Search Result

Isoforms Recommended:	CCR5

Results for "

CCR5,

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Bacterial (1) CCR (27) CXCR (3) Endogenous Metabolite (1) HIV (24) Isotope-Labeled Compounds (1) Mitochondrial Metabolism (1) Oxidative Phosphorylation (1) P-glycoprotein (1) P2X Receptor (1) Potassium Channel (1) Small Interfering RNA (siRNA) (3)
By Research Areas:	Cancer (4) Cardiovascular Disease (1) Endocrinology (15) Infection (22) Inflammation/Immunology (12) Metabolic Disease (3)

Inhibitors & Agonists

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-14231

CCR5 antagonist 5	CCR	Infection Inflammation/Immunology
CCR5 antagonist 5 (compound example 11) is a *CCR5* antagonist. CCR5 antagonist 5 has the potential to study inflammation and immunity and viral (such as HIV) infection .

HY-152131

CCR5 antagonist 2

CCR HIV Infection

CCR5 antagonist 2 (Compound 25) is a CCR5 antagonist with an IC₅₀ of 8.34 nM. CCR5 antagonist 2 shows broad-spectrum anti-HIV-1 activities .
HY-152132

CCR5 antagonist 3

CCR HIV Infection

CCR5 antagonist 3 (Compound 26) is a CCR5 antagonist with an IC₅₀ of 15.90 nM. CCR5 antagonist 3 shows broad-spectrum anti-HIV-1 activities .
HY-100261

CCR5 antagonist 1

CCR HIV Infection Endocrinology

CCR5 antagonist 1 is a CCR5 antagonist which can inhibit HIV replication extracted from WO 2004054974 A2.

CCR5 antagonist 2	CCR HIV	Infection
CCR5 antagonist 2 (Compound 25) is a *CCR5* antagonist with an IC₅₀ of 8.34 nM. CCR5 antagonist 2 shows broad-spectrum anti-HIV-1 activities .

CCR5 antagonist 3	CCR HIV	Infection
CCR5 antagonist 3 (Compound 26) is a *CCR5* antagonist with an IC₅₀ of 15.90 nM. CCR5 antagonist 3 shows broad-spectrum anti-HIV-1 activities .

CCR5 antagonist 1	CCR HIV	Infection Endocrinology
CCR5 antagonist 1 is a *CCR5* antagonist which can inhibit HIV replication extracted from WO 2004054974 A2.

HY-RS02160

CCR5 Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
CCR5 Human Pre-designed siRNA Set A contains three designed siRNAs for CCR5 gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

CCR5 Human Pre-designed siRNA Set A CCR5 Human Pre-designed siRNA Set A

HY-RS02161

Ccr5 Mouse Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Ccr5 Mouse Pre-designed siRNA Set A contains three designed siRNAs for Ccr5 gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

Ccr5 Mouse Pre-designed siRNA Set A Ccr5 Mouse Pre-designed siRNA Set A

HY-RS02162

Ccr5 Rat Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Ccr5 Rat Pre-designed siRNA Set A contains three designed siRNAs for Ccr5 gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

Ccr5 Rat Pre-designed siRNA Set A Ccr5 Rat Pre-designed siRNA Set A

HY-13406

TAK-779 2 Publications Verification Takeda 779	CCR HIV CXCR	Infection Inflammation/Immunology Endocrinology
TAK-779 is a potent and selective nonpeptide antagonist of *CCR5* and CXCR3, with a K_i of 1.1 nM for CCR5, and effectively and selectively inhibits R5 HIV-1, with EC₅₀ and EC₉₀ of 1.2 nM and 5.7 nM, respectively, in MAGI-CCR5 cells.

HY-P99697

Leronlimab PRO 140	CCR HIV	Infection Cancer
Leronlimab (PRO 140) is a humanized IgG4 *anti-CCR5* monoclonal antibody. Leronlimab inhibits CCR5-mediated HIV-1 viral and lung metastasis in mouse tumor models. Leronlimab can be used for the research of HIV nonalcoholic steatohepatitis (NASH) and cancer .

HY-13004

Maraviroc Maximum Cited Publications 27 Publications Verification UK-427857	CCR HIV	Inflammation/Immunology Endocrinology Cancer
Maraviroc (UK-427857) is a selective *CCR5* antagonist with activity against human HIV.

HY-14388

PF-232798

CCR HIV Infection

PF-232798 is an orally active CCR5 antagonist with anti-HIV effects .

PF-232798	CCR HIV	Infection
PF-232798 is an orally active *CCR5* antagonist with anti-HIV effects .

