Search Result

Results for "

Monocyte

" in MedChemExpress (MCE) Product Catalog:

By Targets:	ADC Cytotoxin (4) Akt (1) Aldehyde Dehydrogenase (ALDH) (1) Angiotensin-converting Enzyme (ACE) (1) Antibiotic (12) Apoptosis (8) Arginase (1) Aryl Hydrocarbon Receptor (1) Autophagy (8) Bacterial (13) Biochemical Assay Reagents (2) c-Fms (3) Calcium Channel (2) Cannabinoid Receptor (2) CCR (6) Complement System (9) COX (13) EBI2/GPR183 (1) Endogenous Metabolite (3) Epigenetic Reader Domain (1) Epoxide Hydrolase (1) ERK (1) FLAP (1) Formyl Peptide Receptor (FPR) (3) Fungal (1) Glucocorticoid Receptor (8) Glutathione Peroxidase (1) HBV (1) HDAC (2) Histamine Receptor (1) HIV (2) HuR (1) Indoleamine 2,3-Dioxygenase (IDO) (1) Interleukin Related (3) IRAK (1) Isotope-Labeled Compounds (8) Mitochondrial Metabolism (1) Mitophagy (8) NAMPT (1) NF-κB (2) NOD-like Receptor (NLR) (5) Notch (2) Nucleoside Antimetabolite/Analog (1) P2X Receptor (1) P2Y Receptor (2) p38 MAPK (4) Phospholipase (1) Potassium Channel (1) Prostaglandin Receptor (2) PROTACs (1) SARS-CoV (8) Sodium Channel (1) TNF Receptor (4) Toll-like Receptor (TLR) (3)
By Research Areas:	Cancer (34) Cardiovascular Disease (6) Endocrinology (10) Infection (14) Inflammation/Immunology (65) Metabolic Disease (1) Neurological Disease (10)

By Targets:

ADC Cytotoxin (4)

Akt (1)

Aldehyde Dehydrogenase (ALDH) (1)

Angiotensin-converting Enzyme (ACE) (1)

Antibiotic (12)

Apoptosis (8)

Arginase (1)

Aryl Hydrocarbon Receptor (1)

Autophagy (8)

Bacterial (13)

Biochemical Assay Reagents (2)

c-Fms (3)

Calcium Channel (2)

Cannabinoid Receptor (2)

CCR (6)

Complement System (9)

COX (13)

EBI2/GPR183 (1)

Endogenous Metabolite (3)

Epigenetic Reader Domain (1)

Epoxide Hydrolase (1)

ERK (1)

FLAP (1)

Formyl Peptide Receptor (FPR) (3)

Fungal (1)

Glucocorticoid Receptor (8)

Glutathione Peroxidase (1)

HBV (1)

HDAC (2)

Histamine Receptor (1)

HIV (2)

HuR (1)

Indoleamine 2,3-Dioxygenase (IDO) (1)

Interleukin Related (3)

IRAK (1)

Isotope-Labeled Compounds (8)

Mitochondrial Metabolism (1)

Mitophagy (8)

NAMPT (1)

NF-κB (2)

NOD-like Receptor (NLR) (5)

Notch (2)

Nucleoside Antimetabolite/Analog (1)

P2X Receptor (1)

P2Y Receptor (2)

p38 MAPK (4)

Phospholipase (1)

Potassium Channel (1)

Prostaglandin Receptor (2)

PROTACs (1)

SARS-CoV (8)

Sodium Channel (1)

TNF Receptor (4)

Toll-like Receptor (TLR) (3)

By Research Areas:

Cancer (34)

Cardiovascular Disease (6)

Endocrinology (10)

Infection (14)

Inflammation/Immunology (65)

Metabolic Disease (1)

Neurological Disease (10)

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-N2110

Phellopterin	Akt	Inflammation/Immunology
Phellopterin is a natural product isolated from Angelica dahurica. Phellopterin reduces TNF-alpha-induced VCAM-1 expression through regulation of the Akt and PKC pathway, which contributes to inhibit the adhesion of monocytes to endothelium .

HY-106228

HLF1-11	Fungal Bacterial Glutathione Peroxidase	Infection
HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .

HY-P99704

Licaminlimab OCS-02	TNF Receptor	Inflammation/Immunology
Licaminlimab (OCS-02) is a single-chain anti-TNF alpha antibody fragment. TNF alpha is an inflammatory cytokine produced by macrophages and monocytes during inflammation .

HY-14762

Besifloxacin	Antibiotic Bacterial	Infection
Besifloxacin is a fluoroquinolone antimicrobial agent. Besifloxacin can inhibit cytokine production by monocytes. Besifloxacin has broad-spectrum antibacterial activity .

HY-125445

PCTR1	Others	Inflammation/Immunology
PCTR1 is a potent monocyte/macrophage agonist, regulating key anti-inflammatory and pro-resolving processes during bacterial infection. PCTR1 is a member of the protectin family of specialized pro-resolving mediators (SPMs) .

HY-157939

GPR183 antagonist-3	EBI2/GPR183	Inflammation/Immunology
GPR183 antagonist-3 (compound 33) is an oral active GPR183 antagonist with the IC₅₀ of 8.7 μM. GPR183 antagonist-3 displays strong in vitro antimigration and anti-inflammatory activity in monocytes, and improves the pathological symptoms of DSS-induced experimental colitis .

HY-122767

Romurtide Muroctasin	Interleukin Related	Inflammation/Immunology
Romurtide (Muroctasin), a synthetic muramyl dipeptide derivative, is a cytokines inducer. Romurtide can increase peripheral neutrophils and monocytes in vivo and enhance production of colony-stimulating factors (CSFs), IL-1 and IL-6 in vitro .

HY-13568

Benoxaprofen LRCL 3794	COX	Inflammation/Immunology
Benoxaprofen (LRCL 3794) is a potent and long-acting anti-inflammatory and antipyretic compound. Benoxaprofen is a relatively weak inhibitor of cyclooxygenase in in vitro systems, inhibits lipoxygenase in other systems, and inhibits monocyte migration in some animal models of inflammation .

HY-14926

Levonadifloxacin (S)-(-)-Nadifloxacin; WCK 771	Antibiotic Bacterial	Infection
Levonadifloxacin ((S)-(-)-Nadifloxacin; WCK 771) is a broad-spectrum anti-staphylococcal agent. Levonadifloxacin shows antibacterial activity against Methicillin (HY-121544)-susceptible Staphylococcus aureus (MSSA) and Methicillin-resistant S. aureus (MRSA) strains, with a reduction of which phagocytized in THP-1 monocytes .

HY-129905

L-Leucyl-L-Leucine methyl ester hydrochloride 4 Publications Verification LLOMe hydrochloride; Leu-Leu methyl ester hydrochloride; H-Leu-Leu-OMe hydrochloride	Endogenous Metabolite	Inflammation/Immunology
L-Leucyl-L-Leucine methyl ester (LLOMe) hydrochloride, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrochloride also can induce endolysosomal pathway stress .

HY-129905A

L-Leucyl-L-Leucine methyl ester hydrobromide 4 Publications Verification LLOMe hydrobromide; Leu-Leu methyl ester hydrobromide; H-Leu-Leu-OMe hydrobromide	Endogenous Metabolite	Inflammation/Immunology
L-Leucyl-L-Leucine methyl ester (LLOMe) hydrobromide, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrobromide also can induce endolysosomal pathway stress .

HY-102065

SC-19220	Prostaglandin Receptor	Others
SC-19220 is a competitive prostaglandinn E2 receptor antagonist. SC-19220 increases the bladder capacity and reduced the voiding efficiency of micturition (elicited by slow transvesical filling) of urethane-anesthetized rats. SC-19220 can restores the balance in bone marrow granulocyte and monocyte production after burn sepsis .

HY-14648

Dexamethasone Maximum Cited Publications 120 Publications Verification Hexadecadrol; Prednisolone F	Glucocorticoid Receptor SARS-CoV Autophagy Complement System Mitophagy Bacterial Antibiotic ADC Cytotoxin	Infection Inflammation/Immunology Endocrinology Cancer
Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist, apoptosis inducer, and common disease inducer in experimental animals, constructing models of muscle atrophy, hypertension, and depression. Dexamethasone can inhibit the production of inflammatory miRNA-155 exosomes in macrophages and significantly reduce the expression of inflammatory factors in neutrophils and monocytes. Dexamethasone also has potential for use in COVID-19 research .

HY-14648A

Dexamethasone acetate 2 Publications Verification Dexamethasone 21-acetate; Hexadecadrol acetate	Glucocorticoid Receptor Autophagy Mitophagy Bacterial SARS-CoV Antibiotic Complement System ADC Cytotoxin	Inflammation/Immunology Endocrinology Cancer
Dexamethasone acetate (Dexamethasone 21-acetate) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

HY-13682

Mifamurtide 1 Publications Verification MTP-PE; L-MTP-PE; CGP 19835	NOD-like Receptor (NLR)	Inflammation/Immunology Cancer
Mifamurtide (MTP-PE), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide has potential for use in rare disease and osteosarcoma research .

HY-13682B

Mifamurtide sodium 1 Publications Verification MTP-PE sodium; L-MTP-PE sodium; CGP 19835 sodium	NOD-like Receptor (NLR)	Inflammation/Immunology Cancer
Mifamurtide sodium (MTP-PE sodium), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide sodium is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide sodium has potential for use in rare disease and osteosarcoma research .

HY-14648S5

Dexamethasone-d3-1 Hexadecadrol-d₃-1; Prednisolone F-d₃-1	Isotope-Labeled Compounds	Cancer
Dexamethasone-d₃-1 (Hexadecadrol-d₃-1; Prednisolone F-d₃-1) is a deuterium labeled Dexamethasone (HY-14648). Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

HY-13682C

Mifamurtide TFA 1 Publications Verification MTP-PE TFA; L-MTP-PE TFA; CGP 19835 TFA	NOD-like Receptor (NLR)	Inflammation/Immunology Cancer
Mifamurtide TFA (MTP-PE TFA), an analog of the muramyl dipeptide (MDP), is a nonspecific immunomodulator by stimulating the immune response activating macrophages and monocytes. Mifamurtide TFA is a specific ligand for NOD2 and acts as an insulin sensitizer. Mifamurtide TFA has potential for use in rare disease and osteosarcoma research .

HY-143686

ImmTher	Biochemical Assay Reagents	Cancer
ImmTher is a liposome-encapsulated lipophilic disaccharide tripeptide derivative of muramyl dipeptide. ImmTher can up-regulate specific monocyte cytokine genes and activate monocyte-mediated tumoricidal activity .

HY-109014

Tenofovir exalidex CMX-157	HIV HBV Nucleoside Antimetabolite/Analog	Infection
Tenofovir exalidex (CMX157) is a lipid conjugate of the acyclic nucleotide analog Tenofovir with activity against both wild-type and antiretroviral drug-resistant HIV strains, including multidrug nucleoside/nucleotide analog-resistant viruses. Tenofovir exalidex is active against all major subtypes of HIV-1 and HIV-2 in fresh human PBMCs and against all HIV-1 strains evaluated in monocyte-derived macrophages, with EC₅₀s ranging between 0.2 and 7.2 nM. CMX157 is orally available and has no apparent toxicity. Tenofovir exalidex also shows antiviral activity against HBV .

HY-18763S

Indobufen-d5 Ibustrin-d₅	Isotope-Labeled Compounds COX	Cardiovascular Disease
Indobufen-d₅ is deuterium labeled Indobufen. Indobufen is a platelet aggregation inhibitor. Indobufen is a reversible platelet cyclooxygenase (Cox) activity inhibitor. Indobufen suppresses thromboxane A2 (TxA2) synthesis. Indobufen down-regulates tissue factor (TF) in monocytes[1].

HY-P2311

Defensin HNP-2 human

Endogenous Metabolite Antibiotic

Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.

Defensin HNP-2 human	Endogenous Metabolite Antibiotic
Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.

HY-160197

Aluminum phosphate adjuvant	NOD-like Receptor (NLR)	Others
Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-P1117

MMK1	Formyl Peptide Receptor (FPR) Calcium Channel	Neurological Disease Inflammation/Immunology
MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC₅₀s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity .

HY-P1117A

MMK1 TFA	Formyl Peptide Receptor (FPR) Calcium Channel	Neurological Disease Inflammation/Immunology
MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC₅₀s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity .

HY-102040

Hispidol (Z)-Hispidol	TNF Receptor	Inflammation/Immunology
Hispidol ((Z)-Hispidol) is a potential therapeutic for inflammatory bowel disease; inhibits TNF-α induced adhesion of monocytes to colon epithelial cells with an IC₅₀ of 0.50 µM.

HY-76383

LR-90	Others	Metabolic Disease Inflammation/Immunology
LR-90 is an advanced glycation end product (AGE) inhibitor, inhibits inflammatory responses in human monocytes . LR-90 is also used in the research of diabetic animal model .

HY-107352

Fosfenopril Fosinoprilat; Fosinoprilic acid; SQ 27519	Angiotensin-converting Enzyme (ACE) Toll-like Receptor (TLR) NF-κB TNF Receptor Interleukin Related	Cardiovascular Disease Inflammation/Immunology
Fosfenopril (Fosinoprilat) is a potent angiotensin converting enzyme (ACE) inhibitor. Fosfenopril alleviates lipopolysaccharide (LPS)-induced inflammation by inhibiting TLR4/NF-κB signaling in monocytes .

HY-N3646

Cudratricusxanthone A	Others	Others Neurological Disease Inflammation/Immunology Cancer
Cudratricusxanthone A is isolated from Cudrania tricuspidata, and has anti-inflammatory, hepatoprotective, and anti-proliferative activities. Cudratricusxanthone A inhibits osteoclast differentiation and function in RAW 264.7 cells and mouse bone marrow monocytes .

HY-110343

DBM 1285 dihydrochloride	TNF Receptor	Inflammation/Immunology
DBM 1285 dihydrochloride is an orally active TNF-α production inhibitor with anti-inflammatory effects. DBM 1285 dihydrochloride inhibits Lipopolysaccharide (LPS)-induced TNF-α secretion in various cells of macrophage/monocyte lineage .

HY-148045

TLR9-IN-1	Toll-like Receptor (TLR)	Inflammation/Immunology
TLR9-IN-1 is a potent and selective TLR9 inhibitor with an IC₅₀ value of 7 nM for human TLR9. TLR9-IN-1 can be used for researching diseases associated with undesirable immune response .

HY-148274

KTX-582	PROTACs IRAK Apoptosis	Cancer
KTX-582 is a potent IRAK4 degrader with DC₅₀ values of 4 nM and 5 nM for IRAK4 and Ikaros, respectively. KTX-582 can induce apoptosis in MYD88 ^MT DLBCL, and is efficient to induce in vivo tumor regressions in lymphoma model .

HY-B0253

Piroxicam 1 Publications Verification CP-16171	COX	Inflammation/Immunology Cancer
Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC₅₀s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.

HY-18763

Indobufen Ibustrin	COX	Cardiovascular Disease
Indobufen is a platelet aggregation inhibitor. Indobufen is a reversible platelet cyclooxygenase (Cox) activity inhibitor. Indobufen suppresses thromboxane A₂ (TxA₂) synthesis. Indobufen down-regulates tissue factor (TF) in monocytes .

HY-156850

ITF 3756	HDAC	Cancer
ITF 3756 is a potent and selective HDAC6 inhibitor. ITF 3756 reduces in vitro the expression of PD-L1 on human monocytes and on CD8 T cells, and shows anti-tumor activity .

HY-N11906

Diayangambin Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether	Others	Inflammation/Immunology
Diayangambin (Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether) is a cell proliferation inhibitor with an IC₅₀ value of 1.5 μM against human monocytes. Diayangambin also has immunosuppressive and anti-inflammatory effects .

HY-108661

NF546	P2Y Receptor	Inflammation/Immunology
NF546 is a selective non-nucleotide P2Y11 agonist with a pEC₅₀ of 6.27. NF546 stimulates release of interleukin-8 from human monocyte-derived dendritic cells .

HY-108661A

NF546 hydrate	P2Y Receptor	Inflammation/Immunology
NF546 (hydrate) is a selective non-nucleotide P2Y11 agonist with a pEC₅₀ of 6.27. NF546 (hydrate) stimulates release of interleukin-8 from human monocyte-derived dendritic cells .

HY-15450A

INCB 3284	CCR	Endocrinology
INCB 3284 is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC₅₀ of 3.7 nM. INCB 3284 can be used in the research of acute liver failure.

HY-145653

GSK2647544	Phospholipase	Cardiovascular Disease Neurological Disease Inflammation/Immunology
GSK2647544 is an orally available, selective inhibitor of Lp-PLA2. Lipoprotein-associated phospholipase (Lp-PLA2) is a calcium-independent phospholipase A2 with proinflammatory activities that is primarily secreted by monocyte-derived macrophages .

HY-B0253S

Piroxicam-d3 CP-16171 d₃	COX	Inflammation/Immunology Cancer
Piroxicam-d₃ is deuterium labeled Piroxicam. Piroxicam is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively [1].

HY-15450

INCB 3284 dimesylate	CCR	Endocrinology
INCB 3284 dimesylate is a potent, selective and orally bioavailable human CCR2 antagonist, inhibiting monocyte chemoattractant protein-1 binding to hCCR2, with an IC₅₀ of 3.7 nM. INCB 3284 dimesylate can be used in the research of acute liver failure.

HY-16384

L-156602 Antibiotic L 156602; PD 124966	Complement System	Inflammation/Immunology
L-156602 is a C5a receptor antagonist. L-156602 inhibits inflammation, and the migration of monocytes and neutrophils to the infiltrating site in mouse inflammatory models. L-156602 suppresses the efferent phase of delayed-type hypersensitivity (DTH) .

HY-106409

Tefinostat 1 Publications Verification CHR-2845	HDAC Apoptosis	Cancer
Tefinostat (CHR-2845) is a monocyte/macrophage targeted histone deacetylase (HDAC) inhibitor. Tefinostat can be cleaved into active acid CHR-2847 by the intracellular esterase human carboxylesterase-1 (hCE-1). Tefinostat can be used for the research of leukaemias .

HY-160197G

Aluminum phosphate adjuvant (GMP)	NOD-like Receptor (NLR)	Infection Inflammation/Immunology
Aluminum phosphate adjuvant GMP is a Aluminum phosphate adjuvant produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .

HY-B0253S1

Piroxicam-d4 CP-16171-d₄	Isotope-Labeled Compounds COX	Inflammation/Immunology Cancer
Piroxicam-d₄ is the deuterium labeled Piroxicam. Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.

HY-13412

Cariporide (mesilate) HOE-642	Potassium Channel Sodium Channel	Cardiovascular Disease
Cariporide is a Na+/H+ Exchanger 1 (NHE-1) inhibitor. Cariporide inhibits the expression of monocyte endothelial cell adhesion and intercellular adhesion molecule-1 (ICAM-1) mediated by high glucose (HG) by inhibiting the activation of NHE-1 .

HY-13682A

Mifamurtide sodium hydrate MTP-PE sodium hydrate; L-MTP-PE sodium hydrate; CGP 19835 sodium hydrate	Others	Inflammation/Immunology Cancer
Mifamurtide (sodium hydrate) (MTP-PE (sodium hydrate); L-MTP-PE (sodium hydrate); CGP 19835 (sodium hydrate)) is the sodium hydrate of mifamurtide. Mifamurtide is a nonspecific immunomodulator that acts by stimulating immune responses by activating macrophages and monocytes. Mifamurtide is a specific ligand for NOD2 and is used as an insulin sensitizer and may also be used in osteosarcoma research .

HY-B0227S1

Ketoprofen-d4 RP-19583-d₄	COX Apoptosis	Inflammation/Immunology
Ketoprofen-d₄ is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

Cat. No.	Product Name	Target	Research Area

HY-106228

HLF1-11	Fungal Bacterial Glutathione Peroxidase	Infection
HLF1-11, a human lactoferrin-derived peptide, is a broad spectrum antimicrobial agent. HLF1-11 inhibits human MPO activity. HLF1-11 also directs GM-CSF-driven monocyte differentiation toward macrophages, and enhances immune responses .

HY-122767

Romurtide Muroctasin	Interleukin Related	Inflammation/Immunology
Romurtide (Muroctasin), a synthetic muramyl dipeptide derivative, is a cytokines inducer. Romurtide can increase peripheral neutrophils and monocytes in vivo and enhance production of colony-stimulating factors (CSFs), IL-1 and IL-6 in vitro .

HY-P3895

Substance P (3-11)	Peptides	Neurological Disease
Substance P (3-11) is a substance P (SP) fragment peptide that can cross the BBB. Substance P (3-11) has contracting activities on guinea pig ileum. Substance P (3-11) also promotes human monocyte chemotaxis .

HY-P2311

Defensin HNP-2 human

Endogenous Metabolite Antibiotic

Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Others
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .

HY-P1117

MMK1	Formyl Peptide Receptor (FPR) Calcium Channel	Neurological Disease Inflammation/Immunology
MMK1 is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC₅₀s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 is a potent chemotactic and calcium-mobilizing agonist. MMK1 potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 exerts anxiolytic-like activity .

HY-P1117A

MMK1 TFA	Formyl Peptide Receptor (FPR) Calcium Channel	Neurological Disease Inflammation/Immunology
MMK1 TFA is a potent and selective human formyl peptide receptor like-1 (FPRL-1/FPR2) agonist with EC₅₀s of <2 nM and >10000 nM for FPRL-1 and FPR1, respectively. MMK1 TFA is a potent chemotactic and calcium-mobilizing agonist. MMK1 TFA potently activates phagocytic leukocytes and enhances Pertussis Toxin (HY-112779)-sensitive production by human monocytes of proinflammatory cytokines IL-1b and IL-6. MMK1 TFA exerts anxiolytic-like activity .

HY-P1764

Secretoneurin, rat	Peptides	Neurological Disease
Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes .

HY-P0308

[Glu1]-Fibrinopeptide B	Peptides	Cardiovascular Disease
[Glu1]-Fibrinopeptide B is derived from fibrinopeptide B amino acid residues 1-14. Human fibrinopeptide B (hFpB), a thrombin-derived proteolytic cleavage product of the fibrinogen B beta-chain, to stimulate neutrophils (PMN), monocytes, and fibroblasts.

HY-P1846

Jagged-1 (188-204)	Notch	Cancer
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .

HY-P1846A

Jagged-1 (188-204) (TFA) 5 Publications Verification	Notch	Cancer
Jagged-1 (188-204) TFA is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .

HY-P2320

IDR-1	Bacterial	Infection Inflammation/Immunology
IDR-1 is an antimicrobial peptide that is active against Gram-positive and Gram-negative bacteria. IDR-1 counters infection by selective modulation of innate immunity without obvious toxicities. IDR-1 has anti-inflammatory and anti-infective properties, enhances the levels of monocyte chemokines, and attenuates pro-inflammatory cytokine release .

HY-P5413

[Lys3]-Bombesin	Peptides	Others
[Lys3]-Bombesin is a biological active peptide. (PET (Positron Emission Tomography) imaging of [Lys3]-bombesin is able to detect gastrin-releasing peptide receptor (GRPR) positive prostate cancer. An immunoconjugate of [Lys3]-bombesin and corresponding monoclonal antibody can specifically induce (CD64)-dependent monocyte and neutrophil-mediated lysis of small cell carcinoma.)

HY-P2588

Osteocalcin (1-49) (human)	Peptides	Inflammation/Immunology Cancer
Osteocalcin (1-49) (human) is a vitamin K-dependent bone specific protein. Osteocalcin (1-49) (human) is chemotactic for several of the cell types frequently found at bone remodeling surfaces .

HY-P2358

PSMα3	Toll-like Receptor (TLR)	Inflammation/Immunology
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .

HY-P2358A

PSMα3 TFA	Peptides	Inflammation/Immunology
PSMα3 TFA is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 TFA penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 TFA is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .

HY-P1997

Ferrichrome Iron-free Desferrichrome; DFC; N-Desferriferrichrome	Biochemical Assay Reagents	Others
Ferrichrome is a hydroxamate siderophore produced by various fungi, including U. sphaerogena, that facilitates iron chelation and uptake by these organisms. It can be used as a heterosiderophore by bacteria, including Pseudomonas aeruginosa and Vibrio parahaemolyticus. Ferrichrome (0.8 μM) inhibits concanavalin A-induced proliferation of mouse spleen monocytes and reduces the number of concanavalin A-stimulated CD4+ T cells expressing IL-2 receptor. It also inhibits the heme-catalyzed oxidation of LDL by hydrogen peroxide in a concentration-dependent manner.

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-N2110

Phellopterin	Classification of Application Fields Source classification Coumarins Phenylpropanoids Plants Umbelliferae Helogyne apaloidea Nutt. Inflammation/Immunology Disease Research Fields	Akt
Phellopterin is a natural product isolated from Angelica dahurica. Phellopterin reduces TNF-alpha-induced VCAM-1 expression through regulation of the Akt and PKC pathway, which contributes to inhibit the adhesion of monocytes to endothelium .

HY-129905

L-Leucyl-L-Leucine methyl ester hydrochloride 4 Publications Verification LLOMe hydrochloride; Leu-Leu methyl ester hydrochloride; H-Leu-Leu-OMe hydrochloride	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Inflammation/Immunology Disease Research Fields	Endogenous Metabolite
L-Leucyl-L-Leucine methyl ester (LLOMe) hydrochloride, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrochloride also can induce endolysosomal pathway stress .

HY-129905A

L-Leucyl-L-Leucine methyl ester hydrobromide 4 Publications Verification LLOMe hydrobromide; Leu-Leu methyl ester hydrobromide; H-Leu-Leu-OMe hydrobromide	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Inflammation/Immunology Disease Research Fields	Endogenous Metabolite
L-Leucyl-L-Leucine methyl ester (LLOMe) hydrobromide, a dipeptide condensation product of L-leucine methyl ester generated by human monocytes or polymorphonuclear leukocytes, selectively eliminates lymphocytes with cytotoxic potential. L-Leucyl-L-Leucine methyl ester hydrobromide also can induce endolysosomal pathway stress .

HY-N3646

Cudratricusxanthone A	Structural Classification Flavonoids Source classification Maclura tricuspidata Carriere Plants Moraceae Other Flavonoids	Others
Cudratricusxanthone A is isolated from Cudrania tricuspidata, and has anti-inflammatory, hepatoprotective, and anti-proliferative activities. Cudratricusxanthone A inhibits osteoclast differentiation and function in RAW 264.7 cells and mouse bone marrow monocytes .

HY-N11906

Diayangambin Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether	Structural Classification Source classification Lignans Piperaceae Phenylpropanoids Plants Piper fimbriulatum C.DC.	Others
Diayangambin (Syringaresinol dimethyl ether; Lirioresinol C dimethyl ether) is a cell proliferation inhibitor with an IC₅₀ value of 1.5 μM against human monocytes. Diayangambin also has immunosuppressive and anti-inflammatory effects .

HY-N11451

Lacto-N-fucopentaose III LNFP-III	Structural Classification Polysaccharides Animals Source classification Saccharides	Arginase Aldehyde Dehydrogenase (ALDH) Indoleamine 2,3-Dioxygenase (IDO)
Lacto-N-fucopentaose III (LNFP-III) is an immune modulator. Lacto-N-fucopentaose III reduces the severity of experimental autoimmune encephalomyelitis (EAE) and CNS inflammation .

HY-P2358

PSMα3	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Inflammation/Immunology Disease Research Fields	Toll-like Receptor (TLR)
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .

HY-B0498

Bindarit Maximum Cited Publications 13 Publications Verification AF2838	Structural Classification Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Plants Umbelliferae Disease Research Fields Endocrinology Echinacea angustifolia DC. Cancer	CCR
Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity .

Species:	Human (15) Rat (2) Mouse (7) Cynomolgus (1) Pig (1)
Tag:	His (20) Tag Free (3) Strep (1) Avi (1) Fc (4)
Source:	HEK293 (17) Sf9 insect cells (1) E. coli (8)

Cat. No.	Compare	Product Name	Species	Source

HY-P74331

	CD14 Protein, Rat (HEK293, His) Monocyte Differentiation Antigen CD14; CD14	Rat	HEK293
	The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, His) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Rat (HEK293, His) is 324 a.a., with molecular weight of 45-57 kDa.

HY-P74332

	CD14 Protein, Rat (HEK293, Fc) Monocyte Differentiation Antigen CD14; CD14	Rat	HEK293
	The CD14 protein acts as a coreceptor for bacterial lipopolysaccharide (LPS), forming a complex with LY96 and TLR4. It binds monomeric LPS to LBP, delivers it to the LY96/TLR4 complex and initiates an immune response. CD14 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD14 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of CD14 Protein, Rat (HEK293, Fc) is 341 a.a., with molecular weight of ~72 kDa.

HY-P74333

	CD14 Protein, Human (HEK293, Fc) Monocyte Differentiation Antigen CD14; CD14	Human	HEK293
	The CD14 protein binds to LBP, binds to monomeric lipopolysaccharide (LPS), and delivers it to the LY96/TLR4 complex, promoting the innate immune response against bacterial LPS. CD14 Protein, Human (HEK293, Fc) is the recombinant human-derived CD14 protein, expressed by HEK293 , with N-hFc labeled tag. The total length of CD14 Protein, Human (HEK293, Fc) is 333 a.a., with molecular weight of 75-85 kDa.

HY-P75445

	CD14 Protein, Cynomolgus (HEK293, His) Monocyte Differentiation Antigen CD14; CD14	Cynomolgus	HEK293
	CD14 protein is a key coreceptor that cooperates with LBP to bind LPS and deliver it to the LY96/TLR4 complex to generate an immune response. CD14 activates NF-kappa-B through MyD88, TIRAP and TRAF6, triggering inflammation and cytokine release. CD14 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD14 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD14 Protein, Cynomolgus (HEK293, His) is 344 a.a., with molecular weight of 44-48 kDa.

HY-P7764

	MCP-1/CCL2 Protein, Mouse 4 Publications Verification rMuCCL2; C-C motif chemokine 2; Monocyte chemoattractant protein 1; Monocyte chemotactic protein 1; MCP-1; Ccl2; Scya2	Mouse	E. coli
	MCP-1/CCL2 Protein, Mouse is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse is a mouse MCP-1/CCL2 (Q24-R96) expressed by E.coil.

HY-P75444

	CD14 Protein, Mouse (HEK293, His-Fc) Monocyte Differentiation Antigen CD14; CD14	Mouse	HEK293
	CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-hFc, C-His, C-6*His labeled tag. The total length of CD14 Protein, Mouse (HEK293, His-Fc) is 330 a.a., with molecular weight of 85-95 kDa.

HY-P700164AF

	Animal-Free MCP-1/CCL2 Protein, Mouse (His) Monocyte Chemotactic Protein-1; MCP-1; JE	Mouse	E. coli
	MCP-1/CCL2 protein serves as a CCR2 ligand, inducing a potent chemotactic response and intracellular calcium mobilization in monocytes and basophils, with no impact on neutrophils or eosinophils. Crucial in neuropathic pain and enhancing NMDA-mediated synaptic transmission in dopamine D1 and D2 receptor-containing neurons, it may involve MAPK/ERK-dependent GRIN2B/NMDAR2B phosphorylation. In monomer or homodimer equilibrium, it binds to endothelial cells via glycosaminoglycan side chains and interacts with TNFAIP6 through its Link domain. Animal-Free MCP-1/CCL2 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeMCP-1/CCL2 protein, expressed by E. coli, with N-His labeled tag. The total length of Animal-Free MCP-1/CCL2 Protein, Mouse (His) is 125 a.a., with molecular weight of ~14.65 kDa.

HY-P7771

	MCP-2/CCL8 Protein, Mouse (HEK293, His) rMuCCL8, His; C-C motif chemokine 8; Ccl8; Monocyte chemoattractant protein 2; Monocyte chemotactic protein 2; MCP-2; Small-inducible cytokine A8; Mcp2; Scya8	Mouse	HEK293
	MCP-2/CCL8 Protein, Mouse (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse (HEK293, His ) is a recombinant mouse MCP-2/CCL8 (E20-P97) protein expressed by HEK293 with a his tag.

HY-P7770

	MCP-2/CCL8 Protein, Human (HEK293, His) rHuCCL8, His; C-C Motif Chemokine 8; HC14; Monocyte Chemoattractant Protein 2; Monocyte Chemotactic Protein 2; MCP-2; Small-Inducible Cytokine A8; CCL8; MCP2; SCYA10; SCYA8	Human	HEK293
	MCP-2/CCL8 Protein, Human (HEK293, His) is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Human (HEK293, His ) is a recombinant human MCP-2/CCL8 (Q24-P99) protein expressed by HEK293 with a his tag.

HY-P7786

	CD14 Protein, Human (HEK293, His) rHuCD14, His; Monocyte Differentiation Antigen CD14; Myeloid Cell-Specific Leucine-Rich Glycoprotein; CD14	Human	HEK293
	CD14 Protein, Human (HEK293, His) is a recombinant human CD14 expressed in HEK 293 cells with a His tag at the N-terminus. CD14 Protein is an efficient target for recombinant immunoglobulin vaccine constructs that deliver T cell epitopes.

HY-P73531

	CD14 Protein, Mouse (HEK293, His) rHuCD14, His; Monocyte Differentiation Antigen CD14; Myeloid Cell-Specific Leucine-Rich Glycoprotein; CD14	Mouse	HEK293
	CD14 protein is a key protein in the innate immune response and is significantly expressed in monocytes/macrophages. It acts as a coreceptor that binds various microbial and fungal molecules, including lipopolysaccharide (LPS). CD14 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD14 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of CD14 Protein, Mouse (HEK293, His) is 330 a.a., with molecular weight of ~45-50 kDa.

HY-P70569

	IL-8/CXCL8 Protein, Human (HEK293, His) Interleukin-8; IL-8; C-X-C Motif Chemokine 8; CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1	Human	HEK293
	Interleukin-8 (IL-8), also known as CXCL8 or NAP-1, is a pro-inflammatory CXC chemokine. IL-8 acts on human neutrophils via two receptors, CXCR1 and CXCR2. IL-8 has a conserved Glu-Leu-Arg (ELR) N-terminal motif, and is an agonist for CXCR1/CXCR2. IL-8 is produced by various cells including leukocytes, endothelial cells, and epithelial cells. IL-8/CXCL8 Protein, Human (HEK293, His) is produced in HEK293 cells with six C-Terminal His-tags. It consists of 79 amino acids (E21-S99).

HY-P700250AF

	Animal-Free IL-8/CXCL8 Protein, Pig (His) Interleukin-8; IL-8; C-X-C Motif Chemokine 8; CXCL8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived NeutrophIL Chemotactic Factor; MDNCF; Monocyte-Derived NeutrophIL-Activating Peptide; MONAP; NeutrophIL-Activating Protein 1; NAP-1	Pig	E. coli
	IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-8/CXCL8 Protein, Pig (His) is 78 a.a., with molecular weight of ~10.04 kDa.

HY-P70432

	IL-8/CXCL8 Protein, Human Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8	Human	E. coli
	IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Human is the recombinant human-derived IL-8/CXCL8 protein, expressed by E. coli , with tag free. The total length of IL-8/CXCL8 Protein, Human is 77 a.a., with molecular weight of ~11.0 kDa.

HY-P70876

	LRRC25 Protein, Human (HEK293, His) Leucine-rich repeat-containing protein 25; Monocyte and plasmacytoid-activated protein; MAPA; FLJ38116; UNQ6169/PRO20174	Human	HEK293
	The LRRC25 protein is an important regulator that inhibits RLR-mediated type I interferon signaling by coordinating the autophagic degradation of RIGI. Its specific interaction with ISG15-related RIGI promotes binding to p62/SQSTM1, leading to selective autophagic RIGI degradation. LRRC25 Protein, Human (HEK293, His) is the recombinant human-derived LRRC25 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LRRC25 Protein, Human (HEK293, His) is 145 a.a., with molecular weight of 25-40 kDa.

HY-P71303

	Serpin B1 Protein, Human (HEK293, His) Leukocyte elastase inhibitor; SERPINB1; Monocyte/neutrophil elastase inhibitor; M/NEI; Peptidase inhibitor 2; PI-2	Human	HEK293
	Serpin B1 protein is an important neutrophil serine protease inhibitor that regulates innate immune responses by protecting cells from cytoplasmic proteases during stress. It inhibits various neutrophil proteases, including elastase and chymotrypsin, and blocks GZMH activity intracellularly. Serpin B1 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin B1 Protein, Human (HEK293, His) is 379 a.a., with molecular weight of ~44.0 kDa.

HY-P700133AF

	Animal-Free IL-8/CXCL8 Protein, Human (His) Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived NeutrophIL Chemotactic Factor; MDNCF; Monocyte-Derived NeutrophIL-Activating Peptide; MONAP; NeutrophIL-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8	Human	E. coli
	IL-8/CXCL8 protein, a vital chemotactic factor, orchestrates inflammatory responses by attracting neutrophils, basophils, and T-cells to clear pathogens. It activates neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. IL-8/CXCL8 homodimerizes, disrupted by tick evasin-3, and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. Animal-Free IL-8/CXCL8 Protein, Human (His) is the recombinant human-derived animal-FreeIL-8/CXCL8 protein, expressed by E. coli , with C-His labeled tag. The total length of Animal-Free IL-8/CXCL8 Protein, Human (His) is 72 a.a., with molecular weight of ~9.32 kDa.

HY-P701353

	UBE1L2/UBA6 Protein, Human (Sf9, His, Strep) UBA6; Ubiquitin-like modifier-activating enzyme 6; Ubiquitin-activating enzyme 6; Monocyte protein 4; MOP-4; Ubiquitin-activating enzyme E1-like protein 2; E1-L2	Human	Sf9 insect cells
	The ubiquitin E1 enzyme initiates ubiquitination by adenylating ubiquitin with ATP and forming a thioester bond with the E1 enzyme. It exhibits specificity for ubiquitin and excludes ubiquitin-like peptides. UBE1L2/UBA6 Protein, Human (Sf9, His, Strep) is the recombinant human-derived UBE1L2/UBA6 protein, expressed by Sf9 insect cells , with N-Strep, N-8*His labeled tag. The total length of UBE1L2/UBA6 Protein, Human (Sf9, His, Strep) is 1051 a.a., .

HY-P70168

	LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) rHuLeukocyte immunoglobulin-like receptor subfamily B member 2/LILRB2, His; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2; LIR-2; Leukocyte Immunoglobulin-Like Receptor 2; CD85 Antigen-Like Family Member D; Immunoglobulin-Like Transcript 4; ILT-4; Monocyte/Macrophage Immunoglobulin-Like Receptor 10; MIR-10; CD85d; L	Human	HEK293
	The LILRB2/CD85d/ILT-4 protein is a receptor for class I MHC antigens and can recognize multiple HLA alleles. It crucially downregulates the immune response and builds tolerance. LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is the recombinant human-derived LILRB2/CD85d/ILT-4 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LILRB2/CD85d/ILT-4 Protein, Human (HEK293, His) is 437 a.a., with molecular weight of 58-75 kDa.

HY-P70179

	LILRB1/CD85j/ILT2 Protein, Human (435a.a, HEK293, His) rHuLIR-1/LILRB1, His; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1; LIR-1; Leukocyte Immunoglobulin-Like Receptor 1; CD85 Antigen-Like Family Member J; Immunoglobulin-Like Transcript 2; ILT-2; Monocyte/Macrophage Immunoglobulin-Like Receptor 7; MIR-7; CD85j; LILRB1; ILT2; LIR1; MIR7	Human	HEK293
	The LILRB1/CD85j/ILT2 protein is a receptor for class I MHC antigens and recognizes multiple HLA alleles and H301/UL18 (human cytomegalovirus MHC homolog). Ligand binding induces inhibitory signals that downregulate immune responses. LILRB1/CD85j/ILT2 Protein, Human (435a.a, HEK293, His) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LILRB1/CD85j/ILT2 Protein, Human (435a.a, HEK293, His) is 435 a.a., with molecular weight of 65-90 kDa.

HY-P70182

	LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) rHuLIR-1/LILRB1, Fc; Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 1; LIR-1; Leukocyte Immunoglobulin-Like Receptor 1; CD85 Antigen-Like Family Member J; Immunoglobulin-Like Transcript 2; ILT-2; Monocyte/Macrophage Immunoglobulin-Like Receptor 7; MIR-7; CD85j; LILRB1; ILT2; LIR1; MIR7	Human	HEK293
	LILRB1/CD85j/ILT2 Protein is an inhibitory receptor broadly expressed on leukocytes. LILRB1 recognises a wide range of classical HLA-class I allelic variants, as well as the non-classical molecules HLA-F and -G by binding to the conserved a3 domain. LILRB1 also recognises the human CMV-encoded MHC class I homologue UL18. LILRB1 is encoded within the leukocyte receptor complex on 19q13.4. LILRB1 can function as a negative regulator of BiTE molecule-induced tumor cell killing. LILRB1 acts as a novel checkpoint inhibitory molecule capable of restricting BiTE molecule-mediated CD8+ T cell effector function. LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) is the recombinant human-derived LILRB1/CD85j/ILT2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of LILRB1/CD85j/ILT2 Protein, Human (HEK293, Fc) is 435 a.a., with molecular weight of 100-120 kDa.

HY-P7156

	EMAP-II Protein, Human rHuEMAP-II; Endothelial-Monocyte A Activating Polypeptide II; EMAP-2; AIMP1	Human	E. coli
	EMAP-II Protein, Human is a proinflammatory cytokine and chemoattractant of macrophages.

HY-P72393

	LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) CD85 antigen-like family member E; ILT-6; LIR-4 and Monocyte inhibitory receptor HM43/HM31	Human	HEK293
	LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived LILRA3/CD85e/ILT6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of LILRA3/CD85e/ILT6 Protein, Human (Biotinylated, HEK293, His-Avi) is 416 a.a., with molecular weight of 70-90 kDa.

HY-P71269

	S100A11 Protein, Mouse (His) Protein S100-A11; Calgizzarin; Endothelial Monocyte-activating polypeptide; EMAP; Protein S100-C; S100 calcium-binding protein A11; S100a11; S100c	Mouse	E. coli
	The S100A11 protein plays a crucial role in promoting keratinocyte differentiation and keratinization, suggesting its involvement in important processes related to skin development and integrity. As a disulfide-linked homodimer, S100A11 may contribute to the molecular machinery that regulates keratinocyte maturation and specialized functions. S100A11 Protein, Mouse (His) is the recombinant mouse-derived S100A11 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A11 Protein, Mouse (His) is 98 a.a., with molecular weight of ~12.0 kDa.

HY-P71887A

	CXCL14/BRAK Protein, Mouse (His) Cxcl14; Bmac; Kec; Ks1; Mip2g; Scyb14C-X-C motif chemokine 14; B-cell and Monocyte-activating chemokine; Chemokine BRAK; Kidney-expressed chemokine CXC; MIP-2G; Small-inducible cytokine B14	Mouse	E. coli
	CXCL14/BRAK protein selectively attracts CESS B cells and THP-1 monocytes without affecting T cells. Its specific chemical attraction emphasizes its role in mediating B cell and monocyte migration, contributing to immune responses within the microenvironment. CXCL14/BRAK Protein, Mouse (His) is the recombinant mouse-derived CXCL14/BRAK protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL14/BRAK Protein, Mouse (His) is 77 a.a., with molecular weight of ~13 kDa.

HY-P70162

	ILT6 Protein, Human (HEK293, His) rHuLeukocyte immunoglobulin-like receptor subfamily A member 3/ILT6, His; Leukocyte immunoglobulin-like receptor subfamily A member 3; CD85 antigen-like family member E; Immunoglobulin-like transcript 6; ILT-6; Leukocyte immunoglobulin-like receptor 4; LIR-4 and Monocyte inhibitory receptor HM43/HM31	Human	HEK293
	LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. ILT6 Protein, Human (HEK293, His) is the recombinant human-derived ILT6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ILT6 Protein, Human (HEK293, His) is 421 a.a., with molecular weight of ~70.0 kDa.

Cat. No.	Product Name	Chemical Structure

HY-14648S5

Dexamethasone-d3-1

Dexamethasone-d₃-1 (Hexadecadrol-d₃-1; Prednisolone F-d₃-1) is a deuterium labeled Dexamethasone (HY-14648). Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

HY-B0253S

Piroxicam-d3
Piroxicam-d₃ is deuterium labeled Piroxicam. Piroxicam is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively [1].

HY-B0227S1

Ketoprofen-d4
Ketoprofen-d₄ is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-18763S

Indobufen-d5
Indobufen-d₅ is deuterium labeled Indobufen. Indobufen is a platelet aggregation inhibitor. Indobufen is a reversible platelet cyclooxygenase (Cox) activity inhibitor. Indobufen suppresses thromboxane A2 (TxA2) synthesis. Indobufen down-regulates tissue factor (TF) in monocytes[1].

HY-B0253S1

Piroxicam-d4
Piroxicam-d₄ is the deuterium labeled Piroxicam. Piroxicam (CP-16171) is a non-steroidal anti-inflammatory drugs, acts as a COX inhibitor, with IC50s of 47, 25 μM for human monocyte COX-1 and COX-2, respectively.

HY-B0227S

Ketoprofen-d3
Ketoprofen-d₃ is the deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-B0227S2

Ketoprofen-13C,d3
Ketoprofen- ¹³C,d₃ is the ¹³C- and deuterium labeled Ketoprofen. Ketoprofen (RP-19583) is a non-steroidal antiinflammatory agent, acting as a potent inhibitor of COX, with IC50s of 2 nM and 26 nM for COX-1 and COX-2 in human blood monocytes, respectively[1].

HY-B0335S1

Tolfenamic acid-13C6
Tolfenamic acid- ¹³C₆ is the ¹³C₆ labeled Tolfenamic acid. Tolfenamic Acid (GEA 6414) is a non-steroidal anti-inflammatory and anti-cancer agent, selectively inhibits COX-2, with an IC50 of 13.49 μM (3.53 μg/mL) in LPS-treated (COX-2) canine DH82 monocyte/macrophage cells, but shows no effect on COX-1.

HY-B0335S

Tolfenamic Acid-D4
Tolfenamic acid-d₄ is the deuterium labeled Tolfenamic Acid. Tolfenamic Acid (GEA 6414) is a non-steroidal anti-inflammatory and anti-cancer agent, selectively inhibits COX-2, with an IC50 of 13.49 μM (3.53 μg/mL) in LPS-treated (COX-2) canine DH82 monocyte/macrophage cells, but shows no effect on COX-1[1][2].

HY-14648S1

Dexamethasone-d5-1

Dexamethasone-d₅-1 is deuterium labeled Dexamethasone. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

HY-14648S2

Dexamethasone-d4

Dexamethasone-d₄ is deuterium labeled Dexamethasone. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

HY-14648S

Dexamethasone-d5

Dexamethasone-d₅ is the deuterium labeled Dexamethasone. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses[1][2].

HY-14648S3

Dexamethasone-4,6α,21,21-d4

Dexamethasone-4,6α,21,21-d₄ is the deuterium labeled Dexamethasone-4,6α,21,21. Dexamethasone (Hexadecadrol) is a glucocorticoid receptor agonist. Dexamethasone also significantly decreases CD11b, CD18, and CD62L expression on neutrophils, and CD11b and CD18 expression on monocytes. Dexamethasone is highly effective in the control of COVID-19 infection. Dexamethasone inhibits production of exosomes containing inflammatory microRNA-155 in lipopolysaccharide-induced macrophage inflammatory responses.

Cat. No.	Product Name	Application	Reactivity

HY-P81512

uPAR Antibody (YA1257)

U-PAR; Monocyte activation antigen Mo3; CD87
IHC-P Human

HY-P81096

CD14 Antibody CD14 antigen; CD14 molecule; Lipopolysaccharide receptor; LPSR; Monocyte Differentiation Antigen 14; Monocyte differentiation antigen CD14; Myeloid cell specific leucine rich glycoprotein; CD14_MOUSE; Myeloid cell-specific leucine-rich glycoprotein.	WB; ELISA; IHC-P; IHC-F; ICC; IF	Human, Mouse(predicted: Rat, Dog, Pig, Cow, Rabbit, Sheep)
CD14 Antibody is an unconjugated, approximately 35/40 kDa, rabbit-derived, anti-CD14 polyclonal antibody. CD14 Antibody can be used for: WB, ELISA, IHC-P, IHC-F, ICC, IF expriments in human, mouse, and predicted: rat, dog, pig, cow, rabbit, sheep background without labeling.

HY-P81171

MCP1 Antibody MCP-1/CCL2; C-C motif chemokine 2; CCL 2; CCL2; CCL2_HUMAN; Chemokine (C C motif) ligand 2; Chemokine C C motif ligand 2; Chemokine CC Motif Ligand 2; GDCF 2; GDCF 2 HC11; GDCF-2; GDCF2; HC11; HSMCR30; HSMCR30; JE; MCAF; MCP 1; MCP-1; MGC9434; Monocyte chemoattractant protein 1; Monocyte chemotactic and activating factor; Monocyte chemotactic protein 1; Monocyte secretory protein JE; SCYA2; Small inducible cytokine A2 (Monocyte chemotactic protein 1, homologous to mouse Sig je); Small inducible cytokine A2; Small inducible cytokine subfamily A (Cys Cys), member 2; Small inducible cytokine subfamily A Cys Cys member 2; Small-inducible cytokine A2; SMC CF; SMC-CF; SMCCF.	WB; ELISA; IHC-P; IHC-F; Flow-Cyt; IF	Human, Rat(predicted: Mouse, Dog, Pig, Horse, Rabbit)
MCP1 Antibody is an unconjugated, approximately 11 kDa, rabbit-derived, anti-MCP1 polyclonal antibody. MCP1 Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, rat, and predicted: mouse, dog, pig, horse, rabbit background without labeling.

HY-P82361

CXCR5 Antibody (YA2106) CXCR5; BLR1; MDR15; C-X-C chemokine receptor type 5; CXC-R5; CXCR-5; Burkitt lymphoma receptor 1; Monocyte-derived receptor 15; MDR-15; CD185	WB, ICC/IF, FC	Human, Mouse, Rat

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks