatoprotective effects. β-Glucogallin can be used in retinal research [1] .
|
-
- HY-161265
-
-
- HY-107935
-
|
Fluprednisolone
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
|
6α-Fluoroprednisolone (Fluprednisolone) is an internal standard for methylprednisolone, prednisolone and prednisone. 6α-Fluoroprednisolone is an anti-inflammatory agent. 6α-Fluoroprednisolone can be used for congenital adrenal virilism and Addison's disease research [1] .
|
-
- HY-162093
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Aβ1–42 aggregation inhibitor 2 (compound 7c) is a potent inhibitor of Aβ1-42 aggregation that plays an important role in Alzheimer's disease research. Aβ1–42 aggregation inhibitor 2 displays excellent antioxidant, metal ions chelating, oxidative stress alleviation, neuroprotective and anti-neuroinflammatory activities [1].
|
-
- HY-N2408
-
|
Isophorbol; α-Phorbol
|
Others
|
Others
|
|
4α-Phorbol is a compound that can be isolated from croton oil [1].
|
-
- HY-N0728
-
|
|
PI3K
Akt
|
Cardiovascular Disease
Cancer
|
|
α-Linolenic acid, isolated from Perilla frutescens, is an essential fatty acid that cannot be synthesized by humans. α-Linolenic acid can affect the process of thrombotic through the modulation of PI3K/Akt signaling. α-Linolenic acid possess the anti-arrhythmic properties and is related to cardiovascular disease and cancer [1].
|
-
- HY-P1264F
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) [1].
|
-
- HY-N12135
-
|
|
Others
|
Cancer
|
|
15α-Hydroxy-20-oxo-6,7-seco-ent-kaur-16-en-1,7α(6,11α)-diolide (compound 2) is an enantio-kaurene diterpenoid (ent -kaurene diterpenoid), which can be isolated from Rubescens rubescens. 15α-Hydroxy-20-oxo-6,7-seco-ent-kaur-16-en-1,7α(6,11α)-diolide has cellular activity against EC-1, U87, A549, MCF-7 and HeLa cell lines Toxicity, IC50s are 37.69 μM, 79.362 μM, 80.07 μM, 197.35 μM, 462.13 μM, and 180.09 μM respectively [1].
|
-
- HY-148264
-
-
- HY-B0020R
-
|
SDZ-ICS-9323 (Standard)
|
5-HT Receptor
nAChR
|
Neurological Disease
Cancer
|
|
Tropisetron (Hydrochloride) (Standard) is the analytical standard of Tropisetron (Hydrochloride). Tropisetron Hydrochloride (SDZ-ICS-930) is an effective neuroprotective agent that acts as a 5-HT3 receptor antagonist, a calmodulin inhibitor, and an α7-nAChRreceptor agonist, with an IC50 of 70.1 nM for the 5-HT3 receptor. Tropisetron Hydrochloride has anti-inflammatory properties and immune-regulating functions, effectively alleviating symptoms associated with chemotherapy and post-surgery. Tropisetron Hydrochloride reduces Ab (HY-P4867)-induced hippocampal neuroinflammation [1] .
|
-
- HY-B0072S
-
-
- HY-W654353
-
|
T-α-MCA-d4-1 sodium
|
Isotope-Labeled Compounds
FXR
Endogenous Metabolite
|
Others
|
|
Tauro-α-muricholic acid-d4-1 (sodium) is deuterium labeled Tauro-α-muricholic acid (sodium). Tauro-α-muricholic acid (T-α-MCA) sodium is a FXR (Farnesoid X receptor) antagonist (IC50=28μM). Tauro-α-muricholic acid sodium is also a endogenous metabolite that can be found in cecal [1] .
|
-
- HY-162364
-
|
|
p38 MAPK
|
Neurological Disease
|
|
p38-α MAPK-IN-7 (compound 4) is a p38α-MAPK inhibitor with an IC50 value of 98.7 nM. p38-α MAPK-IN-7 protects neuronal cells from dexamethasone-induced ROS production [1].
|
-
- HY-P1084A
-
|
β-PMTX TFA
|
Sodium Channel
|
Neurological Disease
|
|
β-Pompilidotoxin TFA (β-PMTX TFA), a wasp venom, can slow sodium channel inactivation and increases steady-state sodium current in cells [1].
|
-
- HY-161522
-
|
|
Glycosidase
Carbonic Anhydrase
|
Endocrinology
|
|
α-Glucosidase-IN-63 (Compound 4d) is an inhibitor of α-Glucosidase (IC50=0.44 μM). α-Glucosidase-IN-63 inhibits hCA II with an activity of Ki= 7.0 nM. α-Glucosidase-IN-63 is orally effective. [1].
|
-
- HY-148575
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-23 is an orally active α-Glucosidase inhibitor. α-Glucosidase-IN-23 decreases blood glucose by a-glucosidase inhibition with an IC50 value of 4.48 μM. α-Glucosidase-IN-23 can be used for the research of diabetes [1].
|
-
- HY-P1046
-
|
Amyloid β-Protein (1-15)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-15) is a fragment of β-Amyloid peptide. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-N7857
-
|
19(R)-Hydroxy PGF2α
|
Drug Metabolite
|
Metabolic Disease
|
|
19(R)-Hydroxy-prostaglandin F2α (19(R)-hydroxy PGF2α) is an ω-1 hydroxylase metabolite of PGF2α found in human semen. The concentration of 19(R)-Hydroxy-PGFs compounds (F2α and F1α together) in fresh human semen is about 20 μg/mL. 19(R)-Hydroxy-prostaglandin F2α exhibits no activity at the FP receptor of the cat iris sphincter muscle at concentrations up to 1 μM.
|
-
- HY-106029
-
|
α-TPA
|
PKC
SphK
NF-κB
|
Cancer
|
|
4α-TPA is an inactive form of TPA, and is used as a negative control for TPA-activated events [1].
|
-
- HY-N7136R
-
|
|
Cytochrome P450
|
Metabolic Disease
|
|
α-Terpinyl acetate (Standard) is the analytical standard of α-Terpinyl acetate. This product is intended for research and analytical applications. α-Terpinyl acetate is a monoterpene ester isolated from Laurus nobilis L. essential oil. α-Terpinyl acetate is a competitive P450 2B6 substrate which binding to the active site of P450 2B6 with a Kd value of 5.4 μM [1] .
|
-
- HY-N6710
-
|
|
Estrogen Receptor/ERR
|
Inflammation/Immunology
|
|
α-Zearalenol is a Mycotoxin with high affinity for the estrogen receptors (ER),
α-Zearalenol is the derivative of zearalenone (ZEN), causes reproductive disorders in animals, due to its xenoestrogenic effects [1].
|
-
- HY-W587956
-
|
|
Fungal
|
Infection
|
|
α-Guaiene is a sesquiterpene that could be found in Pogostemon cablin. α-Guaiene is the predominant component of patchouli essential oil, which exhibits antifungal activity against Aspergillus species [1].
|
-
- HY-P0179
-
-
- HY-N0411
-
|
Provitamin A; beta-Carotene
|
Endogenous Metabolite
Apoptosis
Reactive Oxygen Species
|
Metabolic Disease
Cancer
|
|
β-Carotene (Provitamin A), a carotenoid compound, is a naturally-occurring vitamin A precursor. β-Carotene is a modulator of reactive oxygen species (ROS), with antioxidant and antiinflammatory activities. β-Carotene may serve as an antioxidant or as a prooxidant, depending on its intrinsic properties as well as on the redox potential of the biological environment in which it acts. β-Carotene induces breast cancer cells apoptosis, with anticancer activities [1] .
|
-
- HY-131553R
-
|
|
Apoptosis
|
Cancer
|
|
D-α-Tocopherol Succinate (Standard) is the analytical standard of D-α-Tocopherol Succinate. This product is intended for research and analytical applications. D-α-Tocopherol Succinate (Vitamin E succinate) is an antioxidant tocopherol and a salt form of vitamin E. D-α-Tocopherol Succinate inhibits Cisplatin (HY-17394)-induced cytotoxicity. D-α-Tocopherol Succinate can be used for the research of cancer [1] .
|
-
- HY-149341
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-28 (Compound 18) is a α-Glucosidase inhibitor (IC50: 0.62 μM, Ki: 3.93 μM). α-Glucosidase-IN-28 binds to α-glucosidase at the original binding site (OBS), and forms multiple hydrophobic interactions with nearby amino acids. α-Glucosidase-IN-28 can be used for research of diabetes and related diseases [1].
|
-
- HY-P3659
-
-
- HY-162287
-
-
- HY-162286
-
-
- HY-N2922R
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyrin shows effectively counteract amyloid β (Aβ)-induced impairment of long-term potentiation (LTP). β-Amyrin is a promising candidate for Alzheimer's disease (AD) research. β-Amyrin exhibits anti-inflammatory effects, protective activity against pulmonary fibrosis, and notable antibacterial capabilities. β-Amyrin is an orally active natural triterpenoid compound [1] .
|
-
- HY-133970R
-
|
|
Biochemical Assay Reagents
|
Others
|
|
5α-Cholestane (Standard) is the analytical standard of 5α-Cholestane. This product is intended for research and analytical applications. 5α-Cholestane is a biochemical reagent that can be used as a biological material or organic compound for life science related research [1].
|
-
- HY-N2274
-
|
12-Oleanene-3β,16β,23,28-tetrol; 3β,16β-12-Oleanene-3, 16,23,28-tetrol
|
Others
|
Cancer
|
|
23-Hydroxylongispinogenin (12-Oleanene-3β,16β,23,28-tetrol) is extracted from Lysimachia heterogenea Klatt. Lysimachia heterogenea Klatt is a perennial herb, which is used as a folk medicine in subduing swelling and detoxicating in China. The effective fraction LH-1 of L. heterogene has antitumor activity [1].
|
-
- HY-124079
-
-
- HY-107641
-
|
α-Cyano-4-hydroxycinnamate
|
Monocarboxylate Transporter
|
Metabolic Disease
|
|
α-Cyano-4-hydroxycinnamic acid (α-Cyano-4-hydroxycinnamate) is a potent and non-competitive inhibitor of monocarboxylate transporters (MCTs). α-Cyano-4-hydroxycinnamic acid inhibits mitochondrial pyruvate transporter with a Ki of 6.3 μM. α-Cyano-4-hydroxycinnamic acid is used as a matrix to facilitate peptide ionization in matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry applications [1] .
|
-
- HY-164102
-
|
|
TNF Receptor
NF-κB
|
Inflammation/Immunology
|
|
TNF-α-IN-18 (Compound 61) is an inhibitor for TNF-α (IC50 of 1.8 μM), that inhibits TNF signaling pathway through block of NF-kB migration from cytoplasm to nucleus. TNF-α-IN-18 exhibits slight cytotoxicity to mouse fibroblast LM cell, with a CC50 >50 μM. TNF-α-IN-18 ameliorates the TNF- or Lipopolysaccharide (HY-D1056)-induced sepsis in mouse models. TNF-α-IN-18 protects mice from rheumatoid arthritis [1].
|
-
- HY-D1632
-
|
|
Fluorescent Dye
|
Others
|
|
4-MU-α-GlcNS sodium is a fluorogenic substrate of heparin sulphamidase, is desulfurized into 4-MU-α-GlcNH2. 4-MU-α-GlcNH2 can liberate 4-methylumbelliferone (4-MU, fluorescent product) via α-glucosaminidase catalysis, with the emission wavelength maxima of 445-454 nm. 4-MU-α-GlcNS sodium can be used to heparin sulphamidase deficiencies associated with Mucopolisaccaridosis IIIA and other lysosomal disorders researches [1] .
|
-
- HY-W039897R
-
|
α-Methyl-D-mannoside (Standard)
|
Bacterial
|
Inflammation/Immunology
|
|
Methyl α-D-mannopyranoside (Standard) is the analytical standard of Methyl α-D-mannopyranoside. This product is intended for research and analytical applications. Methyl α-D-mannopyranoside could target macrophages in anti-tuberculosis inhalation therapy[1].
|
-
- HY-114164A
-
|
EC 3.4.21.5; Human Alpha Thrombin
|
Thrombin
|
Cardiovascular Disease
|
|
Human α-thrombin is a multifunctional serine protease that plays a pivotal role in the coagulation pathway. Human α-thrombin cleaves fibrinogen and converts it into fibrin. Human α-thrombin can stimulate platelet activation and stabilize fibrin polymers [1].
|
-
- HY-137878
-
|
PNP-α-NeuNAc
|
Endogenous Metabolite
|
Others
|
|
2-O-(p-Nitrophenyl)-α-D-N-acetylneuraminic acid (PNP-α-NeuNAc) acts as a sialyl donor in the process of enzyme-catalyzed trans-sialylation.
|
-
- HY-118714
-
|
U 40125; Alpha-Hydroxyalprazolam
|
Drug Metabolite
|
Neurological Disease
|
|
α-Hydroxy alprazolam (U 40125) is a main metabolite of Alprazolam. α-Hydroxy alprazolam is pharmacologically active accounting for 60% of the activity of Alprazolam [1].
|
-
- HY-120087
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
KG-548 is an ARNT/TACC3 disruptor and a HIF-1α inhibitor. KG-548 directly interferes with ARNT/TACC3 complex formation by competing with TACC3 for binding to the ARNT PAS-B domain. ARNT is the aryl hydrocarbon receptor nuclear translocator, also known as HIF-β .
|
-
- HY-N11512
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-24 (Compound 13) is an α-Glucosidase inhibitor with an IC50 of 451 μM. α-Glucosidase-IN-24 can be isolated from Swertia kouitchensis [1].
|
-
- HY-155372
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-39 is a potent inhibitor of α-glucosidase enzyme with an IC50 of 869.06 ppm. α-Glucosidase-IN-39 can used in study antidiabetic [1].
|
-
- HY-115978
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-2 (compound 5d) is a potent α-Glucosidase inhibitor with an IC50 of 9.48 µM. α-Glucosidase-IN-2 is an antidiabetic agent [1].
|
-
- HY-27787
-
|
cis-Eleostearic acid
|
Apoptosis
Ferroptosis
|
Metabolic Disease
Cancer
|
|
α-Eleostearic acid (cis-Eleostearic acid), a conjugated linolenic acid, is an apoptosis inducer. α-Eleostearic acid is also a ferroptosis inducer. α-Eleostearic acid exhibits antioxidant and antitumor activity [1] .
|
-
- HY-161782
-
|
|
Amylases
|
Metabolic Disease
|
|
α-Amylase-IN-7 (Compound 6e) is an inhibitor for α-Amylase with an IC50 of 40 μM. α-Amylase-IN-7 exhibits potential as an antidiabetic agent [1].
|
-
- HY-E70039
-
|
|
Others
|
Others
|
|
alpha-2-3,6,8-Sialidosidase (SpNanA) catalyses hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates [1].
|
-
- HY-W048231
-
|
4-Methoxyphenyl Alpha-D-Mannopyranoside
|
Biochemical Assay Reagents
|
Others
|
|
4-Methoxyphenyl α-D-mannopyranoside (4-Methoxyphenyl alpha-D-Mannopyranoside) is used in glycobiology research.
|
-
- HY-P2988A
-
|
|
Influenza Virus
|
Metabolic Disease
|
|
α2-3,6 Neuraminidase, Bifidobacterium infantis is a highly specific exoglycosidase that catalyzes the hydrolysis of non-reducing terminal α2-3 and α2-6 unbranched sialic acid residues from complex carbohydrates and glycoproteins. α2-3,6 Neuraminidase does not exhibit activity on α2-8 or branched sialic acids [1].
|
-
- HY-130223
-
|
11β-Dinoprostone; 11β-PGE2
|
Prostaglandin Receptor
|
Endocrinology
|
|
11β-Prostaglandin E2 (11β-Dinoprostone), a Prostanoid derivative, inhibits [ 3H]PGE2 binding to hypothalamic membranes in the rat with a Ki of 53.3 nM [1].
|
-
- HY-N13365
-
|
|
Others
|
Others
|
|
1,10β-Epoxy-6β-isobutanoyloxy-9-oxofuranoeremophilane is a natural product [1].
|
-
- HY-141672
-
|
17β-Estradiol 3-sulfate sodium
|
GABA Receptor
|
Neurological Disease
|
|
17β-Estradiol sulfate (sodium), also known as β-Estradiol 3-sulfate sodium salt, is a neuroactive steroid [1] .
|
-
- HY-161999
-
|
|
Glycosidase
|
Metabolic Disease
Inflammation/Immunology
|
|
α-Glucosidase-IN-73 (compound 16b) is an α-Glucosidase inhibitor with IC50 of 0.158 μM. α-Glucosidase-IN-73 can activate PPAR γ. α-Glucosidase-IN-73 can be used in anti-diabetic and anti-inflammatory studies [1].
|
-
- HY-N7264S
-
|
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
|
7α-Hydroxycholesterol-d7 is the deuterium labeled 7α-Hydroxycholesterol. 7α-Hydroxycholesterol is a cholesterol oxide and is formed by both enzymatic and non-enzymatic oxidation. 7α-Hydroxycholesterol can be used as a biomarker for lipid peroxidation[1][2][3].
|
-
- HY-W089785
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Methyl α-D-galactopyranoside monohydrate is an alpha-D-galactoside having a methyl substituent at the anomeric position. Methyl α-D-galactopyranoside inhibits debaryomyces hansenii UFV-1 extracellular and intracellular α-galactosidases with Ki values of 0.82 and 1.12 mM, respectively [1].
|
-
- HY-163066
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-44 (compound IT4) is an inhibitor of α-glucosidase with IC50 value of 2.35 μM. α-Glucosidase-IN-44 has an oral activity. α-Glucosidase-IN-44 suppresses fasting blood glucose levels in diabetic mice [1].
|
-
- HY-149579
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-36 (compound 5g) is a potent α-glucosidase inhibitor, with an IC50 of 6.69 ± 0.18 μM, Ki and Kis of 1.65 μM and 4.54 μM, respectively. α-Glucosidase-IN-36 may inhibit α-glucosidase activity by binding with its active site as well as changing the secondary structure of α-glucosidase. α-Glucosidase-IN-36 can be used for type 2 diabetes mellitus (T2DM) research [1].
|
-
- HY-162832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid-β-IN-1 (compound 13) is a synthetic peptide containing the hydrophobic C-terminal region "VVIA-NH2" and its reverse sequence "AIVV-NH2" of Aβ42, which is an Aβ inhibitor. Amyloid-β-IN-1 can inhibit Aβ aggregation and has neuroprotective effects [1].
|
-
- HY-N2843
-
|
|
Others
|
Inflammation/Immunology
|
|
α-Amyrin palmitate is isolated from Santalum album (sandalwood). α-Amyrin palmitate can be used for the study of arthritis in vivo [1].
|
-
- HY-112275
-
-
- HY-N6652
-
|
Uracil 1-β-D-arabinofuranoside
|
Others
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
1-beta-D-Arabinofuranosyluracil (Uracil 1-β-D-arabinofuranoside) isolated from the Caribbean sponge Tectitethya crypta, is a methoxyadenosine derivative. 1-beta-D-Arabinofuranosyluracil has demonstrated a diverse bioactivity profile including anti-inflammatory activity, analgesic and vasodilation properties [1]. 1-beta-D-Arabinofuranosyluracil reduces a proliferation of mouse lymphoma cells .
|
-
- HY-P1521
-
|
beta-Amyloid (15-21)
|
Amyloid-β
|
Neurological Disease
|
|
β-amyloid (15-21) is a fragment of Amyloid-β peptide, maybe used in the research of neurological disease.
|
-
- HY-117266
-
|
beta-D-Galactopyranoside, 98%
|
Biochemical Assay Reagents
|
Others
|
|
β-D-Galactopyranoside, 98% (beta-D-Galactopyranoside, 98%) can be used in glycobiology research.
|
-
- HY-N8090
-
|
|
NO Synthase
|
Inflammation/Immunology
|
|
(3β,7β,12β,20Z)-3,7,12-Trihydroxy-11,15,23-trioxo-lanost-8,20-dien-26-oic acid, a lanostane triterpenoids, exhibits obvious NO inhibitory activity on n LPS-induced BV-2 microglia cells with an IC50 of 9.55 uM. (3β,7β,12β,20Z)-3,7,12-Trihydroxy-11,15,23-trioxo-lanost-8,20-dien-26-oic acid has anti-inflammatory activities [1].
|
-
- HY-116008
-
|
8-epi PGF3α; 8-iso PGF3α
|
Prostaglandin Receptor
|
Endocrinology
|
|
8-iso PGF3α is an isoprostane produced from the free-radical peroxidation of EPA. Little is known about the biological activity of 8-iso PGF3α. There is one report that it is inactive in a TP receptor mediated assay of human platelet shape change, where 8-iso PGF2α has an ED50 value of 1 μM.
|
-
- HY-114464
-
|
4-Androsten-11β-ol-3,17-dione
|
Endogenous Metabolite
11β-HSD
|
Endocrinology
|
|
11-Beta-hydroxyandrostenedione (4-Androsten-11β-ol-3,17-dione) is a steroid mainly found in the the adrenal origin (11β-hydroxylase is present in adrenal tissue, but absent in ovarian tissue). 11-Beta-hydroxyandrostenedione is a 11β-hydroxysteroid dehydrogenase (11βHSD) isozymes inhibitor. As 4-androstenedione increases, measuring plasma 11-Beta-hydroxyandrostenedione can distinguish the adrenal or ovarian origin of hyperandrogenism [1] .
|
-
- HY-130325
-
|
|
NO Synthase
|
Neurological Disease
|
|
α-Guanidinoglutaric acid is a guanidino compound first found in cobaltinduced epileptogenic focus tissue in the cerebral cortex of cats. α-Guanidinoglutaric acid induces epileptic seizures in rats after intraventricular administration [1].
|
-
- HY-113462
-
|
|
Others
|
Cancer
|
|
α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables [1] .
|
-
- HY-N11706
-
|
(+)-β-Cedrene
|
Fungal
|
Infection
Inflammation/Immunology
|
|
β-Cedrene ((+)-β-Cedrene) is a sesquiterpene compound that can be isolated from Centaurea kotschyi var. kotschyi and Centaurea kotschyi var. decumbens, exhibiting antibacterial, anti-inflammatory, antispasmodic, tonic, diuretic, sedative, insecticidal, and antifungal activities. β-Cedrene is also a potent competitive inhibitor of the CYP2B6-mediatedbupropion hydroxylase, with a Ki value of 1.6 μM [1] .
|
-
- HY-N0171R
-
|
β-Sitosterol (Standard); 22,23-Dihydrostigmasterol (Standard))
|
Apoptosis
Endogenous Metabolite
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
Beta-Sitosterol (Standard) is the analytical standard of Beta-Sitosterol. This product is intended for research and analytical applications. Beta-Sitosterol (Standard) includes β-sitosterol (≥80%), stigmasterol, campesterol and brassicasterol mainly. Beta-Sitosterol is a plant sterol. Beta-Sitosterol (Standard) interfere with multiple cell signaling pathways, including cell cycle, apoptosis, proliferation, survival, invasion, angiogenesis, metastasis and inflammation [1].
|
-
- HY-N5081
-
|
|
Others
|
Cancer
|
|
1αH,5αH-Guaia-6-ene-4β,10β-diol is a sesquiterpenoid derivative identified from Alisma orientale. 1αH,5αH-Guaia-6-ene-4β,10β-diol has anti-cancer activities [1].
|
-
- HY-113351
-
-
- HY-W783267
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-35 (compound 1) is a kind of chromene. α-Glucosidase-IN-35 can be isolated from the aqueous extract of the aerial parts of Brickellia cavanillesii. α-Glucosidase-IN-35 is a potent inhibitor of α-glucosidase with an IC50 value of 0.169 mg/mL [1].
|
-
- HY-128417S
-
-
- HY-161293
-
|
|
p38 MAPK
|
Cancer
|
|
p38-α MAPK-IN-6 (compound 3a) is a p38α mitogen-activated protein kinase inhibitor [1].
|
-
- HY-117215
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Beta-Ocimene is a naturally occurring organic compound that belongs to the terpene family. It exists as a mixture of three isomers: cis β-Ocimene, trans β-Ocimene and myrcene-like β-Ocimene. It has a pleasant, sweet herbaceous scent and is found in many plants, including mint, basil, parsley, and kumquat. β-Ocimene is widely used in the flavor and fragrance industry due to its characteristic aroma and taste. It also has potential applications in agriculture as natural insect repellants and pheromones that attract beneficial insects. β-Ocimene has potential anti-inflammatory and anticancer activities.
|
-
- HY-147823
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-6 (compound 18) is a competitive α-glucosidase inhibitor with an IC50 of 5.69 µM. α-Glucosidase-IN-6 has anti-diabetic potential [1].
|
-
- HY-170866
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-81 (Compound 5) is a potent α-Glucosidase inhibitor with an IC50 value of 5.30 μM. α-Glucosidase-IN-81 is promising for research of diabetes [1].
|
-
- HY-157488
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-46 is a potent α-glucosidase inhibitor with an IC50 of 26.0 μM. α-Glucosidase-IN-46 can be used for the research of type 2 diabetes [1].
|
-
- HY-161318
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-52 (Compound 3h) is an α-glucosidase inhibitor with an IC50 of 2.8 μM. α-Glucosidase-IN-52 can be used for diabetes research [1].
|
-
- HY-137824
-
|
4-Methylumbelliferyl-β-D-xyloside
|
Biochemical Assay Reagents
|
Others
|
|
4-Methylumbelliferyl-β-D-xylopyranoside (MuX) can be used as substrate for the research of β-Xylosidase activity. 4-Methylumbelliferyl-β-D-xylopyranoside shows burst, steady-state kinetics, which supports the conclusion that hydrolysis of the glycosidic bonds for the substrate 4-Methylumbelliferyl-β-D-xylopyranoside is rapid [1] .
|
-
- HY-115976
-
|
|
COX
|
Inflammation/Immunology
|
|
COX-2-IN-10 is a potent COX-2 inhibitor. COX-2-IN-10 inhibits the production of PGE2 in concentration dependent manner (IC50=2.54 µM). COX-2-IN-10 inhibits the expression of iNOS and COX-2 on mRNA and protein level . COX-2-IN-10 inhibits the production of IL-6, TNF-α and IL-1β .
|
-
- HY-132649S
-
-
- HY-134670S1
-
-
- HY-Y0245S
-
-
- HY-126025
-
-
- HY-142708
-
-
- HY-133890AS
-
-
- HY-147007
-
|
|
β-catenin
Wnt
CDK
|
Cancer
|
|
β-catenin-IN-3 (Compound C2) is a selective β-catenin inhibitor. β-catenin-IN-3 binds to allosteric site on the surface of β-catenin with K D calculated at 54.96 nM. β-catenin-IN-3 selectively inhibits β-catenin via targeting a cryptic allosteric modulation site, lowers its cellular load. β-catenin-IN-3 significantly reduces viability of β-catenin driven cancer cells, and triggers β-catenin degradation via proteasome system in β-catenin-overexpressing cancer cells [1].
|
-
- HY-149845
-
|
|
GSK-3
PROTACs
|
Neurological Disease
|
|
PROTAC GSK-3β Degrader-1 (compound 1) is a degrader targets GSK-3β degradation with an IC50 value of 833 nM. PROTAC GSK-3β Degrader-1 contains SB-216763 (a GSK-3β inhibitor), a PEG linker and a CRBN (E3 ligase liand). PROTAC GSK-3β Degrader-1 reduces the neurotoxicity induced by Aβ25-35 peptide and CuSO4. PROTAC GSK-3β Degrader-1 can be used to research in Alzheimer's disease [1].
|
-
- HY-108013
-
-
- HY-W154295
-
|
|
Fluorescent Dye
|
Others
|
|
Purple-β-D-Gal is a chromogenic β-galactosidase substrate. Intracellular enzymatic hydrolysis of Purple-β-D-Gal generates free indoxyl molecules, which undergo in situ oxidation and subsequent dimerization to produce chromogenic, water-insoluble, indigo precipitates. Purple-β-D-Gal can be used for the detection of β-galactosidase activity [1].
|
-
- HY-N7364R
-
|
|
Fungal
|
Infection
Cancer
|
|
(E)-β-Farnesene (Standard) is the analytical standard of (E)-β-Farnesene. This product is intended for research and analytical applications. (E)-β-Farnesene (trans-β-Farnesene) is a volatile sesquiterpene hydrocarbon which can be found in Phlomis aurea Decne essential oil. (E)-β-Farnesene can be used as a feeding stimulant for the sand fly Lutzomyia longipalpis [1] .
|
-
- HY-P1481A
-
-
- HY-106684A
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Ridazolol hydrochloride is a β-adrenergic receptor (βAR) antagonist. Ridazolol hydrochloride exhibits a high degree of selectivity for β-1 adrenergic receptor (β1AR) and possesses moderate intrinsic sympathomimetic activity (ISA). Ridazolol hydrochloride can competitively antagonize the relaxation effects induced by isoproterenol. Ridazolol hydrochloride is utilized in the research of cardiovascular diseases [1].
|
-
- HY-106684
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Ridazolol is a β-adrenergic receptor (βAR) antagonist. Ridazolol exhibits a high degree of selectivity for β-1 adrenergic receptor (β1AR) and possesses moderate intrinsic sympathomimetic activity (ISA). Ridazolol can competitively antagonize the relaxation effects induced by isoproterenol. Ridazolol is utilized in the research of cardiovascular diseases [1].
|
-
- HY-N6602R
-
|
|
Apoptosis
Akt
mTOR
MMP
NO Synthase
COX
NF-κB
Autophagy
|
Inflammation/Immunology
Cancer
|
|
α-Solanine (Standard) is the analytical standard of α-Solanine. This product is intended for research and analytical applications. α-solanine, a bioactive component and one of the major steroidal glycoalkaloids in Solanum nigrum, has been observed to inhibit growth and induce apoptosis in cancer cells [1].
|
-
- HY-149676
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-42 (Compound 26) is a 9-O-berberrubine carboxylate derivative. α-Glucosidase-IN-42 has potent α-glucosidase inhibitory activities with an IC50 value in the range of 1.61 μM. α-Glucosidase-IN-42 can be used for the research of antidiabetic [1].
|
-
- HY-149886
-
|
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
|
HIF-2α-IN-9 (compound 35r) is an inhibitor ofHIF-2α. HIF-2α-IN-9 inhibits VEGF-A (IC50=305 nM), and regulates growth-promoting genes in tumor cells, reactivates macrophage-mediated tumor immunity [1].
|
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts [1].
|
-
- HY-128174
-
|
beta-CCM; Ro 22-7497
|
GABA Receptor
|
Neurological Disease
|
|
β-CCM is a benzodiazepine receptor inverse agonist with anxiogenic and proconvulsant effects. β-CCM enhances emotional reactivity and reduces vulnerability to interference in spatial working memory tasks. β-CCM can be used for research on anxiety-related disorders [1] .
|
-
- HY-172100
-
|
|
Apoptosis
Reactive Oxygen Species
p38 MAPK
|
Cancer
|
|
p38-α MAPK-IN-8 (Compound 13) is a lipophilic cationic derivative. p38-α MAPK-IN-8 is cytotoxic to various tumor cells, and can induce cell cycle arrest, apoptosis, increase reactive oxygen species (ROS) production, and induce mitochondrial membrane potential depolarization. The antitumor activity of p38-α MAPK-IN-8 may be related to p38α MAPK pathway, which can be used in the study of cancer [1].
|
-
- HY-108229S
-
|
6β-Hydroxynaltrexone-d3
|
Isotope-Labeled Compounds
Opioid Receptor
Drug Metabolite
|
Neurological Disease
|
|
6β-Naltrexol-d3 (6β-Hydroxynaltrexone-d3) is deuterium labeled 6β-Naltrexol. 6β-Naltrexol (6β-Hydroxynaltrexone), the primary metabolite of Naltrexone, is a peripherally selective opioid antagonist. 6β-Naltrexol selectively inhibits gastrointestinal opioid effects in human subjects and inhibits Morphine-induced slowing of gastrointestinal transit [1] .
|
-
- HY-134460
-
|
|
Endogenous Metabolite
|
Others
|
|
4-Methylumbelliferyl α-L-fucopyranoside is an α-L-fucosidase. α-L-fucosidase can enhance capacitation of porcine sperm and protect sperm from premature acrosome reaction. Compared with human liver α-L-fucosidase, 4-Methylumbelliferyl α-L-fucopyranoside has considerable hydrophobicity and isoelectric focusing properties [1] .
|
-
- HY-156435
-
|
|
α-synuclein
|
Neurological Disease
|
|
tau protein/α-synuclein-IN-1 is a dual inhibitor of tau protein and α-synuclein. tau protein/α-synuclein-IN-1 reduces α-syn inclusions development in M17D neuroblastoma cells. tau protein/α-synuclein-IN-1 can be used in study Alzheimer’s disease [1].
|
-
- HY-P5681
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation [1] .
|
-
- HY-160959
-
|
|
nAChR
|
Neurological Disease
|
|
AN317 is a selective agonist for α6β2-containing nicotinic acetylcholine receptor (nAChR) with Ki of 6.2 nM and 4.1 nM, for α6/α3β2β3 receptor and α4β2 receptor, respectively. AN317 induces dopamine release in the synaptosomes of the rat striatum, enhances dopaminergic neuronal activity in substantia nigra, and exhibits protective efficacy to rat neurons against dopamine neurotoxin MPP +. AN317 exhibits good pharmacokinetic characteristics in rats. AN317 penetrates the blood-brain barrier (BB) [1].
|
-
- HY-W1000105
-
|
(E)-3,7-Dimethylocta-2,6-dienal
|
TNF Receptor
Interleukin Related
NOD-like Receptor (NLR)
|
Inflammation/Immunology
|
|
Geranial ((E)-3,7-Dimethylocta-2,6-dienal) is a derivative of geraniol with anti-inflammatory activity. Geranial can inhibit the secretion of TNF-α and IL-6 in macrophages. Furthermore, Geranial also inhibits the secretion of IL-1β mediated by the NLRP-3 inflammasome [1] .
|
-
- HY-18754
-
|
|
p38 MAPK
Autophagy
|
Endocrinology
|
|
FR 167653 free base, an orally active and selective p38 MAPK inhibitor, is a potent suppressor of TNF-α and IL-1β production via specific inhibition of p38 MAPK activity. FR 167653 free base is effective in treating inflammation, relieving trauma and ischemia-reperfusion injury in vivo [1] .
|
-
- HY-N12042
-
-
- HY-15507
-
|
GIT 27
|
Interleukin Related
TNF Receptor
|
Metabolic Disease
Inflammation/Immunology
|
|
VGX-1027 is an orally active isoxazole compound that exhibits various immunomodulatory properties. VGX-1027 targets macrophages, reducing the production of the proinflammatory mediators TNF-α, IL-1β, IL-10. VGX-1027 has antidiabetogenic effects by limiting cytokine-mediated immunoinflammatory events [1] .
|
-
- HY-P5044
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (45-54) (human) is the 45-54 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) [1].
|
-
- HY-P5041
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (34-45) (human) is the 34-45 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a Parkinson's disease (PD) biomarker [1].
|
-
- HY-P5046
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (71-82) (human) is the 71-82 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) [1].
|
-
- HY-107826
-
-
- HY-W416255
-
-
- HY-147718
-
|
|
Glutaminase
|
Metabolic Disease
|
|
α-Glucosidase-IN-5 (compound 8) is a potent α-glucosidase inhibitor with an IC50 of 57.9 µM. α-Glucosidase-IN-5 has the potential for the research of diabetes mellitus [1].
|
-
- HY-151142
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-18 (7B) is an orally active α-glucosidase inhibitor with an IC50 value of 3.96 μM. α-Glucosidase-IN-18 has antidiabetic activity [1].
|
-
- HY-146984
-
|
|
Glycosidase
|
Inflammation/Immunology
|
|
α-Glucosidase-IN-3 is an oleanolic acid (OA) oxime ester derivative against α-glucosidase (IC50=1.28 µM) and α-amylase (IC50=3.8 µM) .
|
-
- HY-P1474
-
|
Amyloid β-Protein (22-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution) [1].
|
-
- HY-N1968
-
|
Quercetin-3-O-beta-D-glucose-7-O-beta-D-gentiobioside
|
Others
|
Others
|
|
Quercetin-3-O-β-D-glucose-7-O-β-D-gentiobiosiden is a flavonoid from Quercetin.
|
-
- HY-W399193
-
|
Prostaglandin F2α 1,9-lactone
|
Prostaglandin Receptor
|
Metabolic Disease
|
|
PGF2α 1,9-lactone (Prostaglandin F2α 1,9-lactone) is a prostaglandin lactone. PGF2α 1,9-lactone shows resistant to hydrolysis by plasma esterases [1].
|
-
- HY-116051A
-
|
16,16-Dimethyl-PGF2β
|
Prostaglandin Receptor
|
Cardiovascular Disease
|
|
16,16-Dimethylprostaglandin F2β (16,16-Dimethyl-PGF2β) is an analog of PGF2β (HY-12956B), which is an irratant, but prevents the aspecifically induced bronchospasm [1].
|
-
- HY-W205320
-
-
- HY-P1468
-
|
Amyloid β-Protein (1-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P1466
-
|
Amyloid β-Protein (1-16)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-16) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-169632
-
|
|
GSK-3
|
Neurological Disease
|
|
GSK3β-IN-1 (compound 1) is a glycogen synthase kinase-3β (GSK-3β) inhibitor (IC50=65 nM), which can be used in the study of Alzheimer's disease [1].
|
-
- HY-12308
-
|
|
Integrin
|
Inflammation/Immunology
|
|
TCS 2314 (compound 3) is orally active and selective very late antigen-4 (VLA-4, α4β1, CD49d/CD29) antagonist with an IC50 of 4.4 nM [1].
|
-
- HY-128976
-
|
DHED
|
Estrogen Receptor/ERR
|
Metabolic Disease
|
|
10β,17β-dihydroxyestra-1,4-dien-3-one (DHED) is a brain-targeting bioprecursor proagent of the main human estrogen, 17β-estradiol, alleviates hot flushes in rat models of thermoregulatory dysfunction of the brain [1].
|
-
- HY-P1253
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
α-Endorphin (human) is a neuropeptide, that acts on the central nervous system (CNS) and peripheral nervous system (PNS). α-Endorphin (human) binds μ-opioid receptor, and exhibits analgesic efficacy. α-Endorphin (human) regulates sexual behaviors and pleasure felling [1].
|
-
- HY-W086896R
-
|
|
Drug Metabolite
|
Inflammation/Immunology
|
|
α-Demethylnaproxen (Standard) is the analytical standard of α-Demethylnaproxen. This product is intended for research and analytical applications. α-Demethylnaproxen is the major metabolite of Nabumetone (HY-B0559), Nabumetone is an orally active COX-2 inhibitor with anti-inflammatory activity [1] .
|
-
- HY-N7932
-
|
|
Others
|
Others
|
|
Kaempferol 3-O-α-L-rhamnopyranosyl(2,1)-α-L-rhamnopyranoside (compound 23) is a flavonoid isolated from the whole herb of E. wushanense [1].
|
-
- HY-W049706R
-
|
|
Biochemical Assay Reagents
|
Others
|
|
α-D-Glucose pentaacetate (Standard) is the analytical standard of α-D-Glucose pentaacetate. This product is intended for research and analytical applications. α-D-Glucose pentaacetate (Penta-O-acetyl-α-D-glucopyranose) is a synthetic sugar compound.
|
-
- HY-113478R
-
|
|
Drug Metabolite
|
Metabolic Disease
|
|
3β-Ursodeoxycholic acid (Standard) is the analytical standard of 3β-Ursodeoxycholic acid. This product is intended for research and analytical applications. 3β-Ursodeoxycholic acid (Isoursodeoxycholic acid) is a bile acid. 3β-Ursodeoxycholic acid shows good tolerance and well intestinal absorption by oral adminstation. 3β-Ursodeoxycholic acid can be isomerized by intestinal and hepatic enzymes to yield UDCA [1].
|
-
- HY-101961
-
|
AG 1288
|
c-Kit
|
Inflammation/Immunology
|
|
Tyrphostin AG 1288 is a potent Tyrosine Kinase inhibitor. Tyrphostin AG 1288 inhibits ICAM1 expression and TNFα-mediated cytotoxicity in vitro [1].
|
-
- HY-P5098
-
|
|
Integrin
|
Cancer
|
|
E(c(RGDfK)) is an αvβ3 integrin-specific binding moiety with tumor targeting properties. Increased uptake of E(c(RGDfK)) in human ovarian cancer OVCAR-3 xenograft tumors may be useful in cancer research [1].
|
-
- HY-118770
-
|
K 5407 free base
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Nafetolol (K 5407), specifically effective on cardiac (β1)-adrenoceptors, is an orally active β blocking agent, with a t1/2 of ~ 2 h in dogs [1].
|
-
- HY-N2849
-
|
(+)-Onocerin; α-Onocerin
|
Others
|
Others
|
|
alpha-Onocerol ((+)-Onocerin) is a Alkaloids product that can be isolated from the roots of Stephania japonica. [1].
|
-
- HY-147964
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-9 (compound 7) is a potent α-glucosidase inhibitor, with an IC50 of 55.6 μM. α-Glucosidase-IN-9 can be used for type II diabetes research [1].
|
-
- HY-147965
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-10 (compound 13) is a potent α-glucosidase inhibitor, with an IC50 of 92.7 μM. α-Glucosidase-IN-10 can be used for type II diabetes research [1].
|
-
- HY-151135
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-15 (Compound 14B) is a potent, orally active α-glucosidase inhibitor with an IC50 of 3.34 μM. α-Glucosidase-IN-15 shows antidiabetic activity [1].
|
-
- HY-151141
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-17 (Compound 12B) is a potent, orally active α-glucosidase inhibitor with an IC50 of 3.79 μM. α-Glucosidase-IN-17 shows antidiabetic activity [1].
|
-
- HY-P2871A
-
|
|
Endogenous Metabolite
|
Metabolic Disease
|
|
α1-3,6 Galactosidase, Xanthomonas manihotis is a highly specific exoglycosidase that catalyzes the hydrolysis of α1-3 and α1-6 linked galactose residues from oligosaccharides [1].
|
-
- HY-128417S1
-
-
- HY-128417S3
-
-
- HY-W020035
-
|
|
GPR55
|
Neurological Disease
|
|
L-α-lysophosphatidylinositol Soy sodium is an endogenous ligand of GPR55. L-α-lysophosphatidylinositol Soy sodium is an endogenous lysophospholipid and endocannabinoid neurotransmitter that belongs to the class of lysophospholipids [1].
|
-
- HY-E70103
-
|
|
Glycosidase
|
Others
|
|
α-L-Arabinofuranosidase is a glycosidic hydrolase. α-L-Arabinofuranosidase hydrolyse the nonreducing termini of the a-l-arabinofuranosyl residues as side chains of arabinoxylan, arabinan and arabinogalactan [1].
|
-
- HY-131617
-
|
PGF2α 1,11-lactone
|
Prostaglandin Receptor
|
Others
|
|
Prostaglandin F2α 1,11-lactone is a prostaglandin.
Prostaglandin F2α 1,11-lactone is absorbed by the eye. Prostaglandin F2α 1,
11-Lactone has metabolic stability on the corneal surface and conjunctiva.
Prostaglandin F2α 1,11-lactone can be used in the treatment of glaucoma
[1].
|
-
- HY-163519
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein inhibitor 13 is an inhibitor of α-synuclein (α-Syn). α-Synuclein inhibitor 13 inhibits the aggregation of α-Syn proteins and is able to break down formed fibers. It is mainly used in Parkinson's disease research [1].
|
-
- HY-P2965
-
|
|
Endogenous Metabolite
|
Cancer
|
|
L-Lysine α-oxidase is a potent anticancer agent. L-Lysine α-oxidase also a L-amino acid oxidase, deaminates L-lysine with the yield of H2O2, ammonia, and α-keto-ε-aminocaproate. L-Lysine α-oxidase shows cytotoxicity and anticancer activity [1] .
|
-
- HY-P5082
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein 4554W is an inhibitor of α-Synuclein (aSyn) aggregation with associated toxicity. α-Synuclein 4554W consists of GIVNGVKA sequences, previously identified through intracellular library screening. α-Synuclein 4554W reduces fibril formation of aSyn mutants assocaited with Parkinson’s disease [1].
|
-
- HY-16686
-
|
Alpha-Tocopherol phosphate; TocP; vitamin E phosphate
|
Apoptosis
Reactive Oxygen Species
|
Cancer
|
|
α-Tocopherol phosphate is an antioxidant that protects against long-wave UVA1 induced cell death and scavenge UVA1 induced ROS in a skin cell model. α-Tocopherol phosphate exhibits angiogenesis-promoting activity [1] .
|
-
- HY-W706304
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gal1-β-4GlcNAc1-β-6Gal is a class of biochemical reagents used in glycobiology research. Glycobiology studies the structure, synthesis, biology, and evolution of sugars. It involves carbohydrate chemistry, enzymology of glycan formation and degradation, protein-glycan recognition, and the role of glycans in biological systems. This field is closely related to basic research, biomedicine, and biotechnology [1].
|
-
- HY-N3706
-
|
|
Fungal
|
Infection
|
|
Dehydro-α-lapachone can be isolated from the methanol extract of stems of Catalpa ovata G Don. Dehydro-α-lapachone inhibits mycelial growth of Botrytis cinerea with IC50 value 0.41 mg/L [1].
|
-
- HY-P990107
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8) is an anti-mouse/human/rat/monkey/hamster/canine/bovine IgG antibody inhibitor of TGF-β . The recommend isotype control of Anti-Mouse/Human/Rat/Monkey/Hamster/Canine/Bovine TGF-β Antibody (1D11.16.8): Mouse IgG1 kappa, Isotype Control (HY-P99977).
|
-
- HY-173130
-
|
|
Glycosidase
|
Metabolic Disease
Inflammation/Immunology
|
|
α-Glucosidase-IN-86 (Compound A4) is an orally active α-glucosidase inhibitor with an IC50 of 2.72 μM. α-Glucosidase-IN-86 has high safety in mice. α-Glucosidase-IN-86 can reduce fasting blood glucose levels, improve glucose tolerance, regulate blood lipids, and has antioxidant effects in diabetic mice. α-Glucosidase-IN-86 can be used for the research of diabetes [1].
|
-
- HY-149984
-
|
|
Monoamine Oxidase
|
Neurological Disease
Inflammation/Immunology
|
|
MAO-B-IN-21 is an excellent MAO-B inhibitor with antioxidant activity and anti-Aβ aggregation activity. MAO-B-IN-21 also exhibits metal-ion chelating ability, anti-neuroinflammation (NO, TNF-α), neuroprotective activity and BBB permeability. MAO-B-IN-21 significantly improves the memory and cognitive impairment in Aβ1-42 induced Alzheimer's disease mice model [1].
|
-
- HY-125849
-
|
Chrysin 7-O-β-gentiobioside
|
Drug Derivative
|
Cancer
|
|
Chrysin 7-O-beta-gentiobioside (Chrysin 7-O-β-gentiobioside) is the glycosylation product of Chrysin [1].
|
-
- HY-113341
-
-
- HY-N11600
-
|
|
Apoptosis
|
Cancer
|
|
β-Apopicropodophyllin is a nature product that could be isolated from Hyptis wticillata.β-Apopicropodophyllin induces apoptosis by inducing microtubule disruption, DNA damage, cell cycle arrest and ER stress. β-Apopicropodophyllin can be used in research of cancer [1].
|
-
- HY-118614R
-
|
|
Drug Metabolite
|
Neurological Disease
|
|
β-Nicotyrine (Standard) is the analytical standard of β-Nicotyrine. This product is intended for research and analytical applications. β-Nicotyrine is a metabolite of Nicotine.β-Nicotyrine, isolated from the leaves of Nicotiana tabacum plants and from cigarette smoke condensate, is a minor tobacco alkaloid [1].
|
-
- HY-P3645
-
|
|
Melanocortin Receptor
|
Others
|
|
(Nle4)-α-MSH is a synthetic analogue of α-MSH (HY-P0252), a melanocyte-stimulating hormone. (Nle4)-α-MSH reversibly darkens frog skins and also exhibits prolonged activity after heat-alkali treatment [1].
|
-
- HY-W020182
-
|
Terpilene
|
Fungal
Parasite
|
Infection
|
|
α-Terpinene (Terpilene) is a monoterpene found in the essential oils of a large variety of foods and aromatic plants such as Mentha piperita. α-Terpinene is active against Trypanosoma evansi and has the potential for trypanosomosis treatment. α-Terpinene has antioxidant and antifungal properties [1] .
|
-
- HY-146483
-
|
|
Amyloid-β
|
Neurological Disease
Inflammation/Immunology
|
|
Anti-Aβ agent 1A (compound M15) has potent activity against amyloid-β. Anti-Aβ agent 1A possesses can significantly inhibit LPS-induced levels of IL-1β, IL-6 and TNF-α, and reduces the apoptosis of SH-SY5Y induced by H2O2 through mitochondria pathway. Anti-Aβ agent 1A possesses antioxidant, anti-inflammatory, anti-Aβ toxicity and neuroprotective activities. Anti-Aβ agent 1A can be used for researching Alzheimer’s disease (AD) [1].
|
-
- HY-P3140A
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-75) TFA is the 61-75 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly enriched in presynaptic nerve terminals. α-Synuclein is a potential biomarker for Parkinson's disease (PD) [1] .
|
-
- HY-W015084AS
-
-
- HY-P1468F
-
|
Biotin-amyloid β-protein (1-28)
|
Amyloid-β
|
Others
|
|
Biotin-β-amyloid (1-28) (Biotin-amyloid β-protein (1-28)) is abiotinylated β-Amyloid (1-28) (HY-P1468).
|
-
- HY-N14912
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
|
|
β-Prumycin hydrochloride is a carbohydrate antibiotic. β-Prumycin hydrochloride has anti-fungal activity and weak anti-individual bacterial activity.
|
-
- HY-137504
-
-
- HY-134036
-
-
- HY-N2848
-
-
- HY-N7276
-
|
|
Others
|
Others
|
|
7α-Galloyloxysweroside is a natural product [1].
|
-
- HY-19767
-
|
|
Integrin
|
Cardiovascular Disease
|
|
GSK 3008348 is a small molecule integrin αvβ6 antagonist, extracted from patent WO/2014154725A1, example 1. The affinity (pIC50) for the human - a 6 protein in the Fluorescence Polarisation Assay for Integrin Antagonist 1 was 8.1, whereas its affinity in the cell Adhesion Assays was for: ανβ6 (pIC50 = 8.4); ανβ3 (pIC50 = 6); ανβ5 (pIC50 = 6.9); ανβ8 (pIC50 = 7.7).
|
-
- HY-N0941R
-
|
|
Bacterial
Parasite
Apoptosis
|
Infection
Cancer
|
|
beta-Mangostin (Standard) is the analytical standard of beta-Mangostin. This product is intended for research and analytical applications. beta-Mangostin (β-Mangostin) is a xanthone compound present in Cratoxylum arborescens, with antibacterial and antimalarial activities. beta-Mangostin exhibits antimycobacterial activity against Mycobacterium tuberculosis with an MIC of 6.25 μg/mL. beta-Mangostin possesses in vitro antimalarial activity against Plasmodium falciparum, with an IC50 of 3.00 μg/mL. beta-Mangostin has potent anticancer activity against various cancers (such as hepatocellular carcinoma, leukaemic) [1] .
|
-
- HY-P1875A
-
-
- HY-P1825A
-
-
- HY-N2454R
-
-
- HY-151143
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-19 (Compound 6B) is a potent, orally active α-glucosidase inhibitor with an IC50 of 3.63 μM. α-Glucosidase-IN-19 shows anti-diabetic activity [1].
|
-
- HY-N12664
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-54 (compound 2) is a α-glucosidase inhibitor with the IC50 of 0.011 mM, and can be isolated form Syzygium jambos (L.). α-Glucosidase-IN-54 can be used for study of diabetes [1].
|
-
- HY-161944
-
|
|
Amylases
|
Metabolic Disease
|
|
α-Amylase-IN-8 (compound 44) is an α-amylase inhibitor (IC50=58.1 μM). α-Amylase-IN-8 can be used in the research of type 2 diabetes [1].
|
-
- HY-157311
-
|
|
Glycosidase
|
Cancer
|
|
α-Glucosidase-IN-45 (compound 11E) is an inhibitor of α-glucosidase. α-Glucosidase-IN-45 is a novel indol-fused pyrano[2,3-D]pyrimidine compound [1].
|
-
- HY-169251
-
-
- HY-170548
-
|
|
Amylases
|
Metabolic Disease
|
|
α-Amylase-IN-10 (Compound 15n) is an inhibitor for α-Amylase with an IC50 of 5.00 µM. α-Amylase-IN-10 can be used for research of type 2 diabetes mellitus [1].
|
-
- HY-158697
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-65 (compound 5) is a Schiff base derivative of 3,4-dihydroxyphenylacetic acid. α-Glucosidase-IN-65 is a potent α-glucosidase inhibitor, with an IC50 of 12.84 μM [1].
|
-
- HY-173035
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-85 (Compound 8D1) is the inhibitor for α-Glucosidase with an IC50 of 5.43 μM. α-Glucosidase-IN-85 can be used in research of type 2 diabetes [1].
|
-
- HY-151145
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-21 (Compound 2B) is a potent, orally active α-glucosidase inhibitor with an IC50 of 2.62 μM. α-Glucosidase-IN-21 shows anti-diabetic activity [1].
|
-
- HY-151144
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-20 (Compound 3B) is a potent, orally active α-glucosidase inhibitor with an IC50 of 3.01 μM. α-Glucosidase-IN-20 shows anti-diabetic activity [1].
|
-
- HY-N5053
-
|
|
Others
|
Others
|
|
Periplogenin 3-[O-β-glucopyranosyl-(1→4)-β-sarmentopyranoside] is a cardenolide isolated from the root barks of Periploca sepium [1].
|
-
![Periplogenin 3-[O-β-glucopyranosyl-(1→4)-β-sarmentopyranoside]](//file.medchemexpress.com/product_pic/hy-n5053.gif)
- HY-111326AR
-
|
|
Adrenergic Receptor
TNF Receptor
Interleukin Related
VEGFR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Naphazoline (nitrate) (Standard) is the analytical standard of Naphazoline (nitrate). This product is intended for research and analytical applications. Naphazoline (Naphthazoline) nitrate is an α-adrenergic receptor agonist. Naphazoline nitrate reduces vascular hyperpermeability and promotes vasoconstriction. Naphazoline nitrate reduces the levels of inflammatory factors (TNF-α, IL-1β and IL-6), cytokines (IFN-γ and IL-4), IgE, GMCSF, and NGF. Naphazoline nitrate can be used for non-bacterial conjunctivitis research [1] .
|
-
- HY-173416
-
|
|
NF-κB
p38 MAPK
ERK
JNK
|
Inflammation/Immunology
|
|
Anti-inflammatory agent 100 (Compound (+)-4S-23) is an anti-inflammatory agent. Anti-inflammatory agent 100 inhibits MAPK and NF-κB signaling, and also inhibits NF-κB pathway by suppressing the phosphorylation of IκB-α and blocking nuclear translocation of phosphorylated p65. Anti-inflammatory agent 100 inhibits NO production (IC50: 0.5 μM) and TNF-α, IL-6, IL-1β secretion [1].
|
-
- HY-N3037
-
-
- HY-157537
-
-
- HY-133970S
-
-
- HY-133970S1
-
-
- HY-146752
-
|
|
Amylases
|
Others
|
|
α-Amylase-IN-1 is a potent α-amylase inhibitor with an IC50 of 4.46 μM [1].
|
-
- HY-118566S
-
-
- HY-N6741R
-
|
|
Others
|
Infection
Endocrinology
|
|
β-Zearalenol (Standard) is the analytical standard of β-Zearalenol. This product is intended for research and analytical applications. β-Zearalenol is a non-steroidal estrogenic mycotoxin synthesized by Fusarium species. β-Zearalenol potentially influences transcription and effects gene expression on translational level [1].
|
-
- HY-148908
-
|
|
TNF Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Cancer
|
|
TNF-α-IN-8 (compound I-42) is a TNF-α inhibitor. TNF-α-IN-8 is an isoindole-imide compound. TNF-α-IN-8 can be used for the research of cancer, heart disease, osteoporosis, inflammatory, allergic and autoimmune diseases [1]. TNF-α-IN-8 is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.
|
-
- HY-N3995
-
|
|
Apoptosis
Drug Metabolite
|
Cancer
|
|
5β-Dihydrocortisol, a metabolite of Cortisol, is a potential mineralocorticoid. 5β-Dihydrocortisol can potentiate glucocorticoid activity in raising the intraocular pressure. 5β-Dihydrocortisol causes breast cancer cell apoptosis [1] .
|
-
- HY-W020044S
-
|
|
Ferroptosis
|
Others
|
|
DL-alpha-Tocopherol- 13C3 is the 13C-labeled DL-alpha-Tocopherol. DL-alpha-Tocopherol is a synthetic vitamin E, with antioxidation effect. DL-alpha-Tocopherol protects human skin fibroblasts against the cytotoxic effect of UVB[1].
|
-
- HY-117580R
-
|
|
Drug Metabolite
|
Inflammation/Immunology
|
|
16α-Hydroxyprednisolone (Standard) is the analytical standard of 16α-Hydroxyprednisolone. This product is intended for research and analytical applications. 16α-Hydroxyprednisolone is a stereoselective metabolite of the 22(R) epimer of the glucocorticoid budesonide via cytochrome P450 3A (CYP3A) enzymes [1] .
|
-
- HY-163376
-
|
17-CF3PTPG2α EA
|
Prostaglandin Receptor
|
Metabolic Disease
|
|
17-Trifluoromethylphenyl trinor prostaglandin F2α ethyl amide (compound 17-CF3PTPG2α EA) is a lipophilic analog of 17-trifluoromethylphenyl trinor PGF2α [1].
|
-
- HY-121735
-
|
|
Biochemical Assay Reagents
|
Others
|
|
2α-Mannobiose is a disaccharide composed of two mannose molecules linked by a 1-2 glycosidic bond. 2α-Mannobiose can be used for affinity purification of mannose-binding proteins by column chromatography [1].
|
-
- HY-113091
-
|
|
Apoptosis
|
Neurological Disease
|
|
Alpha-Tocotrienol is a vitamin E analog with anti-apoptotic neuroprotective action and antioxidant properties. Alpha-Tocotrienol prevents oxidative stress-independent apoptotic cell death, DNA cleavage, and nuclear morphological changes [1].
|
-
- HY-P2950A
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α1-6 Mannosidase, Xanthomonas phaseoli is a highly specific exoglycosidase that removes unbranched α1-6 linked mannose residues from oligosaccharides [1].
|
-
- HY-137870
-
|
gamma-Glutamyl-beta-naphthylamide
|
Biochemical Assay Reagents
|
Others
|
|
γ-Glutamyl-β-naphthylamide is a substrate for γ-glutamine peptidase. γ-Glutamyl-β-naphthylamide is specifically recognized and the peptide chain is cleaved. γ-Glutamyl-β-naphthylamide can be used to distinguish between gonococci and meningococci [1].
|
-
- HY-125457
-
|
p-Naphtolbenzein
|
Fluorescent Dye
|
Others
|
|
α-Naphtholbenzein (p-Naphtolbenzein) is a dye. α-Naphtholbenzein can be used as a pH indicator. α-Naphtholbenzein has a visual transition from yellow (pH0-8.2) to turquoise (pH10). α-Naphtholbenzein is often used during sequential injection analysis technique done for acid-base titrations [1].
|
-
- HY-W746888
-
|
17-p-PGF2α-NEt2; 17-Phenyl trinor PGF2α diethyl amide
|
Prostaglandin Receptor
|
Cardiovascular Disease
|
|
17-Phenyl trinor prostaglandin F2α diethyl amide (17-phenyl trinor PGF2α diethyl amide) is a PGF2α analog with hypotensive efficacy [1].
|
-
- HY-N1132
-
|
D-Trehalose; α,α-Trehalose
|
Endogenous Metabolite
|
Metabolic Disease
|
|
D-(+)-Trehalose (α,α-Trehalose) is an orally active disaccharide, showing anti-desiccant and cryopreservative activities. D-(+)-Trehalose acts as an osmolyte, and stress protectant and helps in the storage and transport of carbon. D-(+)-Trehalose can be used as a food ingredient and pharmaceutical excipient [1] .
|
-
- HY-N15333
-
|
|
Insecticide
|
Infection
|
|
β-Terpinyl acetate is a compound with anti-termitic activity, which is found in Lavandula Latifolia. β-Terpinyl acetate is promising for research of termiticides [1].
|
-
- HY-168465
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-83 (compound I-1) is a potent inhibitor of α-Glucosidase, with the IC50 of 1.49 μg/mL. α-Glucosidase-IN-83 shows reduction in blood glucose levels in vivo [1].
|
-
- HY-160532
-
|
|
Casein Kinase
|
Cancer
|
|
CK1α degrader-1 (Compound 82) is an orally active CK1α degrader with a DC50 of 0.105 μM. CK1α degrader-1 can be used for the research of cancer [1].
|
-
- HY-N12689
-
|
|
Glycosidase
|
Metabolic Disease
|
|
α-Glucosidase-IN-56 (compound 1) is an orally active, potent α‐glucosidase inhibitor with an IC50 value of 45.86 μM. α-Glucosidase-IN-56 has potent anti-glycation activities [1].
|
-
- HY-W739985
-
|
7α-Thiomethylspironolactone
|
SARS-CoV
Estrogen Receptor/ERR
|
Infection
|
|
7α-(Thiomethyl)spironolactone is a nuclear steroid receptor antagonist that can be used for the research of coronaviruses [1].
|
-
- HY-19610
-
|
α-Amatoxin
|
DNA/RNA Synthesis
ADC Cytotoxin
|
Cancer
|
|
α-Amanitin is the principal toxin of several deadly poisonous mushrooms, exerting its toxic function by inhibiting RNA-polymerase II.
|
-
- HY-D1461
-
|
|
Fluorescent Dye
|
Cancer
|
|
Fluorescein Di-β-D-Glucopyranoside is a specific β-glucocerebrosidase substrate that can be used for the intralysosomal β-galactosidase [1].
|
-
- HY-P1772
-
-
- HY-128510
-
|
|
Adrenergic Receptor
|
Cardiovascular Disease
|
|
Colterol is the agonist for adrenergic receptor, and exhibits good affinity to β1-adrenoreceptor (heart) and β2-adrenoreceptor (lung) with IC50 of 645 nM and 147 nM. Colterol exhibits potential as a bronchodilator [1] .
|
-
- HY-101355A
-
-
- HY-115843
-
![GlcNAcβ(1-3)[GlcNAcβ(1-6)]GalNAc-α-Thr](http://file.medchemexpress.com/product_pic/hy-w145539.gif)
![Galβ(1-3)[Neu5Acα(2-6)]GlcNAc-β-pNP](http://file.medchemexpress.com/product_pic/hy-w145622.gif)
![Gal[246Bn]β(1-4)Glc[236Bn]-β-MP](http://file.medchemexpress.com/product_pic/hy-w145620.gif)
![Gal[26Bn]β(1-4)Glc[236Bn]-β-MP](http://file.medchemexpress.com/product_pic/hy-w145594.gif)
![Gal[236Bn]β(1-4)Glc[236Bn]-β-MP](http://file.medchemexpress.com/product_pic/hy-w145559.gif)
![Galβ(1-3)[Neu5Acα(2-6)]GalNAc-α-pNP](http://file.medchemexpress.com/product_pic/hy-w145540.gif)
![7-[α-L-Arabinopyranosyl-(1→6)-β-D-glucopyranosyloxy]cuminol](http://file.medchemexpress.com/product_pic/hy-n11122.gif)
![(3β)-3-[(O-β-D-Glucopyranosyl-(1→3)-O-6-deoxy-α-L-mannopyranosyl-(1→2)-α-L-arabinopyranosyl)oxy]olean-12-en-28-oic acid](http://file.medchemexpress.com/product_pic/hy-n6058.gif)
![Kaempferol-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside](http://file.medchemexpress.com/product_pic/hy-n11910.gif)
![Genistein 7-O-β-D-glucopyranoside-4'-O-[α-L-rhamnopyranosyl-(1→2)-β-D-glucopyranoside]](http://file.medchemexpress.com/product_pic/hy-n5129.gif)
![Acacetin 7-O-β-D-xylopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside](http://file.medchemexpress.com/product_pic/hy-n12032.gif)
![Quercetin-3-O-[(6-caffeoyl)-β-glucopyranosyl (1→3) α-rhamnopyranoside]-7-O-α-rhamnopyranoside](http://file.medchemexpress.com/product_pic/hy-n11901.gif)
![Acacetin 7-O-β-D-glucuronopyranosyl-(1→2)[α-L-rhamnopyranosyl-(1→6)]-β-D-glucopyranoside](http://file.medchemexpress.com/product_pic/hy-n12030.gif)
![(25R)-Ruscogenin-3-yl α-L-rhamnopyranosyl-(1→2)-[β-D-xylopyranosyl-(1→4)]-β-D-glucopyranoside](http://file.medchemexpress.com/product_pic/hy-n11983.gif)
![β-D-glucopyranosyl-[α-L-rhamnopyranosyl-(1→3)-βD-glucuronopyranosyl-(1→3)]-3β-hydroxyolean-12-ene28-oate](http://file.medchemexpress.com/product_pic/hy-n9522.gif)
![Neu5Troc[1Me,4789Ac]α(2-3)Gal[26Bn]-β-MP](http://file.medchemexpress.com/product_pic/hy-w145609.gif)
![Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine](http://file.medchemexpress.com/product_pic/hy-p3976.gif)
![[Ala28]-β Amyloid(25-35)](http://file.medchemexpress.com/product_pic/hy-p5968.gif)
![Periplogenin 3-[O-β-glucopyranosyl-(1→4)-β-sarmentopyranoside]](http://file.medchemexpress.com/product_pic/hy-n5053.gif)