HY-117621

PF-04634817	CCR	Metabolic Disease
PF-0463481 is a potent and orally active dual *CCR2/CCR5* antagonist with comparable human and rodent CCR2 potency (rat IC₅₀=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC₅₀=470 nM). PF-0463481 is safe and well-tolerated and has the potential for the study of diabetic nephropathy .

HY-117621A

PF-04634817 succinate	CCR	Metabolic Disease
PF-0463481 succinate is a potent and orally active dual *CCR2/CCR5* antagonist with comparable human and rodent CCR2 potency (rat IC₅₀=20.8 nM), and displays 10-20 fold less rodent CCR5 potency (rat IC₅₀=470 nM). PF-0463481 succinate is safe and well-tolerated and has the potential for the study of diabetic nephropathy .

HY-111069

Nifeviroc

CCR HIV Infection Inflammation/Immunology

Nifeviroc is an orally active CCR5 antagonist. Nifeviroc is used for the study of HIV type-1 infection .
HY-124848

CMPD167

MRK-1
CCR HIV Infection

CMPD167 (MRK-1) is an orally active CCR5 inhibitor with potent antiviral activity in vitro .

Nifeviroc	CCR HIV	Infection Inflammation/Immunology
Nifeviroc is an orally active *CCR5* antagonist. Nifeviroc is used for the study of HIV type-1 infection .

CMPD167 MRK-1	CCR HIV	Infection
CMPD167 (MRK-1) is an orally active *CCR5* inhibitor with potent antiviral activity in vitro .

HY-14882A

Cenicriviroc Mesylate 4 Publications Verification TAK-652 Mesylate; TBR-652 Mesylate	CCR HIV	Infection Inflammation/Immunology Endocrinology
Cenicriviroc Mesylate (TAK-652 Mesylate) is a dual *CCR2/CCR5* antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity.

HY-P1034

DAPTA 1 Publications Verification D-Ala-peptide T-amide; Adaptavir	CCR HIV	Infection Endocrinology
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively *CCR5*, and shows potent anti-HIV activities.

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of *CCR5*. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-14882

Cenicriviroc 4 Publications Verification TAK-652; TBR-652	CCR HIV	Infection Endocrinology
Cenicriviroc (TAK-652) is an orally active, dual *CCR2/CCR5* antagonist, also inhibits both HIV-1 and HIV-2, and displays potent anti-inflammatory and antiinfective activity .

HY-146338

RPR103611	HIV	Infection
RPR103611, the betulinic acid derivative, is a potent HIV-1 entry inhibitor with IC₅₀s of 80, 0.27, and 0.17 for CCR5-tropic virus YU2, CXCR4-tropic virus NL4-3 and dual tropic virus 89.6, respectively .

HY-111321

Fuscin	Oxidative Phosphorylation CCR HIV Bacterial Mitochondrial Metabolism Endogenous Metabolite	Infection Metabolic Disease
Fuscin, a fungal metabolite, CCR5 receptor antagonist with anti-HIV effects. Fuscin is a respiration and oxidative phosphorylation inhibitor, and also a mitochondrial SH-dependent transport-linked functions inhibitor .

HY-12080

BX471 5+ Cited Publications ZK-811752	CCR	Inflammation/Immunology Endocrinology
BX471 (ZK-811752) is an orally active, potent and selective non-peptide *CCR1* antagonist with a K_i of 1 nM, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.

HY-13004S

Maraviroc-d6	Isotope-Labeled Compounds CCR HIV	Inflammation/Immunology Endocrinology Cancer
Maraviroc-d₆ (UK-427857-d6) is the deuterium labeled Maraviroc. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV[1][2].

HY-12080A

BX471 hydrochloride 5+ Cited Publications ZK-811752 hydrochloride	CCR	Inflammation/Immunology Endocrinology
BX471 hydrochloride (ZK-811752 hydrochloride) is a potent, selective non-peptide *CCR1* antagonist with K_i of 1 nM for human CCR1, and exhibits 250-fold selectivity for CCR1 over CCR2, CCR5 and CXCR4.

HY-17450

Aplaviroc AK 602; GSK 873140; GW 873140	CCR HIV	Infection Endocrinology
Aplaviroc (AK 602), a SDP derivative, is a *CCR5* antagonist, with IC₅₀s of 0.1-0.4 nM for HIV-1_Ba-L, HIV-1_JRFL and HIV-1_MOKW.

HY-17450A

Aplaviroc hydrochloride AK602 hydrochloride; GSK-873140 hydrochloride; GW-873140 hydrochloride	CCR HIV	Infection
Aplaviroc (AK 602) hydrochloride, a SDP derivative, is a *CCR5* antagonist, with IC₅₀s of 0.1-0.4 nM for HIV-1_Ba-L, HIV-1_JRFL and HIV-1_MOKW.

HY-15971A

AMD 3465 GENZ-644494	CXCR HIV	Infection Endocrinology
AMD 3465 (GENZ-644494) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 ^AF647 to CXCR4, with IC₅₀s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC₅₀: 1-10 nM), but has no effect on CCR5-using (R5) viruses.

HY-15971

AMD 3465 hexahydrobromide 4 Publications Verification GENZ-644494 hexahydrobromide	CXCR HIV	Infection Endocrinology
AMD 3465 hexahydrobromide (GENZ-644494 hexahydrobromide) is a potent antagonist of CXCR4, inhibits binding of 12G5 mAb and CXCL12 ^AF647 to CXCR4, with IC₅₀s of 0.75 nM and 18 nM in SupT1 cells; AMD 3465 also potently inhibits the replication of X4 HIV strains (IC₅₀: 1-10 nM), but has no effect on CCR5-using (R5) viruses.

HY-109593

BMS-813160 1 Publications Verification	CCR	Cardiovascular Disease Inflammation/Immunology Endocrinology Cancer
BMS-813160 is a potent and selective *CCR2/5* dual antagonist. BMS-813160 binds with CCR2 and CCR5 with IC₅₀s of 6.2 and 3.6 nM, respectively. BMS-813160 can be used for the research of inflammation .

HY-106055

Murabutide	HIV	Inflammation/Immunology
Murabutide is a safe synthetic immunomodulator. Murabutide can reduce CD4 and CCR5 receptor expression and secrete high levels of beta-chemokines. Murabutide enhances nonspecific resistance against viral infections. Murabutide did not affect virus entry, reverse transcriptase activity or early proviral DNA formation in the cytoplasm of infected cells .

HY-17377

Vicriviroc maleate SCH-417690 maleate; SCH-D maleate	CCR HIV	Infection Endocrinology
Vicriviroc maleate (SCH-417690 maleate; SCH-D maleate) is a potent, selective, oral bioavailable and CNS penetrated antagonist of *CCR5, with a K_i* of 2.5 nM, and also inhibits HIV-1 in PBMC cells, with IC₉₀s of 3.3 nM (JrFL), 2.8 nM (ADA-M), 1.8 nM (301657), 4.9 nM (JV1083) and 10 nM (RU 570).

HY-19974

TAK-220 2 Publications Verification	CCR HIV	Infection Endocrinology
TAK-220 is a selective and orally bioavailable *CCR5* antagonist, with IC₅₀s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC₅₀s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC₉₀s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.

HY-103360

J-113863 3 Publications Verification	CCR	Inflammation/Immunology
J-113863 is a potent and selective *CCR1* antagonist with IC₅₀ values of 0.9 nM and 5.8 nM for human and mouse *CCR1* receptors, respectively. J-113863 is also a potent antagonist of the human *CCR3* (IC₅₀ of 0.58 nM) , but a weak antagonist of the mouse *CCR3* (IC₅₀ of 460 nM). J-113863 is inactive against CCR2, CCR4 and CCR5, as well as the LTB4 or TNF-α receptors. Anti-inflammatory effect .

HY-D0976

NF279	P2X Receptor HIV	Infection
NF279 is a potent selective and reversible P2X1 receptor antagonist, with an IC₅₀ of 19 nM. NF279 displays good selectivity over P2X2, P2X3 (IC₅₀=1.62 μM), P2X4 (IC₅₀>300 μM). NF279 is a dual HIV-1 coreceptor inhibitor that interferes with the functional engagement of CCR5 and CXCR4 by Env .

HY-119101

AZD-5672 1 Publications Verification	CCR Potassium Channel P-glycoprotein	Inflammation/Immunology
AZD-5672 is an orally active, potent, and selective *CCR5* antagonist (IC₅₀=0.32 nM). AZD-5672 shows moderate activity against the hERG ion channel (binding IC₅₀=7.3 μM). AZD5672 is a substrate of human P-gp, and inhibits P-gp-mediated digoxin transport (IC₅₀=32 μM). AZD-5672 can be used for the research of rheumatoid arthritis .

HY-134851

HIV-1 inhibitor-6	HIV	Infection
HIV-1 inhibitor-6 (compound 9), a diheteroarylamide-based compound, is a potent HIV-1 pre-mRNA alternative splicing inhibitor. HIV-1 inhibitor-6 blocks HIV replication. HIV-1 inhibitor-6 is active against wild-type HIV-1IIIB (subtype B, X4-tropic) and HIV-1 97USSN54 (subtype A, R5-tropic) with EC₅₀s of 0.6 μM and 0.9 μM, respectively. HIV-1 inhibitor-6 inhibits HIV strains resistant to agents targeting HIV reverse transcriptase, protease, integrase, and coreceptor CCR5 with EC₅₀s ranging from 0.9 to 1.5 μM .

DAPTA 1 Publications Verification D-Ala-peptide T-amide; Adaptavir	CCR HIV	Infection Endocrinology
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively *CCR5*, and shows potent anti-HIV activities.

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of *CCR5*. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

Leronlimab PRO 140	CCR HIV	Infection Cancer
Leronlimab (PRO 140) is a humanized IgG4 *anti-CCR5* monoclonal antibody. Leronlimab inhibits CCR5-mediated HIV-1 viral and lung metastasis in mouse tumor models. Leronlimab can be used for the research of HIV nonalcoholic steatohepatitis (NASH) and cancer .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-111321

Fuscin	Quinones Structural Classification Microorganisms Classification of Application Fields Source classification Metabolic Disease Naphthalene Quinones Disease Research Fields	Oxidative Phosphorylation CCR HIV Bacterial Mitochondrial Metabolism Endogenous Metabolite
Fuscin, a fungal metabolite, CCR5 receptor antagonist with anti-HIV effects. Fuscin is a respiration and oxidative phosphorylation inhibitor, and also a mitochondrial SH-dependent transport-linked functions inhibitor .

Recombinant Proteins Recommended:

CCR5

Species:	Human (1) Mouse (1)
Tag:	His (2)
Source:	E. coli Cell-free (1) P. pastoris (1)

Cat. No.	Compare	Product Name	Species	Source

HY-P700540

	CCR5 Protein, Mouse (P. pastoris, His) CCR5; chemokine (C-C motif) receptor 5 (gene/pseudogene); chemokine (C C motif) receptor 5, CMKBR5; C-C chemokine receptor type 5; CC CKR 5; CD195; CKR 5; CKR5; IDDM22; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A; CCR-5; CKR-5; CCCKR5; CMKBR5; CC-CKR-5; FLJ78003	Mouse	P. pastoris
	CCR5 Protein, a receptor for inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, plays a crucial role in signal transduction by increasing intracellular calcium ion levels. It contributes to granulocytic lineage control and T-lymphocyte migration to infection sites, serving as a chemotactic receptor. Interactions with PRAF2, GRK2, ARRB1, ARRB2, and CNIH4 highlight CCR5's regulatory network complexity. Efficient ligand binding to CCL3/MIP-1alpha and CCL4/MIP-1beta requires sulfation, O-glycosylation, and sialic acid modifications. Glycosylation on Ser-6 is essential for optimal CCL4 binding. The stimulating effect on T-lymphocyte chemotaxis, observed in interaction with S100A4, emphasizes CCR5's multifaceted roles in immune responses and cellular signaling pathways. CCR5 Protein, Mouse (P. pastoris, His) is the recombinant mouse-derived CCR5 protein, expressed by P. pastoris, with N-6*His labeled tag. The total length of CCR5 Protein, Mouse (P. pastoris, His) is 92 a.a., with molecular weight of 12.6 kDa.

HY-P702233

	CCR5 Protein, Human (Cell-Free, His) C-C chemokine receptor type 5; CHEMR13; HIV-1 fusion coreceptor	Human	E. coli Cell-free
	CCR5 Protein, a receptor for inflammatory CC-chemokines like CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES, transduces signals, elevating intracellular calcium levels. It regulates granulocytic lineage and facilitates T-lymphocyte migration to infection sites. In microbial infection, CCR5 acts as a coreceptor, along with CD4, for HIV-1, emphasizing its role in the cellular response to infections. CCR5 Protein, Human (Cell-Free, His) is the recombinant human-derived CCR5 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of CCR5 Protein, Human (Cell-Free, His) is 352 a.a., with molecular weight of 43.9 kDa.

Cat. No.	Product Name	Chemical Structure

HY-13004S

Maraviroc-d6

Maraviroc-d₆ (UK-427857-d6) is the deuterium labeled Maraviroc. Maraviroc (UK-427857) is a selective CCR5 antagonist with activity against human HIV[1][2].

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks