Search Result
Results for "
THR
" in MedChemExpress (MCE) Product Catalog:
6
Biochemical Assay Reagents
18
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-147055
-
-
-
- HY-P3467
-
-
-
- HY-160266
-
-
-
- HY-160416
-
-
-
- HY-149218
-
|
Thyroid Hormone Receptor
|
Metabolic Disease
Inflammation/Immunology
|
THR-β agonist 6 is an orally active, selective thyroid hormone receptor β (THR-β) agonist with EC50s of 0.03 μM and 0.22 μM for THR-β and THR-α, respectively. THR-β agonist 6 exhibits an xcellent liver-to-serum ratio of 93:1 in mice. THR-β agonist 6 has the potential for nonalcoholic steatohepatitis (NASH) research .
|
-
-
- HY-124890
-
|
Others
|
Metabolic Disease
|
Thr101 is an inhibitor (IC50=2.9 μM) of phosphomannose isomerase (PMI).PMI can compete with phosphomannose mutase 2 (PMM2) for the binding site of Man-6-P and convert mannose-6-phosphate (Man-6-P) into fructose-6-phosphate (Fru-6-P) .Thr101 only specifically inhibits PMI and not PMM2. Thr101 can be used for research of congenital disorder of glycosylation type Ia (CDG-Ia) .
|
-
-
- HY-153637
-
|
Thyroid Hormone Receptor
|
Endocrinology
|
THR-β modulator-1 (compound 1a) is a potent thyroid hormone receptor β modulator. THR-β modulator-1 can be used in research of thyroid hormone receptor related disorders .
|
-
-
- HY-142917
-
|
Others
|
Metabolic Disease
|
THR-β agonist 4 is a potent agonist of THR-β. THR-β agonist 4 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021143706A1, compound 72) .
|
-
-
- HY-143613
-
|
Others
|
Metabolic Disease
|
THR-β agonist 2 is a potent agonist of THR-β. THR-β agonist 2 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021121210A1, compound 3) .
|
-
-
- HY-143614
-
|
Others
|
Metabolic Disease
|
THR-β agonist 3 is a potent agonist of THR-β. THR-β agonist 3 has the potential for the research of metabolic diseases such as obesity, hyperlipidemia, hypercholesterolemia, diabetes and other conditions such as steatosis and non-alcoholic steatohepatitis (NASH), atherosclerosis and other related conditions and diseases (extracted from patent WO2021129827A1, compound 6) .
|
-
-
- HY-142441
-
|
Others
|
Endocrinology
|
THR-β Agonist 1 is a potent and selective agonist of THRβ. Thyroid hormone receptor mediates the physiological activity of thyroid hormones which plays a key role in normal growth and development of the body and in maintaining metabolic balance. THR-β Agonist 1 has the potential for the research of thyroid hormone receptor-related diseases (extracted from patent WO2021104288A1, compound 2) .
|
-
-
- HY-P5309
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
(Thr(GalNAc)4,7,15,Ser(GalNAc)9,11)-IgA1 Hinge Region Peptide is a synthetic glycopeptide and can be used for detection of gender difference and epitope specificity of IgG antibody activity against IgA1 hinge portion in IgA nephropathy patients .
|
-
-
- HY-153535
-
-
-
- HY-130718
-
|
Bacterial
|
Infection
Cancer
|
ThrRS-IN-1 (Compound 30d) is a threonyl-tRNA synthetase (ThrRS) inhibitor with an IC50 of 1.4 µM and a Kd of 1.36 µM against Salmonella enterica ThrRS (SeThrRS). ThrRS-IN-1 simultaneously targets the tRNA Thr and L-threonine binding pockets of ThrRS. ThrRS-IN-1 shows potent antibacterial activities .
|
-
-
- HY-125083
-
-
-
- HY-W008086A
-
|
Others
|
Others
|
(Rac)-H-Thr-OMe hydrochloride is the isomer of H-Thr-OMe hydrochloride (HY-W008086), and can be used as an experimental control. H-Thr-OMe.HCl is a threonine derivative .
|
-
-
- HY-W005883
-
-
-
- HY-W008086
-
-
-
- HY-W008297
-
-
-
- HY-W008696
-
-
-
- HY-W012437
-
-
-
- HY-W048671
-
|
Amino Acid Derivatives
|
Others
|
Fmoc-Thr(TBDMS)-OH is a Threonine derivative. Fmoc-Thr(TBDMS)-OH can be used for the preparation of sugar ligand-tethered functional nucleic acid conjugates for targeted research .
|
-
-
- HY-22296
-
-
-
- HY-W016731
-
-
-
- HY-W007706
-
-
-
- HY-W008800
-
-
-
- HY-W042013
-
-
-
- HY-W011606
-
-
-
- HY-W011892
-
-
-
- HY-W013198
-
-
-
- HY-W008464
-
-
-
- HY-W018650
-
-
-
- HY-P1332
-
[D-Ser2, Leu5, THR6]-enkephalin
|
Opioid Receptor
|
Neurological Disease
|
DSLET ([D-Ser2, Leu5, Thr6]-enkephalin) is a highly specific agonist of the δ-receptor. DSLET is an enkephalin-related peptide selectively bound to the δ opioid receptor .
|
-
-
- HY-P2673
-
KRTLRR
|
EGFR
|
Others
|
Lys-Arg-Thr-Leu-Arg-Arg (KRTLRR) is a hexapeptide. Lys-Arg-Thr-Leu-Arg-Arg is a substrate of protein kinase C from EGF receptor. Lys-Arg-Thr-Leu-Arg-Arg can be used to determine the activity of protein kinase C .
|
-
-
- HY-W051350
-
-
-
- HY-W051351
-
-
-
- HY-W008315
-
-
-
- HY-W013745
-
-
-
- HY-W010770
-
-
-
- HY-W048700
-
-
-
- HY-120833
-
|
Caspase
|
Others
|
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .
|
-
-
- HY-P4561
-
|
Cathepsin
|
Others
|
H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a water-soluble polypeptide that can serve as a substrate for cathepsin D, pepsin and pepsinogen. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH has potential applications in biochemical analysis .
|
-
-
- HY-W012874
-
-
-
- HY-P2396
-
-
-
- HY-P2400
-
-
-
- HY-P2393
-
-
-
- HY-P2409
-
-
-
- HY-P2402
-
-
-
- HY-P3083
-
|
PKC
|
Inflammation/Immunology
|
N-Myristoyl-Lys-Arg-Thr-Leu-Arg is a protein kinase C (PKC) inhibitor with an IC50 value of 75 μM. N-Myristoyl-Lys-Arg-Thr-Leu-Arg inhibits IL-2 receptor induction and IL-2 production in the human leukemic cell line Jurkat .
|
-
-
- HY-P2395
-
-
- HY-P2397
-
-
- HY-P2399
-
-
- HY-P2404
-
-
- HY-P2408
-
-
- HY-P2388
-
-
- HY-P2411
-
-
- HY-P10001
-
Z-Ile-Glu-THR-Asp-pNA
|
Caspase
|
Cancer
|
Z-IETD-pNA (Z-Ile-Glu-Thr-Asp-pNA) is a colorimetric caspase-8 and granzyme B substrate. Z-IETD-pNA is hydrlyzed by caspase 8 to generate pNA .
|
-
- HY-P2394
-
-
- HY-W145586
-
GlcNAc beta(1-3)GalNAc-alpha-THR
|
Biochemical Assay Reagents
|
Others
|
GlcNAcβ(1-3)GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-P2392
-
-
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
-
- HY-15400
-
-
- HY-P2014
-
-
- HY-W007706S
-
-
- HY-126542
-
|
Others
|
Neurological Disease
|
VRK-IN-1 is a potent and selective inhibitor of vaccinia-related kinases 1 (VRK1), with an IC50 of 150 nM. VRK1 is human Ser/Thr protein kinases associated with increased cell division and neurological disorders .
|
-
- HY-W012874S
-
-
- HY-W145539
-
GlcNAc beta(1-3)[GlcNAc beta(1-6)]GalNAc-alpha-THR
|
Biochemical Assay Reagents
|
Others
|
GlcNAcβ(1-3)[GlcNAcβ(1-6)]GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-141513
-
NH-3
1 Publications Verification
|
Thyroid Hormone Receptor
|
Neurological Disease
|
NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1, inhibits binding of thyroid hormones to their receptor and that inhibits cofactor recruitment . NH-3 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-120026
-
KB015
|
Thyroid Hormone Receptor
|
Neurological Disease
|
KB130015 (KB015) is an orally active and potent ThRα and ThRβ (Thyroid Hormone Receptor) inhibitor, with IC50 values of 4.5 and 5.1 μM, respectively. KB130015 has antiarrhythmic properties. KB130015 markedly slows the kinetics of inactivation of Na + channels. KB130015 opens large-conductance Ca 2+-activated K + channels and relaxes vascular smooth muscle .
|
-
- HY-118978
-
|
Thyroid Hormone Receptor
|
Endocrinology
|
PF-00277343 is a selective and skin-penetrable THR-β (Ki: 0.51 nM for THR-β, 8.0 nM for THR-α) agonist. PF-00277343 is effective against androgenetic alopecia in animal models .
|
-
- HY-P3818
-
|
PKC
|
Others
|
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
|
-
- HY-P3811A
-
|
CaMK
|
Neurological Disease
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-153445
-
|
ERK
MEK
|
Cancer
|
MEK-IN-6 (Example 69) is a MEK inhibitor. MEK-IN-6 inhibits ERK1/2 (Thr202/Tyr204) phosphorylation in A375 cells (IC50: 2 nM). MEK-IN-6 can be used for research of cancer .
|
-
- HY-102081
-
|
Others
|
Cancer
|
2OH-BNPP1 is an inhibitor of BUB1 kinase, a Ser/Thr kinase, used for the treatment of cancer.
|
-
- HY-145232
-
|
PROTACs
|
Others
|
Similar to PROTACs in their ability to induce ternary complexes, PhosTAC7 focuses on recruiting a Ser/Thr phosphatase to a phosphosubstrate to mediate its dephosphorylation.
|
-
- HY-12216
-
-
- HY-P0232
-
-
- HY-P1115
-
|
Akt
|
Others
|
AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-P5525
-
Autocamtide-3 Derived Inhibitory Peptide
|
CaMK
|
Others
|
AC3-I, myristoylated is a biological active peptide. (This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.)
|
-
- HY-P1115A
-
|
Akt
|
Others
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-P3811
-
|
CaMK
|
Neurological Disease
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
-
- HY-146221
-
|
DYRK
|
Neurological Disease
|
Dyrk1A-IN-5 (compound 5j) is a potent and selective DYRK1A inhibitor, with an IC50 of 6 nM. Dyrk1A-IN-5 dose-dependently reduces the phosphorylation of Thr434 in SF3B1, with an IC50 of 0.5 μM. Dyrk1A-IN-5 inhibits phosphorylation of tau at Thr212, with an IC50 of 2.1 μM. Dyrk1A-IN-5 can be used for Down syndrome research .
|
-
- HY-P1230
-
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity .
|
-
- HY-P3766
-
|
PKC
|
Others
|
Protein kinase C α peptide (TFA) is a peptide of PKC-α. PKC-α acts as a lipid-dependent ser/thr protein kinase, can modulate various cellular processes, including cell survival, proliferation, differentiation, migration, adhesion and so on .
|
-
- HY-115492
-
|
PKC
|
Cancer
|
NSC668394 is a potent ezrin (Thr567) phosphorylation inhibitor, with a Kd of 12.59 μM. NSC668394 inhibit ezrin T567 phosphorylation caused by PKCΙ primarily via their binding to ezrin. NSC668394 can be used to prevent tumor metastasis .
|
-
- HY-115741
-
|
Others
|
Neurological Disease
Cancer
|
3BrB-PP1 is an ATP-competitive analog. 3BrB-PP1 can specifically inhibit the activity of protein kinase with mutations in the ATP-binding pocket (mutation of Thr97 within Sty1’s ATP-binding pocket) .
|
-
- HY-16230
-
|
ROS Kinase
Apoptosis
|
Cancer
|
GGTI-2417 is a potent and selective inhibitor of GGTase I. GGTI-2417 inhibits the Cdk2-mediated phosphorylation of p27 Kip1 at Thr187 and accumulates p27 Kip1 in the nucleus. GGTI-2417 also induces breast cancer cell apoptosis .
|
-
- HY-D0846
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
Diethyl pyrocarbonate is a potent, orally active, non-specific chemical inhibitor of RNase. Diethyl pyrocarbonate has been useful in vitro as an agent relatively specific for binding to imidazole of histidine. Diethyl pyrocarbonate inhibits central chemosensitivity in rabbits. Diethyl pyrocarbonate can modify Ser, Thr, His and Tyr residues. Diethyl pyrocarbonate can be used for modeling .
|
-
- HY-108801
-
VEGF Trap; VEGF-TRAPR1R2; VEGF-trapR1
|
VEGFR
|
Cardiovascular Disease
Metabolic Disease
|
Aflibercept (VEGF Trap) is a soluble decoy VEGFR constructed by fusing the Ig domains of VEGFR1 and VEGFR2 with the Fc region of human IgG1. Aflibercept inhibits VEGF signaling by reducing VEGF-regulated processes. Aflibercept can be used for thr research of age-related macular degeneration (AMD) and cardiovascular disease .
|
-
- HY-108801A
-
|
VEGFR
|
Cardiovascular Disease
Metabolic Disease
|
Aflibercept (VEGF Trap) is a soluble decoy VEGFR constructed by fusing the Ig domains of VEGFR1 and VEGFR2 with the Fc region of human IgG1. Aflibercept inhibits VEGF signaling by reducing VEGF-regulated processes. Aflibercept can be used for thr research of age-related macular degeneration (AMD) and cardiovascular disease .
|
-
- HY-128345
-
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
|
UDM-001651 is a potent, selective, and orally bioavailable protease-activated receptor 4 (PAR4) antagonist (IC50=4 nM; Kd=1.4 nM). UDM-001651 shows antiplatelet potency (IC50=25 nM) in a γ-thrombin-induced platelet-rich plasma aggregation assay (γ-Thr PRP) .
|
-
- HY-126477
-
|
Endogenous Metabolite
|
Cancer
|
NNK is a nicotine-nitrosated derivative. NNK simultaneously stimulates Bcl2 phosphorylation exclusively at Ser 70 and c-Myc at Thr 58 and Ser 62 through activation of both ERK1/2 and PKCα . NNK induces survival and proliferation of human lung cancer cells. NNK can be used for lung cancer mice model structure .
|
-
- HY-E70018
-
|
Endogenous Metabolite
|
Infection
Metabolic Disease
|
Picornain 3C is a protease found in picornaviruses, which cleaves peptide bonds of non-terminal sequences. Picornain 3C is an intermediate between the serine peptidase chymotrypsin and the cysteine peptidase papain. Picornain 3C shows endopeptidase activity by selectively cleaving Gln-Gly bonds in the polyprotein of poliovirus and with substitution of Glu for Gln, and Ser or Thr for Gly in other picornaviruses .
|
-
- HY-13241
-
LY2228820 dimesylate
|
p38 MAPK
Autophagy
Apoptosis
|
Inflammation/Immunology
Cancer
|
Ralimetinib dimesylate (LY2228820 dimesylate) is a selective, ATP-competitive inhibitor of p38 MAPK α/β with IC50s of 5.3 and 3.2 nM, respectively. Ralimetinib (LY2228820) selectively inhibits phosphorylation of MK2 (Thr334), with no effect on phosphorylation of p38a MAPK, JNK, ERK1/2, c-Jun, ATF2, or c-Myc.
|
-
- HY-13241A
-
LY2228820
|
p38 MAPK
Autophagy
|
Inflammation/Immunology
Cancer
|
Ralimetinib (LY2228820) is a potent and selective, ATP-competitive inhibitor of p38 MAPK α/β, with IC50s of 5.3 and 3.2 nM, respectively. Ralimetinib (LY2228820) selectively inhibits phosphorylation of MK2 (Thr334), with no effect on phosphorylation of p38α MAPK, JNK, ERK1/2, c-Jun, ATF2, or c-Myc .
|
-
- HY-145294
-
|
ROCK
|
Neurological Disease
|
ROCK2-IN-5 (compound 1d) is a hybrid compound containing structural fragments of the Rho kinase inhibitor fasudil and the NRF2 inducers caffeic and ferulic acids. ROCK2-IN-5 has good multitarget profile and good tolerability. ROCK2-IN-5 has the potential for thr research of Amyotrophic lateral sclerosis (ALS) with a SOD1 mutation .
|
-
- HY-P5126
-
|
Somatostatin Receptor
|
Cancer
|
DOTA-LM3 is a somatostatin receptor (SSTR) antagonist. LM3 refers to p-Cl-Phe- cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr- NH2, as well as a somatostatin antagonist. DOTA-LM3 is often isotopically labeled for tracing tumors in vivo, such as 177Lu-DOTA-LM3 and 68 Ga-DOTA-LM3. 68 Ga-DOTA-LM3 shows favorable biodistribution, high tumor uptake, good tumor retention, and few safety concerns. 177Lu-DOTA-LM3 can be used for research in DOTATOC-negative liver metastases, such as pancreatic NET and extensive tumor thrombosis .
|
-
- HY-P5126A
-
|
Somatostatin Receptor
|
Cancer
|
DOTA-LM3 TFA is a somatostatin receptor (SSTR) antagonist. LM3 refers to p-Cl-Phe- cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr- NH2, as well as a somatostatin antagonist. DOTA-LM3 TFA is often isotopically labeled for tracing tumors in vivo, such as 177Lu-DOTA-LM3 TFA and 68 Ga-DOTA-LM3 TFA. 68 Ga-DOTA-LM3 TFA shows favorable biodistribution, high tumor uptake, good tumor retention, and few safety concerns. 177Lu-DOTA-LM3 TFA can be used for research in DOTATOC-negative liver metastases, such as pancreatic NET and extensive tumor thrombosis .
|
-
- HY-P1906
-
|
CDK
|
Neurological Disease
|
[pThr3]-CDK5 Substrate is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
-
- HY-P1906A
-
|
CDK
|
Neurological Disease
|
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
-
- HY-11000A
-
|
Phosphatase
|
Cancer
|
CaMKP inhibitor sodium (compound 5) is an inhibitor of Ca 2+/neutral protein-dependent protein concentration (CaMKP) and its nuclear type (CaMKP-N) (IC50: 6.4 μM, CaMKP; 6.6 μM, CaMKP-N). CaMKP is one type of Ser/Thr protein, which can be passed through to remove the oxidized oxidized protein (CaMK). CaMKP inhibitor sodium inhibits CaMKP mediated phospho-CaMKI hydrolysis, unaffectes protein phosphoric acid 2C (PP2C) and calcineurin (CaN) .
|
-
- HY-155245
-
|
CDK
Bcl-2 Family
|
Cancer
|
A09-003 is a CDK-9 inhibitor (IC50: 16 nM). A09-003 inhibits leukemia cell proliferation (IC50: 1.90, 0.86, 2.49, 1.84, 0.48 μM for BDCM, Molm-14, THP-1, U937, MV4-11 cells). A09-003 induces apoptosis and decreases Mcl-1 expression through Thr163 dephosphorylation .
|
-
- HY-147298
-
CYC140
|
Polo-like Kinase (PLK)
|
Cancer
|
Plogosertib (CYC140) is a selective, potent, and orally active ATP-competitive PLK1 inhibitor (IC50: 3 nM). Plogosertib is an anti-cancer agent with anti-proliferative activity. Plogosertib can be used in the research of several tumors, including esophageal, gastric, leukemia, non–small cell lung cancer, ovarian, and squamous cell cancers .
|
-
- HY-10790
-
SB-207499
|
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
Cilomilast (SB-207499) is a potent, selective and orally active inhibitor of Phosphodiesterase 4 (PDE4), with IC50s of ~100 and 120 nM for LPDE4 and HPDE4, respectively. Cilomilast shows selectivity for PDE4 over PDE1, PDE2, PDE3 and PDE5 (IC50=74, 65, >100, and 83 µM, respectively). Cilomilast has anti-inflammatory and immunomodulatory effects and can be used for thr research of asthma and chronic obstructive pulmonary disease (COPD) .
|
-
- HY-P5272
-
|
Bacterial
|
Inflammation/Immunology
|
Histatin-3 TFA, a 32 amino acid peptide, possesses powerful antimicrobial properties. Histatin-3 TFA behaves as a substrate for proprotein convertase 1 (PC1), being cleaved by this endoprotease primarily at a site carboxy terminal to the single Arg25 residue (HRGYR decrease SN). Histatin-3 TFA is a moderately potent, reversible and competitive inhibitor of the furin-mediated cleavage of the pentapeptide pGlu-Arg-Thr-Lys-Arg-MCA fluorogenic substrate, with an estimated inhibition constant Ki of 1.98 μM .
|
-
- HY-11010
-
|
JNK
|
Neurological Disease
Inflammation/Immunology
Cancer
|
AS601245 is an orally active, selective, ATP competitive JNK (c-Jun NH2-terminal protein kinase) inhibitor with IC50s of 150, 220, and 70 nM for three JNK human isoforms (hJNK1, hJNK2, and hJNK3), respectively. AS601245 exhibits 10- to 20-fold selectivity over c-src, CDK2, and c-Raf and more than 50- to 100-fold selectivity over a range of Ser/Thr- and Tyr-protein kinases. Neuroprotective properties .
|
-
- HY-P5562
-
|
Bacterial
|
Infection
|
PP102 is an antimicrobial peptide is active against gram-positive B. subtilis (MIC: 25 uM), S. aureus (MIC: 13.3 uM), S. lutea (MIC: 63 uM), and B. pumilu (MIC: 23 uM) .
|
-
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
-
- HY-P0280
-
-
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
-
- HY-P3012
-
|
Cathepsin
|
Inflammation/Immunology
|
Cathepsin G acts as a potent agonist of human platelet activation leading to their aggregation., and can be used for screening of relevant inhibitors .
|
-
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
-
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
FITC-α-Bungarotoxin is the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P1264F1
-
|
nAChR
|
Neurological Disease
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Inflammation/Immunology
|
Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
-
- HY-P4972
-
-
- HY-P4800
-
-
- HY-P4704
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (61-95) (human) is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
-
- HY-P4704A
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (61-95) (human) TFA is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) TFA can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
-
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
-
- HY-P5797
-
-
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
-
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
-
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
-
- HY-P0272
-
|
HIV
|
Infection
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-P0272A
-
|
HIV
|
Infection
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P1034
-
DAPTA
1 Publications Verification
D-Ala-peptide T-amide; Adaptavir
|
CCR
HIV
|
Infection
Endocrinology
|
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
|
-
- HY-P0058A
-
-
- HY-P0058
-
-
- HY-P0058B
-
-
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
-
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
-
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
-
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
-
- HY-P1346A
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P6013
-
|
Calcium Channel
|
Others
|
wt hMLN is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
-
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
-
- HY-P5310
-
-
- HY-P5904
-
Caveolin-1 scaffolding domain peptide
|
c-Met/HGFR
|
Others
|
Caveolin-1 (82-101) amide (human, mouse, rat) (Caveolin-1 scaffolding domain peptide) is a peptide that reverses aging-associated deleterious changes in multiple organs. Caveolin-1 (82-101) amide (human, mouse, rat) inhibits tyrosine kinases .
|
-
- HY-P1782
-
-
- HY-P2285
-
-
- HY-P1393
-
|
Amylin Receptor
|
Endocrinology
|
AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has neuroprotective effects .
|
-
- HY-P1393A
-
|
Amylin Receptor
|
Endocrinology
|
AC 187 TFA is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 TFA shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 TFA has neuroprotective effects .
|
-
- HY-P4977
-
-
- HY-P1265
-
Vc1.1
|
nAChR
|
Neurological Disease
|
ACV1 (Vc1.1), an α-Conotoxin, is a selective α9α10 nAChR antagonist with an IC50 of 19 nM. ACV1 is ~100-fold less potent on human α9α10 vs. rat nAChRs .
|
-
- HY-P1142
-
|
Apoptosis
|
Others
|
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
-
- HY-P1142A
-
|
Apoptosis
|
Others
|
GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
-
- HY-P0263
-
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration .
|
-
- HY-P0263A
-
|
Bacterial
Fungal
|
Infection
|
Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration .
|
-
- HY-P1142S1
-
|
Isotope-Labeled Compounds
|
Others
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
- HY-P1142S
-
|
Isotope-Labeled Compounds
|
Others
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
- HY-P5593
-
|
Fungal
|
Infection
|
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5594
-
|
Fungal
|
Infection
|
Dermaseptin-S1 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
-
- HY-P1532
-
-
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
-
- HY-P0203
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P1071
-
Calcitonin gene-related peptid
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
-
- HY-P1071A
-
Calcitonin gene-related peptid TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
-
- HY-P2221
-
ZP1848
|
GCGR
|
Inflammation/Immunology
|
Glepaglutide (ZP1848), a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide reduces faecal output and increases intestinal absorption. Glepaglutide alleviates small intestinal inflammation. Glepaglutide can be used in the research of inflammatory bowel disease (IBD) and Crohn’s disease .
|
-
- HY-P2221B
-
ZP1848 acetate
|
GCGR
|
Inflammation/Immunology
|
Glepaglutide (ZP1848) acetate, a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide acetate reduces faecal output and increases intestinal absorption. Glepaglutide acetate alleviates small intestinal inflammation. Glepaglutide acetate can be used in the research of inflammatory bowel disease (IBD) and Crohn’s disease .
|
-
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
-
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P3071
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-P4815
-
|
Endogenous Metabolite
|
Neurological Disease
Metabolic Disease
|
Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity .
|
-
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
-
- HY-P0191A
-
-
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
-
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
-
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P1805
-
|
Calmodulin
|
Neurological Disease
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
-
- HY-P3384
-
|
Antibiotic
|
Others
Inflammation/Immunology
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
-
- HY-P5046
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (71-82) (human) is the 71-82 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) .
|
-
- HY-163423S
-
-
- HY-P1534
-
-
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P2123A
-
|
Bacterial
Antibiotic
|
Infection
|
Colistin A sulfate hydrate is a major component of Colistin. Colistin is a polymyxin antibiotic and can be used to combat infections caused by problematic gram-negative bacteria .
|
-
- HY-P2508
-
|
Mucin
|
Cancer
|
MUC1, mucin core is the region of the MUC1 mucin core. MUC1 is a type I transmembrane glycoprotein, and is overexpressed and aberrantly glycosylated in carcinoma cells. MUC1, mucin core protein binds to domain 1 of ICAM-1 .
|
-
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
-
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
-
- HY-P5276
-
|
PD-1/PD-L1
|
Cancer
|
Human membrane-bound PD-L1 polypeptide can be used as an antigen to induce PD-L1 antibody production .
|
-
- HY-P0222
-
|
PKA
|
Others
|
PKI(5-24) is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
-
- HY-P0222A
-
|
PKA
|
Others
|
PKI(5-24) TFA is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) TFA corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
-
- HY-P4984
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) is a T cell proliferation activator. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) promotes the in vitro proliferation of human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) can be used in research on inflammatory and immunity, as well as cancer .
|
-
- HY-P5560
-
|
Bacterial
|
Infection
|
PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. subtilis (MIC: 13.3 uM), S. aureus (MIC: 23.3 uM), S. lutea (MIC: 8.0 uM), and B. pumilu (MIC: 9.0 uM) .
|
-
- HY-P3965A
-
-
- HY-P3517
-
β-EP (6-31), human
|
Opioid Receptor
|
Neurological Disease
Endocrinology
|
β-Endorphin, an endogenous opioid neuropeptide, is an opioid receptor agonist. β-Endorphin binds preferentially to μ-opioid receptors and is produced in certain neurons of the central and peripheral nervous system and is one of three endorphins produced in humans. β-Endorphin can be used to reduce stress and maintain homeostasis in the body and is involved in neurological pain perception regulation .
|
-
- HY-P5892
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin (1-27) (human) is an opioid antagonist that binds μ-, δ-, and κ-opioid receptors with Kis of 5.31, 6.17, and 39.82 nM, respectively. β-Endorphin (1-27) (human) inhibits β-Endorphin (HY-P1502)-induced and etorphine-induced analgesia .
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
-
- HY-P3383A
-
PL-5 acetate
|
Bacterial
|
Infection
|
Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection .
|
-
- HY-P5604
-
|
Bacterial
|
Infection
|
Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5605
-
|
Bacterial
|
Infection
|
Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 2 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5668
-
|
Bacterial
|
Infection
|
Maximin 28 is an antimicrobial peptide derived from the toad brain. Maximin 28 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 4.7, 9.4, 75 μg/mL, respectively .
|
-
- HY-P5672
-
|
Bacterial
|
Infection
|
Maximin 39 is an antimicrobial peptide derived from the toad brain. Maximin 39 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 18.8, 37.5 μg/mL, respectively .
|
-
- HY-P5612
-
-
- HY-P0091
-
Thymosin α1
|
Influenza Virus
|
Cancer
|
Thymalfasin is an immunomodulating agent able to enhance the Thl immune response.
|
-
- HY-P0082
-
Glucagon
|
GCGR
|
Metabolic Disease
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-P0285
-
|
RABV
|
Infection
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P1874
-
|
Calmodulin
|
Neurological Disease
|
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II) .
|
-
- HY-P0285A
-
|
RABV
|
Infection
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
- HY-P0082A
-
Glucagon hydrochloride
|
GCGR
|
Metabolic Disease
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-P1143
-
|
GCGR
|
Metabolic Disease
|
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes .
|
-
- HY-P1143A
-
|
GCGR
|
Metabolic Disease
|
[Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA is potentially useful in the study of the pathogenesis of diabetes .
|
-
- HY-P5623
-
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-P5623B
-
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-P5623A1
-
RVG29-Cys acetate; RDP-Cys acetate; Rabies Virus Glycoprotein-29-Cys acetate
|
RABV
|
Others
|
RVG-Cys (RVG29-Cys;RDP-Cy) acetate is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
-
- HY-P5623A
-
RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys
|
RABV
|
Others
|
RVG-Cys (RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
-
- HY-P1473
-
Amylin (8-37) (mouse, rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
|
-
- HY-P1502
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
-
- HY-P2260
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
- HY-P2501
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological hallmark of type II diabetes mellitus .
|
-
- HY-P1728
-
|
YAP
|
Cancer
|
Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model .
|
-
- HY-P4672
-
|
GCGR
|
Metabolic Disease
|
(Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .
|
-
- HY-P2260B
-
|
HIV
|
Infection
|
Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
-
- HY-P2260C
-
|
HIV
|
Infection
|
Tat-beclin 1 scrambled TFA is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
-
- HY-P2046
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction .
|
-
- HY-P4785
-
-
- HY-P2625S1
-
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
- HY-P2625S
-
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
- HY-P5693
-
|
Bacterial
CMV
HSV
|
Infection
|
HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
|
-
- HY-P10110
-
|
Autophagy
|
Neurological Disease
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
-
- HY-P1024
-
GLP-2 (human); Glucagon-like peptide 2 (human)
|
GCGR
|
Metabolic Disease
|
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
|
-
- HY-P1841
-
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
-
- HY-P5821
-
-
- HY-P10076
-
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
- HY-P3021
-
|
Bacterial
Biochemical Assay Reagents
|
Infection
|
Human milk lysozyme is the lysozyme found in human milk. Human milk lysozyme is thought to be a key defense factor in protecting the gastrointestinal tract of newborns against bacterial infection .
|
-
- HY-P1714A
-
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P1714
-
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P10079
-
-
- HY-P1144
-
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
-
- HY-P5203
-
EntK1
|
Bacterial
|
Infection
|
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections .
|
-
- HY-P5204
-
K1-EJ hybrid
|
Bacterial
|
Infection
|
Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus .
|
-
- HY-P5902
-
-
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
-
- HY-P1295
-
Urocortin (human); Human urocortin; Human urocortin 1; Human urocortin I
|
CRFR
|
Neurological Disease
Endocrinology
|
Urocortin, human, a 40-aa neuropeptide, acts as a selective agonist of endogenous CRF2 receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively.
|
-
- HY-P1296
-
Urocortin (Rattus norvegicus); Rat urocortin
|
CRFR
|
Neurological Disease
Endocrinology
|
Urocortin, rat (Urocortin (Rattus norvegicus)) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively .
|
-
- HY-P3498
-
ZP1846
|
GCGR
|
Others
|
Elsiglutide (ZP1846) is a GLP-2 analogue, an orally active and selective GLP-2 receptor agonist, increases cell proliferation and reduces apoptosis in the intestine. Elsiglutide improves Lapatinib (HY-50898)-induced diarrhoea in rat model .
|
-
- HY-P4086
-
|
RABV
|
Infection
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction .
|
-
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
-
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
-
- HY-P10032
-
-
- HY-P10032A
-
-
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
-
- HY-P10090
-
|
Akt
PI3K
Apoptosis
|
Cancer
|
Apoptin-derived peptide is an antitumor polypeptide with cytotoxicity. Apoptin-derived peptide promotes apoptosis and necrosis of gastric cancer (GC) cells by regulating PI3K/AKT/ARNT signaling. Apoptin-derived peptide inhibited the invasion and migration of cancer cells, and inhibited the expression and phosphorylation of the subunit p85 of PI3K, which further inhibited the PI3K/AKT pathway involved in the development of gastric cancer .
|
-
- HY-P4211
-
|
Bacterial
|
Infection
|
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties .
|
-
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
-
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
-
- HY-P6008
-
MLN peptide
|
Calcium Channel
|
Cardiovascular Disease
|
Myoregulin (MLN peptide) is a member of the regulin family. Myoregulin regulates muscle performance by modulating intracellular calcium handling. Myoregulin interactes directly with sarcoplasmic reticulum Ca 2+-ATPase (SERCA) and impedinf Ca 2+ uptake into the sarcoplasmic reticulum .
|
-
- HY-P6008A
-
MLN peptide TFA
|
Calcium Channel
|
Cardiovascular Disease
|
Myoregulin (MLN peptide) TFA is a member of the regulin family. Myoregulin TFA regulates muscle performance by modulating intracellular calcium handling. Myoregulin TFA interactes directly with sarcoplasmic reticulum Ca 2+-ATPase (SERCA) and impedinf Ca 2+ uptake into the sarcoplasmic reticulum .
|
-
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
-
- HY-P1727
-
|
YAP
|
Cancer
|
Super-TDU is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU suppresses tumor growth in gastric cancer mouse model .
|
-
- HY-P4327
-
|
Bacterial
|
Infection
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative .
|
-
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
-
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
-
- HY-P7060
-
TPPT
|
iGluR
|
Neurological Disease
|
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases.
|
-
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P5065
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-16728
-
GLYX-13
|
iGluR
|
Neurological Disease
|
Rapastinel (GLYX-13) is an N-methyl-D-aspartate receptor (NMDAR) modulator that has characteristics of a glycine site partial agonist.
|
-
- HY-P0017
-
-
- HY-108719
-
-
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I is a potent K + channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes .
|
-
- HY-P5899
-
-
- HY-P1228
-
-
- HY-P2463
-
|
Arp2/3 Complex
|
Inflammation/Immunology
|
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing .
|
-
- HY-P5314
-
|
EGFR
STAT
|
Others
|
OK2, a specific inhibitor of the CCN2/EGFR interaction, efficiently blocks CCN2/EGFR interaction through binding to the CT domain of CCN2. OK2 can be used for kidney fibrosis and chronic kidney disease research .
|
-
- HY-P0313
-
|
Influenza Virus
|
Infection
|
CEF6 is a 9-aa-long peptide corresponding to aa 418-426 of the influenza A virus (H1N1) nucleocapsid protein.
|
-
- HY-P1757
-
|
HIV
|
Infection
|
HIV p17 Gag (77-85) is an HLA-A*0201(A2)-restricted CTL epitope, used in the research of anti-HIV .
|
-
- HY-P1762
-
-
- HY-P1762A
-
-
- HY-P4100
-
|
Somatostatin Receptor
|
Others
|
Cyclic SSTR agonist octreotide is a Octreotide (HY-P0036), serving as the cyclic Somatostatin Receptor SSTR agonist .
|
-
- HY-P5482
-
|
EBV
|
Others
|
Epstein-barr virus BRLF1 (134-142) is a biological active peptide. (HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142).)
|
-
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
-
- HY-P1881
-
|
HPV
|
Cancer
|
HPV16-E711-20 epitope is a well-known HLA-A *0201-restricted human cytotoxic T lymphocyte (CTL) epitope of the HPV16 E7 protein that shows high-affinity binding to HLA-A2 in vitro. HPV16 CTL epitopes may be good candidates for the development of an effective peptide-based antitumor vaccine .
|
-
- HY-P10132
-
|
Ferroptosis
|
Metabolic Disease
|
PRDX3(103-112), human is a marker for ferroptosis. PRDX3 is hyperoxidated by mitochondrial lipid peroxides. PRDX3 inhibits cystine uptake after hyperoxidization .
|
-
- HY-P0139
-
Gap 27
5 Publications Verification
|
Gap Junction Protein
|
Cardiovascular Disease
|
Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment .
|
-
- HY-P1224
-
-
- HY-P1776
-
|
Insulin Receptor
|
Metabolic Disease
|
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor (1142-1153) binds to insulin and can be used as insulin receptor tyrosine kinase substrates .
|
-
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P1191
-
TI-JIP; JIP-1 peptide; JIPtide
|
JNK
|
Others
|
JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
-
- HY-P1191A
-
TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA
|
JNK
|
Others
|
JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
-
- HY-P2275B
-
-
- HY-P3258
-
|
Cholinesterase (ChE)
|
Infection
|
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
|
-
- HY-P5043
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (67-78) (human) is the 67-78 fragment of α-Synuclein. α-Synuclein (67-78) (human) promotes network activity drive and blocks KCl-induced syt1L-ab uptake .
|
-
- HY-P10133
-
-
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
-
- HY-P5144
-
-
- HY-106783
-
|
Bacterial
Antibiotic
|
Infection
|
Polymyxin B nonapeptide is a cyclic peptide obtained from Polymyxin B by proteolytic removal of its terminal amino acyl residue. Polymyxin B nonapeptide is less toxic, lacks bactericidal activity, and retains its ability to render gram-negative bacteria susceptible to several antibiotics by permeabilizing their outer membranes .
|
-
- HY-P1749
-
|
Influenza Virus
|
Infection
|
Influenza HA (307-319) is 13 amino acids 307 to 319 fragment of Influenza HA. Influenza HA is a glycoprotein found on the surface of influenza viruses .
|
-
- HY-P1736
-
|
Influenza Virus
|
Infection
|
Influenza HA (126-138) is a influenza virus hemagglutinin (HA) peptide comprising amino acids 126-138, induces thymic and peripheral T-cell apoptosis .
|
-
- HY-P1052
-
|
Others
|
Inflammation/Immunology
|
Myelin Basic Protein(87-99) is an encephalitogenic peptide that induces basic protein-specific T cell proliferation. Myelin Basic Protein(87-99) causes a Th1 polarization in peripheral blood mononuclear cells with is implicated of multiple sclerosis (MS) .
|
-
- HY-P10212
-
UCCB01-125
|
iGluR
|
Neurological Disease
|
AVLX-125 (UCCB01-125) is a PSD-95 and PDZ domain inhibitor with Kd value of 10 nM. AVLX-125 can be used in the study of inflammatory pain .
|
-
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
-
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
-
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P5691
-
|
Bacterial
|
Infection
|
P1 is a broad-spectrum antimicrobial peptide. P1 shows antibacterial activity against Gram-positive and Gram-negative bacteria,such as B. anthracis spores and Carbapenem-resistant A. baumannii and K. pneumoniae .
|
-
- HY-156345S1
-
-
- HY-P10056
-
Human ezrin peptide (324-337)
|
HIV
|
Infection
|
HEP-1 (Human ezrin peptide (324-337)) is an orally active peptide with anti-HIV activity. HEP-1 enhances antibody titers generated by hepatitis B vaccination. HEP-1 has the potential to be studied against viral infections .
|
-
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
-
- HY-P1445
-
-
- HY-P2276
-
-
- HY-P10055A
-
PSMA-1 TFA
|
PSMA
|
Cancer
|
PSMA targeting peptide TFA (PSMA-1 TFA) is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells .
|
-
- HY-P1560
-
Lysozyme C (46-61) (chicken)
|
Bacterial
|
Infection
|
Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
|
-
- HY-P1592
-
G3-C12
1 Publications Verification
|
Galectin
|
Cancer
|
G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
-
- HY-P4027
-
|
HCV
|
Infection
|
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
-
- HY-P4027A
-
|
HCV
|
Infection
|
HCV-1 e2 Protein (554-569) TFA is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) TFA contains a putative N-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
-
- HY-P5555
-
|
Bacterial
|
Infection
|
LMW peptide is an antimicrobial peptide. LMW peptide is active against Gram-positive and Gram-negative bacterial, such as B. subtilis, L. monocytogenes, E. coli, P. aeruginosa, V. cholera .
|
-
- HY-P1770
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (16-31), human is amino acid residues 16-31 fragment of human adrenomedullin (hADM). Adrenomedullin has appreciable affinity for the CGRP1 receptor. Adrenomedullin (16-31), human possesses pressor activity in the systemic vascular bed of the rat, but not the cat .
|
-
- HY-163427S
-
-
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
-
- HY-P1777
-
Insulin-like Growth Factor I (24-41)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) regulates somatic growth and behavioral development .
|
-
- HY-P1777A
-
Insulin-like Growth Factor I (24-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) TFA regulates somatic growth and behavioral development .
|
-
- HY-P2545
-
-
- HY-P4038
-
|
HCV Protease
|
Infection
|
Hepatitis C Virus S5A/5B is a synthetic peptide substrate. Hepatitis C Virus S5A/5B mimics the NS5A/5B junction of the nonstructural protein (NS), served as the substrate for the study of HCV NS3 protease activity .
|
-
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
-
- HY-P0121
-
ReACp53
2 Publications Verification
|
MDM-2/p53
|
Cancer
|
ReACp53 could inhibit p53 amyloid formation and rescue p53 function in cancer cell lines.
|
-
- HY-P4351
-
|
HIV
|
Others
|
HIV-1 gag Protein p24 (194-210) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P1479
-
|
Autophagy
CaMK
|
Neurological Disease
|
Calmodulin-Dependent Protein Kinase II (290-309) is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II .
|
-
- HY-P4156
-
|
mAChR
|
Neurological Disease
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA .
|
-
- HY-P1894
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid Protein Precursor 770 (135-155) is a peptide of amyloid precursor protein isoform (APP 770). APP 770 produces Aβ40/42 .
|
-
- HY-P2265
-
|
Ras
|
Cancer
|
SAH-SOS1A is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM), directly and independently blocks nucleotide association, impairs KRAS-driven cancer cell viability, and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
-
- HY-P2265A
-
|
Ras
|
Cancer
|
SAH-SOS1A TFA is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A TFA binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM). SAH-SOS1A TFA directly and independently blocks nucleotide association. SAH-SOS1A TFA impairs KRAS-driven cancer cell viability and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
-
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
-
- HY-P5547
-
|
Bacterial
|
Infection
|
Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection
|
-
- HY-P2247
-
|
JNK
|
Cancer
|
JTP10-△-R9 TFA is a selective JNK2 peptide inhibitor, with an IC50 of 89 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3 .
|
-
- HY-P1206
-
|
Somatostatin Receptor
|
Neurological Disease
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
-
- HY-P10081
-
-
- HY-P1783A
-
|
Influenza Virus
|
Infection
|
M2e, human TFA, consisting of the 23 extracellular residues of M2 (the third integral membrane protein of influenza A), has been remarkably conserved in all human influenza A. M2e, human TFA is a valid and versatile vaccine candidate to protect against any strain of human influenza A .
|
-
- HY-P5003
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Collagen Type II Fragment is an anti-inflammatory peptide that potently inhibits collagen-induced arthritis (CIA) in mice. Collagen Type II Fragment can be used for research on inflammation and immunity .
|
-
- HY-P5054
-
-
- HY-P10115
-
|
STAT
|
Cancer
|
APT STAT3 is a specific STAT3-binding peptide. APT STAT3 can bind STAT3 with high specificity and affinity (~231 nmol/L). APT STAT3 is a tractable agent for translation to target the broad array of cancers harboring constitutively activated STAT3 .
|
-
- HY-P0233
-
-
- HY-P0204A
-
-
- HY-P0233A
-
|
Phospholipase
|
Infection
Cancer
|
Melittin TFA is a PLA2 activator, stimulates the activity of the low molecular weight PLA2, while it does not the increase activity of the high molecular weight PLA2 .
|
-
- HY-P5379
-
|
Proteasome
|
Others
|
Calpastatin subdomain B is a biological active peptide. (inhibit calpain activity)
|
-
- HY-P5606
-
|
Bacterial
|
Infection
|
Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 3 has cytotoxicity on tumor cells and spermicidal effect. Maximin 3 has significant anti-HIV activity .
|
-
- HY-P5609
-
|
Bacterial
|
Infection
|
Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 5 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P10160
-
chCATH-2
|
Bacterial
|
Infection
|
Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates .
|
-
- HY-P1244
-
Secretin (rat)
|
Secretin Receptor
|
Neurological Disease
|
Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
|
-
- HY-P1465
-
-
- HY-P1535
-
Porcine secretin acetate
|
Secretin Receptor
|
Inflammation/Immunology
|
Secretin, porcine (Porcine secretin acetate) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
|
-
- HY-P1784
-
|
Secretin Receptor
|
Endocrinology
|
Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway .
|
-
- HY-P1244A
-
Secretin (rat) (TFA)
|
Secretin Receptor
|
Neurological Disease
|
Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K + from the pancreas .
|
-
- HY-P1465A
-
-
- HY-P1535A
-
Porcine secretin TFA
|
Secretin Receptor
|
Inflammation/Immunology
|
Secretin, porcine TFA (Porcine secretin TFA) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid .
|
-
- HY-P5910
-
|
MDM-2/p53
Apoptosis
|
Cancer
|
Azurin p28 peptide is a tumor-penetrated antitumor peptide. Azurin p28 peptide redues proteasomal degradation of p53 through formation of a p28: p53 complex. Azurin p28 peptide induces apoptosis or cell cycle arrest. Azurin p28 peptide inhibits p53-positive tumor growths. Azurin p28 peptide shows antiangiogenic effect by inhibiting phosphorylation of VEGFR-2, FAK and Akt .
|
-
- HY-P5666
-
|
Bacterial
|
Infection
|
Maximin 15 is an antimicrobial peptide derived from the toad brain. Maximin 15 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 9.4, 18.8, 75 μg/mL, respectively .
|
-
- HY-P5671
-
|
Bacterial
|
Infection
|
Maximin 32 is an antimicrobial peptide derived from the toad brain. Maximin 32 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 9.4, 18.8 μg/mL, respectively .
|
-
- HY-P5683
-
|
Bacterial
|
Infection
|
Maximin 45 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus, E. coli, B. subtilis (MIC: 4.7, 9.4, 75 μg/mL). Maximin 45 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P5689
-
|
Bacterial
|
Infection
|
Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells .
|
-
- HY-P10106
-
|
PAK
|
Cancer
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
-
- HY-P1141
-
|
GCGR
|
Metabolic Disease
|
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor .
|
-
- HY-P1141A
-
|
GCGR
|
Metabolic Disease
|
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor .
|
-
- HY-P1081
-
|
Proteasome
|
Inflammation/Immunology
|
Acetyl-Calpastatin(184-210)(human) is a potent, selective and reversible calpain inhibitor with Ki values of 0.2 nM and 6 μM for µ-calpain and cathepsin L, respectively .
|
-
- HY-P1081A
-
|
Proteasome
|
Inflammation/Immunology
|
Acetyl-Calpastatin(184-210)(human) TFA is a potent, selective and reversible calpain inhibitor with Ki values of 0.2 nM and 6 μM for µ-calpain and cathepsin L, respectively .
|
-
- HY-P5587
-
|
Fungal
|
Infection
|
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5005
-
|
Biochemical Assay Reagents
|
Cancer
|
VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study of cancers such as non-small cell lung cancer (NSCLC) .
|
-
- HY-P10080
-
-
- HY-P10169
-
|
Proteasome
|
Others
|
Acetyl-Calpastatin(184-210)(human), Negative Control is a control scramble peptide of Acetyl-Calpastatin(184-210)(human) (HY-P1081). Acetyl-Calpastatin(184-210)(human) is a potent, selective and reversible calpain inhibitor .
|
-
- HY-P1014
-
-
- HY-P1127
-
-
- HY-P1132
-
-
- HY-P1132A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect .
|
-
- HY-P4927
-
-
- HY-P4969
-
-
- HY-P0165
-
ITM077; R1583; BIM51077
|
GCGR
|
Metabolic Disease
|
Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist developed for treatment of type 2 diabetes, with an EC50 value of 0.06 nM.
|
-
- HY-P0054
-
Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate
|
GCGR
|
Metabolic Disease
|
GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
|
-
- HY-P0055
-
|
GCGR
|
Metabolic Disease
|
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
|
-
- HY-P0209
-
-
- HY-P0054A
-
Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide
|
GCGR
|
Metabolic Disease
|
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
|
-
- HY-P0055A
-
|
GCGR
|
Metabolic Disease
|
GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion .
|
-
- HY-P1866
-
-
- HY-P1866A
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .
|
-
- HY-108795A
-
GLP-1-Gly8 TFA; GLP-1 (7-36) analog TFA
|
GLP Receptor
|
Metabolic Disease
|
Albiglutide fragment (GLP-1 (7-36) analog) TFA is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment TFA significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies .
|
-
- HY-P3141
-
-
- HY-108795
-
GLP-1-Gly8; GLP-1 (7-36) analog
|
GLP Receptor
|
Metabolic Disease
|
Albiglutide fragment (GLP-1 (7-36) analog) is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies .
|
-
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
-
- HY-P4924
-
-
- HY-P1471
-
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P1520
-
|
GnRH Receptor
|
Neurological Disease
|
Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P0069A
-
-
- HY-P1471A
-
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P1160A
-
|
GCGR
|
Metabolic Disease
|
Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes .
|
-
- HY-P1160
-
|
GCGR
|
Metabolic Disease
|
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes .
|
-
- HY-P1520A
-
|
GnRH Receptor
|
Neurological Disease
|
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
-
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
-
- HY-P5848
-
|
nAChR
|
Neurological Disease
|
αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10. αO-Conotoxin GeXIVA shows analgesic in animal models of pain .
|
-
- HY-P5578
-
|
GCGR
|
Metabolic Disease
|
A8SGLP-1 is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 reduces blood glucose in db/db mice without affecting its function .
|
-
- HY-P5578A
-
|
GCGR
|
Metabolic Disease
|
A8SGLP-1 TFA is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 TFA reduces blood glucose in db/db mice without affecting its function .
|
-
- HY-P5820
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
-
- HY-P2535
-
|
GLP Receptor
|
Metabolic Disease
|
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
|
-
- HY-P5802
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin FVIA is an N-type Ca 2+channel (Ca v 2.2)
inhibitor. ω-Conotoxin FVIA reduces mechanical and thermal pain abnormalities
in a rat model of caudal nerve injury. ω-Conotoxin FVIA can be used in the
study of highly effective pain relievers with low side effects
.
|
-
- HY-P5805
-
-
- HY-P0069
-
AM-111; XG-102
|
JNK
|
Others
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
-
- HY-P4841
-
|
GLP Receptor
|
Others
|
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding to the 7-36 sequence of GLP-1.
|
-
- HY-P5804
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin CVIF is a selective Cav2.2 channel inhibitor with an IC50 of 34.3 nM in rat isolated DRG neurons. ω-Conotoxin CVIF block of Cav2.2 channels is weakly reversible .
|
-
- HY-P1231
-
-
- HY-P1065A
-
|
HIV
Apelin Receptor (APJ)
|
Infection
Cardiovascular Disease
Metabolic Disease
|
Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ .
|
-
- HY-P0189A
-
-
- HY-P2497
-
|
GCGR
|
Neurological Disease
|
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats .
|
-
- HY-P0199
-
-
- HY-P1537
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
Endocrinology
|
Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4.
|
-
- HY-P1145
-
HuGLP-1
|
GCGR
|
Metabolic Disease
|
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
|
-
- HY-P1145A
-
HuGLP-1 TFA
|
GCGR
|
Metabolic Disease
|
Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.
|
-
- HY-P2231A
-
MEDI0382 acetate
|
GCGR
|
Metabolic Disease
|
Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide acetate can be used in the research of obesity and type 2 diabetes (T2D) .
|
-
- HY-P3366
-
XW003
|
GCGR
|
Metabolic Disease
|
Ecnoglutide (XW003) is a long-acting, cAMP-biased glucagon-like peptide 1 (GLP-1) receptor agonist. Ecnoglutide can be used for research of T2DM and obesity .
|
-
- HY-P2231
-
MEDI0382
|
GCGR
|
Metabolic Disease
|
Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D) .
|
-
- HY-P4060
-
-
- HY-P5815
-
Glucagon-like Peptide 1 (1-36) amide (human, rat)
|
GLP Receptor
GCGR
|
Metabolic Disease
|
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)
) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells .
|
-
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
-
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
-
- HY-P0014
-
-
- HY-P1858
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
-
- HY-P1858A
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
-
- HY-P3019
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with Ki values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion .
|
-
- HY-P3365
-
|
Bacterial
|
Inflammation/Immunology
Cancer
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory .
|
-
- HY-P5450
-
|
PDK-1
|
Others
|
PDKtide is a biological active peptide. (This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).)
|
-
- HY-107528
-
|
β-catenin
GSK-3
|
Cancer
|
FRATtide is a peptide derived from the GSK-3 binding protein that inhibits the phosphorylation of Axin and β-catenin. FRATtide inhibits GSK-3 binding to Axin .
|
-
- HY-P5786
-
-
- HY-P5815A
-
Glucagon-like Peptide 1 (1-36) amide (human, rat) (TFA)
|
GLP Receptor
GCGR
|
Metabolic Disease
|
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)
) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells .
|
-
- HY-P0014S2
-
|
Isotope-Labeled Compounds
|
Others
|
Liraglutide- 13C6, 15N (TFA)is the 13C and 15N labeledLiraglutide(HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
-
- HY-13443
-
Exenatide
|
GCGR
|
Metabolic Disease
|
Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
-
- HY-13443A
-
Exenatide acetate
|
GCGR
|
Metabolic Disease
|
Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
-
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P2282
-
|
STAT
|
Cancer
|
APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity .
|
-
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
-
- HY-P2542
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo .
|
-
- HY-P1440A
-
|
Potassium Channel
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
-
- HY-P1440
-
-
- HY-P0014S
-
-
- HY-P4790
-
|
PI3K
Akt
|
Metabolic Disease
|
Acetyl-Exenatideyes is an acetylated derivative of Exenatide. Exenatide has the function similar to insulin, which can be used for research of type 2 diabetes. Exenatide can promote Th17 differentiation, inhibits Tregs differentiation, downregulates PI3K/Akt/FoxO1 phosphorylation .
|
-
- HY-P4386
-
|
GLP Receptor
|
Metabolic Disease
|
(Asp28)-Exenatide is a degradation product of exenatide (HY-13443). (Asp28)-Exenatide can be used as a GLP-1R agonist .
|
-
- HY-P4856
-
|
PKC
|
Endocrinology
|
pTH-Related Protein (1-40) (human, mouse, rat) stimulates calcium uptake in rat intestinal cells through PTHR1 receptor and PKCα/β signaling pathways. pTH-Related Protein (1-40) up-regulates parathyroid hormone 1 receptor (PTHR1) protein, four transcellular calcium transporters, potential vanillin member 6 (TRPV6), calcium-binding protein-D9K (CaBP-D9k), sodium-calcium Exchanger 1 (NCX1) and plasma membrane calcium ATPase 1 (PMCA1) .
|
-
- HY-P0014S1
-
|
Isotope-Labeled Compounds
|
Others
|
Liraglutide- 13C5, 15N (tetraTFA)is the 13C and 15N labeledLiraglutide(HY-P0014) . Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
-
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
-
- HY-P5809
-
-
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
-
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
-
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
-
- HY-P0276
-
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
-
- HY-P1533
-
-
- HY-P1533A
-
-
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P1282
-
-
- HY-P0276A
-
Gastric Inhibitory Peptide (GIP), human TFA
|
Insulin Receptor
|
Metabolic Disease
|
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
-
- HY-P3580
-
Human N-acetyl GIP
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P3584
-
(Pro3) Gastric Inhibitory Peptide, human
|
Insulin Receptor
|
Metabolic Disease
|
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes .
|
-
- HY-P3580A
-
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
-
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
-
- HY-P1434
-
|
Insulin Receptor
|
Metabolic Disease
|
[Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50: 2.6 μM). [Pro3]-GIP (Mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (Mouse) can be used for research of type 2 diabetes .
|
-
- HY-P3247
-
|
Insulin Receptor
|
Neurological Disease
Metabolic Disease
|
[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc
|
-
- HY-P5563
-
|
Bacterial
|
Infection
|
PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive bacteria, E.coli (MIC: 73.3 uM), B. subtilis (MIC: 23.3 uM), S. aureus (MIC: 13 uM), S. lutea (MIC: 16.7 uM), and B. pumilu (MIC: 23.3 uM) .
|
-
- HY-P3491
-
PEX 168
|
GLP Receptor
|
Metabolic Disease
|
Pegloxenatide is a glucagon-like peptide-1 receptor (GLP-1 RA) agonist. Pegloxenatide can be used for type 2 diabetes research .
|
-
- HY-P3584A
-
(Pro3) Gastric Inhibitory Peptide, human TFA
|
Insulin Receptor
|
Metabolic Disease
|
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes .
|
-
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-P0119
-
|
GCGR
MEK
Akt
MMP
JNK
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe −/− Irs 2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation .
|
-
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
-
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P5161A
-
|
GCGR
|
Metabolic Disease
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
-
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
-
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
-
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
-
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
-
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
-
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P1731
-
LY3298176
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide (LY3298176) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
-
- HY-P1731B
-
LY3298176 hydrochloride
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide hydrochloride (LY3298176 hydrochloride) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide hydrochloride has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
-
- HY-P1731A
-
LY3298176 TFA
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide TFA (LY3298176 hydrochloride) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide TFA has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
-
- HY-P3255
-
-
- HY-P3506
-
LY3437943
|
GCGR
GLP Receptor
|
Metabolic Disease
|
Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide can be used for the research of obesity .
|
-
- HY-P3506A
-
LY3437943 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
Retatrutide (LY3437943) TFA is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide TFA binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide TFA can be used for the research of obesity .
|
-
- HY-P10018
-
SAR425899
|
GLP Receptor
GCGR
|
Metabolic Disease
|
Bamadutide (SAR425899) is a potent dual glucagon-like peptide-1 receptor/glucagon receptor agonist. Bamadutide (SAR425899) improves postprandial glucose control by significantly enhancing β-cell function and slowing glucose absorption rate in vivo. Bamadutide (SAR425899)can be used for type 2 diabetes research .
|
-
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
-
- HY-P5818
-
-
- HY-P2312
-
HβD-3
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml .
|
-
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
-
- HY-P5824
-
-
- HY-P5808A
-
-
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
-
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
-
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
-
- HY-P4976
-
-
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
-
- HY-P3479
-
-
- HY-P5551
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells .
|
-
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P5063
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P5064
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide that was first isolated from the porcine hypothalamus. Galanin-Like Peptide (porcine) has a high affinity for the GALR2 receptor (IC50 of 0.24 nM) and a lower affinity for the GALR1 receptor (IC50 of 4.3 nM) .
|
-
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
-
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
-
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
-
- HY-108814
-
DX-88
|
Ser/Thr Protease
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
-
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
-
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
-
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
-
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
-
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
-
- HY-P0240
-
-
- HY-P0240A
-
-
- HY-P5244
-
-
- HY-P5248
-
-
- HY-P4684
-
PTHRP (107–111)
|
PTHR
|
|
Osteostatin, a fragment of parathyroid hormone-related protein (PTHrP) 107-111, promotes bone repair in animal models of bone defects and prevents bone erosion in inflammatory arthritis, inhibits collagen-induced arthritis and inhibits osteoclastic bone resorption directly. Osteostatin can be used for inflammation and immunology research .
|
-
- HY-P0226
-
-
- HY-101297
-
Z-IE(OMe)TD(OMe)-FMK
|
Caspase
|
Cancer
|
Z-IETD-FMK (Z-IE(OMe)TD(OMe)-FMK) is a selective and cell permeable caspase-8 inhibitor . Z-IETD-FMK is also a granzyme B inhibitor .
|
-
- HY-P2518
-
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
Protease-Activated Receptor-1, PAR-1 Agonist is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
-
- HY-P2518A
-
|
Protease Activated Receptor (PAR)
|
Cancer
|
Protease-Activated Receptor-1, PAR-1 Agonist TFA is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist TFA corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
-
- HY-P4798
-
Human PTHRP(107-111) amide
|
PTHR
|
Others
|
Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) (Human PTHrP (107-111) amide) is a C-terminal parathyroid hormone-related protein fragment that can inhibit bone resorption .
|
-
- HY-P4279
-
-
- HY-P5702
-
|
Bacterial
Apoptosis
Fungal
|
Infection
|
EP3 is an antimicrobial peptide. EP3 has antibacterial and antifungal activities. EP3 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 12.85 μg/mL. EP3 also shows antitumor activity against cancer cells, and induces cell apoptosis .
|
-
- HY-113963
-
|
Apoptosis
|
Cancer
|
Ac-?IETD-?CHO is a potent, reversible inhibitor of granzyme B and caspase-8. Ac-?IETD-?CHO inhibits Fas-mediated apoptotic cell death, hemorrhage, and liver failure. Ac-?IETD-?CHO also inhibits cytotoxic T lymphocytes induced cell death .
|
-
- HY-P10082
-
|
Caspase
|
Others
|
Ac-VETD-AMC is a synthetic peptide substrate for caspase 8. Ac-VETD-AMC also has potential to assess functional activity of recombinant phytaspase .
|
-
- HY-P10146
-
|
Caspase
|
Cancer
|
Ac-LETD-CHO
is a caspases 8 inhibitor. Ac-LETD-CHO has specific inhibition to casp-8 with
an IC50 value of 6.71 nM. Ac-LETD-CHO
can be used for the research of anticancer .
|
-
- HY-P0318
-
-
- HY-P1599
-
|
Opioid Receptor
|
Neurological Disease
Cancer
|
Valorphin is an endogenous hemoglobin β-chain (33-39) fragment with opioid analgesic activity, binds to rat mu-opioid receptor, with an IC50 of 14 nM; Valorphin also shows anti-tumor activity.
|
-
- HY-P0141
-
|
Akt
|
Others
|
Akt/SKG Substrate Peptide is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or
MAPK1 .
|
-
- HY-P0141A
-
|
Akt
|
Others
|
Akt/SKG Substrate Peptide TFA is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or MAPK1 .
|
-
- HY-P1044
-
LVV-hemorphin-4
|
Others
|
Neurological Disease
|
Spinorphin is an inhibitor of enkephalin-degrading enzymes. Spinorphin inhibits aminopeptidase, dipeptidyl aminopeptidase III, angiotensin-converting enzyme and enkephalinase. Spinorphin possesses an antinociceptive effect .
|
-
- HY-P1319
-
|
Opioid Receptor
|
Inflammation/Immunology
|
Nociceptin (1-7) is the N-terminal bioactive fragment of nociceptin (HY-P0183). Nociceptin (1-7) is a potent ORL1 (NOP) receptor agonist with antinociceptive activity. Nociceptin (1-7) combines with nociceptin reduces hyperalgesia in vivo .
|
-
- HY-P1319A
-
|
Opioid Receptor
|
Inflammation/Immunology
|
Nociceptin (1-7) TFA is the N-terminal bioactive fragment of nociceptin (HY-P0183). Nociceptin (1-7) TFA is a potent ORL1 (NOP) receptor agonist with antinociceptive activity. Nociceptin (1-7) TFA combines with nociceptin reduces hyperalgesia in vivo .
|
-
- HY-P4082
-
HER2-binding peptide
|
EGFR
|
Cancer
|
ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research .
|
-
- HY-P5360
-
-
- HY-P1452A
-
|
Bacterial
|
Infection
|
RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
|
-
- HY-P1778
-
|
HPV
|
Infection
|
HPV16 E7 (86-93) is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) is immunogenic in cervical carcinomas .
|
-
- HY-P1816
-
|
Integrin
|
Cancer
|
The connecting segment 1 (CS-1) is a cell attachment domain located in the type III homology connecting segment (IIICS) of fibronectin. Fibronectin CS1 Peptide lacks the Arg-Gly-Asp-containing domain, actively inhibits tumor metastases in spontaneous and experimental metastasis models .
|
-
- HY-P1778A
-
|
HPV
|
Infection
|
HPV16 E7 (86-93) TFA is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) TFA is immunogenic in cervical carcinomas .
|
-
- HY-P1077
-
|
mGluR
Phosphodiesterase (PDE)
Apoptosis
Calmodulin
|
Inflammation/Immunology
|
CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca 2+-binding site. CALP1 blocks calcium influx and apoptosis (IC50 of 44.78 µM) through inhibition of calcium channel opening. CALP1 blocks glutamate receptor channels and blocks a store-operated nonselective cation channel. CALP1 activates CaM-dependent phosphodiesterase activity .
|
-
- HY-P1077A
-
|
mGluR
Phosphodiesterase (PDE)
Apoptosis
Calmodulin
|
Inflammation/Immunology
|
CALP1 TFA is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca 2+-binding site. CALP1 TFA blocks calcium influx and apoptosis (IC50 of 44.78 µM) through inhibition of calcium channel opening. CALP1 TFA blocks glutamate receptor channels and blocks a store-operated nonselective cation channel. CALP1 TFA activates CaM-dependent phosphodiesterase activity .
|
-
- HY-P2521
-
|
Influenza Virus
|
Infection
Inflammation/Immunology
|
NS2 (114-121), Influenza, the 114-121 fragment of influenza nonstructural protein 2 (NS2), is a influenza-derived epitope. NS2 (114-121), Influenza can be used for the research of CD8 + cytotoxic T lymphocyte (CTL) in antiviral immune responses .
|
-
- HY-P3342
-
|
PD-1/PD-L1
Apoptosis
|
Inflammation/Immunology
|
[D-Leu-4]-OB3 inhibits expressions of pro-inflammatory, proliferative and metastatic genes and PD-L1 expression. [D-Leu-4]-OB3 stimulates expression of pro-apoptotic genes .
|
-
- HY-P5225
-
|
PGC-1α
|
Others
|
Acetyl hexapeptide-38 is a bioactive peptide with upregulate adipogenesis effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P5253
-
-
- HY-P5737
-
|
Bacterial
|
Infection
|
ASP-1 is a strong antistaphylococcal peptide with minimum inhibitory concentrations (MICs) of the purified peptide against S. aureus and methicillin-resistant S. aureus (MRSA) ranged from 2 μg/mL to 64 μg/mL .
|
-
- HY-P10113
-
|
STAT
|
Cancer
|
STAT3-IN-23 (PY*LKTK) is a potent STAT3 inhibitor .
|
-
- HY-P10177
-
|
Opioid Receptor
|
Neurological Disease
|
Acetalin-3 (Ac-RFMWMT-NH2), a hexapeptide, is a μ opioid receptor antagonist with high affinity for μ and κ3 opioid receptor, weak affinity for κ1 receptors and no affinity for κ2 receptors .
|
-
- HY-P0323
-
|
Arenavirus
|
Infection
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
-
- HY-P1569
-
|
Arenavirus
|
Inflammation/Immunology
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-P0137
-
|
Influenza Virus
|
Infection
|
CEF1, Influenza Matrix Protein M1 (58-66) is an epitope derived from the matrix protein of the influenza A virus .
|
-
- HY-P1780
-
|
CMV
|
Infection
|
CEF20 is an HLA-A*0201-restricted epitope from cytomegalovirus pp65 (495-503).
|
-
- HY-P1788
-
|
Influenza Virus
|
Infection
|
Influenza A NP(366-374) Strain A/PR/8/35 is an H2-Db-restricted epitope from Influenza A/PR/8/35 nucleoprotein .
|
-
- HY-P1837
-
|
Influenza Virus
|
Infection
|
Influenza HA (518-526) is an H-2K d-restricted epitope of the influenza virus hemagglutinin comprised amino acids 533 to 541 .
|
-
- HY-P1907
-
|
HPV
|
Cancer
|
Human Papillomavirus (HPV) E7 protein (49-57) is the H-2 d-restricted human papillomavirus (HPV) E749-57 epitope (short peptide spanning the 49th to 57th amino acid residues in the E7 protein) .
|
-
- HY-P1569A
-
|
Arenavirus
|
Inflammation/Immunology
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-P2456
-
|
p38 MAPK
|
Others
|
MBP MAPK Substrate is used as an exogenous substrate for MAPK .
|
-
- HY-P2528
-
|
Fluorescent Dye
|
Others
|
Enhanced Green Fluorescent Protein (EGFP) (200-208) is a marker gene product derived from the jellyfish Aequorea Victoria. Enhanced Green Fluorescent Protein (EGFP) (200-208) is a common reporter protein and is easy to detect .
|
-
- HY-P1911
-
|
EBV
|
Infection
|
CEF27, Epstein-Barr Virus BRLF-1 lytic 148-156 corresponding to amino acids 148-156 of the BRLF1 protein. BRLF1 is a transcriptional activator that binds directly to a GC-rich motif present in some Epstein-Barr virus (EBV) lytic gene promoters .
|
-
- HY-105436
-
-
- HY-P5439
-
|
PKC
|
Others
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P5470
-
|
EBV
|
Others
|
LMP2A (426-434) is a biological active peptide. (HLA A2.1-restricted epitope from Epstein-Barr Virus latent membrane protein LMP2 (426-434).)
|
-
- HY-P5475
-
|
EBV
|
Others
|
BMLF1 (280–288) is a biological active peptide. (HLA A2.1-restricted epitope from Epstein-Barr Virus lytic protein BMLF1 (280-288).)
|
-
- HY-P5881
-
|
PKC
|
Cardiovascular Disease
|
PKCα (C2-4) inhibitor peptide is a PKCα‐specific inhibitor peptide that blocks the inhibition of IKr by the α1A‐adrenoreceptor agonist A-61603 (HY-101366) .
|
-
- HY-P5888
-
Myr‐PKCɛ-
|
PKC
|
Inflammation/Immunology
|
PKCε inhibitor peptide,myristoylated (Myr‐PKC?-) is a cell permeable myristic acid conjugated PKC? peptide inhibitor that attenuates NO release in cultured human umbilical vein endothelial cells (HUVECs) .
|
-
- HY-P5988
-
|
PKC
|
Cancer
|
N-myristoyl-RKRTLRRL inhibits binding of PKC substrates. N-myristoyl-RKRTLRRL inhibits Ca 2+- and phosphatidylserine (PS)-dependent histone phosphorylation with IC50 of 5 μM.? histone phosphorylation with IC50 of 80 μM .
|
-
- HY-P10085
-
|
PKC
|
Inflammation/Immunology
|
PKC-ε translocation inhibitor peptide is a PKC-ε translocation inhibitor. PKC-ε translocation inhibitor peptide can regulate the rate of FcγR-mediated internalization of opsonized beads, has no effect of FcαR trafficking .
|
-
- HY-P0304
-
|
Influenza Virus
|
Infection
|
CEF4 is a peptide that corresponds to aa 342-351 of the influenza A virus nucleocapsid protein.
|
-
- HY-P1755
-
|
MDM-2/p53
|
Cancer
|
p53 (17-26) is amino acids 17 to 26 fragment of p53. p53 (17-26) is mdm-2-binding domain .
|
-
- HY-P1883A
-
|
Fluorescent Dye
|
Infection
|
Bacterial Sortase Substrate III, Abz/DNP TFA is an internally quenched fluorescent peptide substrate. Staphylococcus aureus transpeptidase sortase A (SrtA) reacts with its native substrate Bacterial Sortase Substrate III, Abz/DNP, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this substrate can be monitored at Ex/Em=320 nm/420 nm.
|
-
- HY-P1883
-
|
Fluorescent Dye
|
Infection
|
Bacterial Sortase Substrate III, Abz/DNP is an internally quenched fluorescent peptide substrate. Staphylococcus aureus transpeptidase sortase A (SrtA) reacts with its native substrate Bacterial Sortase Substrate III, Abz/DNP, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this substrate can be monitored at Ex/Em=320 nm/420 nm.
|
-
- HY-P3828
-
|
Fluorescent Dye
|
Neurological Disease
|
Biotin-myelin basic protein (94-102) is a peptide fragemt. Myelin basic protein is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin, it plays an important role in the process of myelination of nerves in the nervous system. Myelin basic protein also acts as a membrane actin-binding protein, which might allow it to participate in transmission of extracellular signals to the cytoskeleton in oligodendrocytes and tight junctions in myelin .
|
-
- HY-P5044
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (45-54) (human) is the 45-54 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) .
|
-
- HY-P3199
-
|
PKC
|
Inflammation/Immunology
|
PKCβII Peptide Inhibitor I is a PKCβII inhibitor. PKCβII Peptide Inhibitor I shows cardioprotective effects in rat cardiac Ischemia/reperfusion injury model. PKCβII Peptide Inhibitor I also prevents vascular endothelial dysfunction .
|
-
- HY-P10036
-
|
PKG
|
Others
|
G-Subtide is a G-substrate peptide localized in Purkinje cells of the cerebellum. G-Subtide has little activity distinct from background and is a preferentially phosphorylated peptide substrate of recombinant PfPKG2 protein .
|
-
- HY-P10098
-
|
PKA
|
Cancer
|
PKA Substrate is a potent and selective substrate peptide of PKA that can be used to detect PKA activity .
|
-
- HY-P10201
-
|
STAT
|
Cancer
|
Ac-GpYLPQTV-NH2 is a STAT3 inhibitor with an IC50 value of 0.33 μM. Ac-GpYLPQTV-NH2 has antitumor activity .
|
-
- HY-P0328
-
|
VSV
|
Infection
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
-
- HY-P0241
-
-
- HY-P0315
-
|
Akt
|
Others
|
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
|
-
- HY-P0197
-
Substance K; Neurokinin α; Neuromedin L
|
Neurokinin Receptor
|
Neurological Disease
Endocrinology
|
Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues .
|
-
- HY-P0150
-
-
- HY-P0197A
-
Substance K TFA; Neurokinin α TFA; Neuromedin L TFA
|
Neurokinin Receptor
|
Neurological Disease
Endocrinology
|
Neurokinin A TFA (Substance K TFA), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues .
|
-
- HY-P4190
-
|
GnRH Receptor
|
Endocrinology
|
FSH receptor-binding inhibitor fragment(bi-10) is a potent FSH antagonist. FSH receptor-binding inhibitor fragment(bi-10) blocks the binding of FSH to FSHR, and alteres FSH action at the receptor level. FSH receptor-binding inhibitor fragment(bi-10) results in the suppression of ovulation and causes follicular atresia of mice. FSH receptor-binding inhibitor fragment(bi-10) has the potential for utilizing to restrain the carcinogenesis of ovarian cancer by down-regulating overexpression of FSHR and ERβ in the ovaries .
|
-
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-P1129
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
-
- HY-P5896
-
-
- HY-P5909
-
-
- HY-P5909F
-
|
Keap1-Nrf2
|
Others
|
FITC-labelled Keap1-Nrf2 probe is aFITC-labeled Keap1-Nrf2 probe (HY-P5909).
|
-
- HY-P10202
-
|
STAT
|
Cancer
|
5-FAM-GpYLPQTV-NH2 is a fluorescently labeled peptide and has STAT3 inhibitory activity. 5-FAM-GpYLPQTV-NH2 can be used in cancer research .
|
-
- HY-A0190
-
-
- HY-P0317
-
-
- HY-P1773A
-
Insulin-like Growth Factor I (30-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I). IGF-I is partly responsible for systemic GH activities although it possesses a wide number of own properties (anabolic, antioxidant, anti-inflammatory and cytoprotective actions) .
|
-
- HY-P2297
-
-
- HY-P2297A
-
-
- HY-P1198A
-
|
Neurokinin Receptor
|
Neurological Disease
|
Hemokinin 1, human TFA is a selective tachykinin neurokinin 1 (NK1) receptor full agonist. Hemokinin 1, human TFA is a full agonist at NK2 and NK3 receptor. Hemokinin 1, human TFA can produces an opioid-independent analgesia .
|
-
- HY-P2054
-
|
HIV Protease
|
Infection
|
Mvt-101 is a hexapeptide-based inhibitor of HIV-1 protease. Mvt-101 is also reduced-peptide-bond inhibitor. Mvt-101 inhibits reproduction of the HIV virus by blocking protease action .
|
-
- HY-P3929A
-
|
PKA
|
Cancer
|
PKI (14-24)amide TFA is a potent PKA inhibitor. PKI (14-24)amide strongly inhibited cyclic AMP-dependent protein kinase activity in the cell homogenate .
|
-
- HY-P5041
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (34-45) (human) is the 34-45 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a Parkinson's disease (PD) biomarker .
|
-
- HY-P4992
-
|
Somatostatin Receptor
|
Cancer
|
Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) is a somatostatin agonist that can be used in cancer research .
|
-
- HY-P0225
-
Autocamtide II
|
CaMK
Autophagy
|
Neurological Disease
|
Autocamtide 2 is a highly selective peptide substrate of calcium/calmodulin-dependent protein kinase II (CaMKII). It can be used in the CaMKII activity assay.
|
-
- HY-P1337
-
-
- HY-P1774
-
|
HBV
|
Infection
|
Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
|
-
- HY-P1337A
-
-
- HY-P2548
-
|
EGFR
|
Others
|
pp60 (v-SRC) Autophosphorylation Site, Phosphorylated is the phosphorylated peptide of an EGFR substrate. pp60 (v-SRC) Autophosphorylation Site, Phosphorylated can be used for the screening of EGFR Kinase inhibitors via phosphorylated-substrate quantification .
|
-
- HY-P4133
-
|
ERK
MEK
|
Cancer
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable .
|
-
- HY-P4072
-
|
PD-1/PD-L1
|
Cancer
|
(D)-PPA 1 is a hydrolysisresistant d-peptide antagonist. (D)-PPA 1 serves as a potent PD-1/PD-L1 inhibitor. (D)-PPA 1 binds to PD-1 with the affinity 0f 0.51 μM with in vitro and in vivo efficacy .
|
-
- HY-P5190S
-
-
- HY-P4072A
-
|
PD-1/PD-L1
|
Cancer
|
(D)-PPA 1 TFA is a hydrolysisresistant d-peptide antagonist. (D)-PPA 1 TFA serves as a potent PD-1/PD-L1 inhibitor. (D)-PPA 1 TFA binds to PD-1 with the affinity 0f 0.51 μM with in vitro and in vivo efficacy .
|
-
- HY-P2112
-
DOTA-Nal3-octreotide
|
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging .
|
-
- HY-P1755F
-
-
- HY-P5440
-
|
ERK
|
Others
|
ERKtide is a biological active peptide. (ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.)
|
-
- HY-P5258
-
|
EGFR
|
Metabolic Disease
|
Oligopeptide-41 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P10051
-
|
Ras
Raf
|
Cancer
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
-
- HY-P10131
-
|
FAP
|
Cancer
|
3BP-3940 is a highly potent fibroblast activation protein (FAP)-targeting peptide for theranostics. 3BP-3940 is often coupled with radionuclides for tumor diagnosis and treatment .
|
-
- HY-P1528
-
-
- HY-P1597
-
|
PKA
PKC
|
Cancer
|
Malantide is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts . Malantide is also an efficient substrate for PKC with a Km of 16 μM .
|
-
- HY-P1597A
-
|
PKA
PKC
|
Cancer
|
Malantide TFA is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide TFA is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts . Malantide TFA is also an efficient substrate for PKC with a Km of 16 μM .
|
-
- HY-P1233A
-
|
Motilin Receptor
|
Metabolic Disease
|
ANQ-11125 TFA is a potent and selective antagonist of motilin, with the pKd of 8.24. ANQ-11125 TFA blocks motilide-induced contractions in vitro in the rabbit .
|
-
- HY-P0118A
-
P144 TFA
|
TGF-beta/Smad
PI3K
Apoptosis
|
Cancer
|
Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis inducer .
|
-
- HY-P1317A
-
|
Opioid Receptor
|
Neurological Disease
|
Nociceptin (1-13), amide TFA is a potent ORL1 receptor (opioid receptor-like 1 receptor, OP4) agonist with a pEC50 of 7.9 for mouse vas deferens and a Ki of 0.75 nM for binding to rat forebrain membranes .
|
-
- HY-P4136
-
|
ERK
|
Cancer
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM .
|
-
- HY-P5461
-
|
Bacterial
|
Others
|
CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
|
-
- HY-P5480
-
|
Keap1-Nrf2
|
Others
|
Keap1-Nrf2-IN-16 is a biological active peptide. (KEAP1 binding activity)
|
-
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
-
- HY-P4979
-
|
Biochemical Assay Reagents
|
Cancer
|
Cdc25A (80-93) (human) is a polypeptide that controls the cell proliferation and tumorigenesis by a change in expression of proteins involved in cyclin D1 regulation and G1/S transition. Cdc25A (80-93) (human) can be used in cancer research .
|
-
- HY-P1962
-
[Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)
|
Beta-secretase
|
Neurological Disease
|
β-Secretase inhibitor ([Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)) is a β-secretase and BACE1 inhibitor (IC50: 25 nM for β-secretase) .
|
-
- HY-P5998
-
|
Myosin
|
Cancer
|
Myosin Light Chain Kinase Substrate (smooth muscle) is a smooth muscle myosin light chain kinase (MLCK) synthetic peptide substrate .
|
-
- HY-163422S
-
-
- HY-P0271
-
|
CaMK
Autophagy
|
Neurological Disease
|
Syntide 2, a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected .
|
-
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P1164
-
-
- HY-P1164A
-
-
- HY-P0271A
-
|
CaMK
|
Neurological Disease
|
Syntide 2 (TFA), a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected .
|
-
- HY-P2161A
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 TFA is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 TFA is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 TFA depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P2547
-
|
Src
|
Others
|
Tyrosine Kinase Peptide 1 is a control substrate peptide for c-Src assay .
|
-
- HY-P2161
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P2161B
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 acetate is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 acetate is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 acetate depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
-
- HY-P5564
-
|
Fungal
|
Infection
|
BTL peptide is an antifungal peptide. BTL peptide is active against B. maydis, A. brassicae, A. niger and C. personata .
|
-
- HY-P4773
-
|
HSV
|
Infection
|
HSV-1 Protease substrate is a peptide substrate for HSV-1 (Herpes Simplex Virus Type 1) protease, and the specificity constant (kcat/Km) at pH 7.5 for cleavage is 5.2 M -1 s -1 .
|
-
- HY-P5201S1
-
|
Isotope-Labeled Compounds
|
Others
|
VTSEGAGLQLQK- 13C6, 15N2 (TFA) is the 13C- and 15N-labeled VTSEGAGLQLQK. VTSEGAGLQLQK is an amino acid sequence in the C-terminal region of recombinant human alpha-acid glucosidase (rhGAA), which can be used to bind anti-drug antibodies in plasma and quantitatively analyze the therapeutic effect .
|
-
- HY-P5969
-
-
- HY-P5977
-
Ste-MPKKKPTPIQLNP-NH₂; ERK Activation Inhibitor Peptide
|
ERK
|
Cancer
|
STE-MEK1(13) (Ste-MPKKKPTPIQLNP-NH?) is a cell permeable ERK1/2 inhibitor (IC50: 13-30?μM). STE-MEK1(13) inhibits ERK1/2 phosphorylation .
|
-
- HY-P10105
-
|
Akt
Apoptosis
|
Cancer
|
TCL1(10-24) is a encompassing the betaA strand of human TCL1. TCL1(10-24) is a Akt inhibitor. TCL1(10-24) interacts with the Akt PH domain prevented phosphoinositide binding and hence inhibits membrane translocation and activation of Akt. TCL1(10-24) inhibits cellular proliferation and anti-apoptosis. TCL1(10-24) has tumor growth in vivo .
|
-
- HY-P10148
-
Ac-[Leu28,31]-NPY (24-36)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) is a selective agonist of neuropeptide Y Y2 receptor. N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) attenuates cardiac vagal action in anaesthetised rats .
|
-
- HY-P1026
-
-
- HY-P1578
-
-
- HY-P1578A
-
-
- HY-P1202
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
-
- HY-P1202A
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806 TFA, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
-
- HY-P1818
-
-
- HY-P2295
-
|
SARS-CoV
|
Others
|
Dabcyl-KTSAVLQSGFRKME-Edans TFA is a fluorogenic peptide. Dabcyl-KTSAVLQSGFRKME-Edans TFA is used as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKME-Edans TFA has the potential for study 2019-nCoV (COVID-19) infection .
|
-
- HY-P1382
-
|
Ras
|
Cancer
|
Rac1 Inhibitor W56 is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
-
- HY-P1382A
-
|
Ras
|
Cancer
|
Rac1 Inhibitor W56 TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 TFA inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
-
- HY-106258
-
OHM 11638; BAX-ACC 1638; MOT 288
|
Motilin Receptor
|
Metabolic Disease
|
OHM 11638 (Atilmotin), an analogue of the (1-14) fragment of porcine motilin, is a motilin receptor agonist with a pKd of 8.94 for the motilin receptor. OHM 11638 affects esophageal, lower esophageal sphincter (LES), and gastric motility. OHM 11638 increases LES and gastric pressures, OHM 11638 can be used as prokinetic agents .
|
-
- HY-P0183
-
-
- HY-P1586
-
HIV-1 rev Protein (34-50)
|
HIV
|
Infection
|
HIV-1 Rev (34-50) is a 17-aa peptide derived from the Rev-responsive element (RRE)-binding domains of Rev in HIV-1, with anti-HIV-1 activity.
|
-
- HY-P1110
-
AF12198
1 Publications Verification
|
Interleukin Related
|
Inflammation/Immunology
|
AF12198 is a potent, selective and specific peptide antagonist for human type I interleukin-1 receptor (IL1-R1) (IC50=8 nM) but not the human type II receptor (IC50=6.7 µM) or the murine type I receptor (IC50>200 µM). AF12198 inhibits IL-1-induced IL-8 production (IC50=25 nM) and IL-1-induced intercellular adhesion molecule-1 (ICAM-1) expression (IC50=9 nM) in vitro. AF12198 has anti-inflammatory activities and blocks responses to IL-1 in vivo .
|
-
- HY-P3689
-
|
CGRP Receptor
Adenylate Cyclase
|
Others
|
[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat is a fragments 22-37 of rat calcitonin gene related peptide (CGRP), targeting CGRP receptor and adenylate cyclase. Calcitonin is mainly produced by thyroid C cells while CGRP is secreted and stored in the nervous system .
|
-
- HY-P1674
-
POL7080
|
Bacterial
Antibiotic
|
Infection
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
-
- HY-P4735
-
-
- HY-P5549
-
|
Bacterial
Fungal
|
Infection
|
Hb 98-114, the amino acids 98-114 of the alpha subunit of bovine hemoglobin, is an antimicrobial peptide. Hb 98-114 is active against several yeast and filamentous fungi (MIC: 2.1 μM-12.5 μM) .
|
-
- HY-P5571
-
-
- HY-156343S1
-
-
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1212
-
CST-14, human, rat
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, human, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
- HY-P1341
-
Orexin A (17-33) (human, mouse, rat, bovine)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
OXA(17-33) is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
-
- HY-P1341A
-
Orexin A (17-33) (human, mouse, rat, bovine) TFA
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
OXA(17-33) TFA is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) TFA shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
-
- HY-P1118
-
-
- HY-P1118A
-
-
- HY-P3437
-
|
Virus Protease
|
Others
|
Dabcyl-KTSAVLQSGFRKM-Glu(Edans)-NH2 is a fluorogenic peptide, as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKM-Glu(Edans)-NH2 can be used for researching 2019-nCoV (COVID-19) infection.
|
-
- HY-P4469
-
-
- HY-P5885
-
|
PKC
|
Others
|
PKCη pseudosubstrate inhibitor,myristoylated is cell permeable and can be used to study the mechanism of action of PKCη .
|
-
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor comprising 14 amino acid residues. SFTI-1 is a potent Bowman-Birk inhibitor.
|
-
- HY-P10099
-
|
STAT
|
Cancer
|
STAT3-IN-21, cell-permeable, negative control, a peptide, is a negative control for Stat3 activity detection .
|
-
- HY-P0324
-
|
Bacterial
|
Infection
|
Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
|
-
- HY-P0324A
-
|
Bacterial
|
Infection
|
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity .
|
-
- HY-P1932A
-
-
- HY-P5128
-
Satoreotide tetraxetan
|
Somatostatin Receptor
|
Cancer
|
DOTA-JR11 is a somatostatin receptor 2 (SSTR2)antagonist. DOTA-JR11 can be labeled by 68Ga, used for paired imaging in neuroendocrine tumors (NETs) research .
|
-
- HY-P5381
-
|
NADPH Oxidase
|
Others
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
-
- HY-P5444
-
|
Bacterial
|
Others
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
-
- HY-P5556
-
|
Bacterial
|
Infection
|
KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. aeruginosa. .
|
-
- HY-P10047
-
|
PKA
|
Others
|
PKItide exhibits an IC50 of 0.2 μM for cAMP-PK .
|
-
- HY-P1269
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
-
- HY-P1269A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB TFA, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
-
- HY-P2466
-
|
Apoptosis
|
Cancer
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models .
|
-
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P5148
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. α-Conotoxin BuIA can be used to distinguish nAChRs containing β2- and β4-subunit, respectively. α-Conotoxin BuIA distinguishes among αxβ2 nAChRs with a rank order potency of α6>α3>α2>α4 .
|
-
- HY-P5422
-
|
Calcium Channel
|
Others
|
Caloxin 3A1 is a biological active peptide. (This peptide belongs to caloxins, the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP.)
|
-
- HY-P5545
-
|
Bacterial
|
Infection
|
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection .
|
-
- HY-P5949
-
|
Bacterial
|
Infection
|
AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to the bacterial membrane and induces membrane permeabilization. AMPR-22 is effective against murine model of sepsis induced by MDR strains
|
-
- HY-156341S1
-
-
- HY-P10114
-
PpYLKTK-mts; STAT3 PI
|
STAT
|
Cancer
|
STAT3-IN-24, cell-permeable (PpYLKTK-mts) is a STAT3 peptide inhibitor. STAT3-IN-24, cell-permeable inhibits recruitment of STAT3 to Jak2 and phosphorylation of Y705, thus preventing the dimerization and the nuclear translocation of STAT3 .
|
-
- HY-P0262
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Endocrinology
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM) .
|
-
- HY-P1025
-
-
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-P1345
-
|
Complement System
|
Neurological Disease
Endocrinology
|
TLQP-21, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor 1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8 μM). TLQP-21 activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 is used for the research in regulation of nociception and other relevant physiologic functions .
|
-
- HY-P1345A
-
|
Complement System
|
Neurological Disease
Endocrinology
|
TLQP-21 TFA, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8μM). TLQP-21 TFA activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 TFA is used for the research in regulation of nociception and other relevant physiologic functions .
|
-
- HY-P1131
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
M617 is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
-
- HY-P1131A
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
M617 TFA is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617 TFA, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
-
- HY-P4149
-
-
- HY-P0262A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
|
Galantide TFA is a reversible and non-specific galanin (GAL) receptor antagonist. Galantide TFA dose-dependently shows antagonism to galanin-induced K + conductance with an IC50 value of 4 nM. Galantide TFA can be used for the research of neurological disease and hormone metabolism research .
|
-
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
- HY-P5342
-
-
- HY-P5474
-
|
Bacterial
|
Others
|
PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.)
|
-
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
-
- HY-P5546
-
|
Bacterial
|
Infection
|
Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-256 μg/mL for methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection
|
-
- HY-P5011
-
-
- HY-P5616
-
|
Bacterial
|
Infection
|
Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively .
|
-
- HY-P5704
-
|
Bacterial
|
Infection
|
K11 is an antimicrobial peptide. K11 is active against MDR/XDR K. pneumoniae isolates (MIC: 8-512 μg/mL), and inhibits bacterial biofilm formation. K11 can act synergistically with antibiotics (Chloramphenicol (HY-B0239), Meropenem (HY-13678), Rifampicin (HY-B0272), etc.) against drug-resistant K. pneumoniae. K11 has high thermal and wide pH stability .
|
-
- HY-P6010
-
|
Integrin
|
Cancer
|
αvβ6-BP is a selective αvβ6 binding peptide, and can be used for molecular imaging .
|
-
- HY-P1025A
-
-
- HY-P1037
-
|
Motilin Receptor
|
Others
|
Motilin (26-47), human, porcine is an endogenous motilin receptor ligand with Ki and EC50 of 2.3 nM and 0.3 nM in a Chinese hamster ovary cell line.
|
-
- HY-P1541
-
Motilin (canine)
|
Motilin Receptor
|
Metabolic Disease
|
Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
|
-
- HY-P1568
-
Flagellin 22
|
Bacterial
|
Infection
|
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae .
|
-
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P1840
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
Galanin Receptor Ligand M35 is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
-
- HY-P1840A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
-
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P4073
-
GRN1005; Paclitaxel trevatide
|
Antibody-Drug Conjugates (ADCs)
|
Cancer
|
ANG1005 (Paclitaxel trevatide) is a brain-penetrating peptide-drug conjugate. ANG1005, a taxane derivative, consists of three paclitaxel (HY-B0015) molecules covalently linked to Angiopep-2, designed to cross the blood-brain and blood-cerebrospinal barriers and to penetrate malignant cells via low density lipoprotein receptor-related protein (LRP1) transport system .
|
-
- HY-P4222
-
Caspase-8-IN-1
|
Caspase
|
Others
|
IETD-CHO (Caspase-8-IN-1) is a potent caspase-8 inhibitor .
|
-
- HY-P4222A
-
|
Caspase
|
Others
|
IETD-CHO TFA (Caspase-8-IN-1) is a potent caspase-8 inhibitor .
|
-
- HY-106323
-
KW-5139
|
Motilin Receptor
|
Metabolic Disease
|
[Leu13]-Motilin (KW-5139) is a motilin analogue. [Leu13]-Motilin stimulates gastrointestinal motility in the rabbit. [Leu13]-Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro .
|
-
- HY-P5844
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor. α-Conotoxin AuIA is a α-conotoxin that can be isolated from Conus aulicus .
|
-
- HY-P5852
-
Alpha-conotoxin EIIB
|
nAChR
|
Neurological Disease
|
α-Conotoxin EIIB (Alpha-conotoxin EIIB) is a toxin peptide that can be obtained from Conus ermineus. α-Conotoxin EIIB binds to nAChR (Ki=2.2 nM). α-Conotoxin EIIB can be used in the study of neurological diseases such as schizophrenia, drug addiction, Alzheimer's disease, and Parkinson's disease .
|
-
- HY-P1268
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
-
- HY-P1268A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
-
- HY-P1266
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin EI is a selective nicotinic acetylcholine α1β1γδ receptor (nAChR) antagonist (IC50=187 nM) and an α3β4 receptor inhibitor. α-Conotoxin EI can block muscle and ganglionic receptors .
|
-
- HY-P5362
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
- HY-P5362A
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
- HY-P3117
-
Pituitary adenylate cyclase-activating peptide (6-27)
|
Adenylate Cyclase
|
Neurological Disease
|
PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases .
|
-
- HY-P5839
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin MrIC is an α7nAChR biased agonist. α-Conotoxin MrIC exclusively activates α7nAChR regulated by type II positive allosteric modulators, including PNU120596. α-Conotoxin MrIC can be used to study neurological diseases and also to probe the pharmacological properties of α7nAChR .
|
-
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
- HY-P5827
-
-
- HY-P6009
-
|
Integrin
|
Cancer
|
Cys-αvβ6-BP is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P6010A
-
|
Integrin
|
Cancer
|
αvβ6-BP TFA is a selective αvβ6 binding peptide, and can be used for research of molecular imaging .
|
-
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P1184
-
-
- HY-P1184A
-
-
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
-
- HY-P1928
-
|
Bcl-2 Family
|
Neurological Disease
Endocrinology
|
Humanin, an anti-apoptotic peptide of 24 amino acids, is a Bax inhibitor. Humanin prevents the translocation of Bax from cytosol to mitochondria, blocks Bax from the inactive to active conformation. Humanin is a mitochondria-associated peptide with a neuroprotective effect against AD-related neurotoxicity. Humanin also improves overall insulin sensitivity in animal. Humanin are related to aging . Humanin analogue, in which the serine at position 14 is replaced by glycine, names HNG .
|
-
- HY-P3993A
-
14-Glycine-Humanin (human) (acetate)
|
Apoptosis
|
Neurological Disease
|
(Gly14)-Humanin (human) (14-Glycine-Humanin (human)) acetate is an analog of Humanin in which the 14th amino acid serine was replaced with glycine (Gly). (Gly14)-Humanin (human) acetate has anti-apoptotic and neuroprotective functions .
|
-
- HY-P1130
-
Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide
|
Neuropeptide Y Receptor
|
Neurological Disease
|
M871 (Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide) is a selective galanin receptor type 2 (GalR2) antagonist. M871 exhibits Ki values of 13.1 nM and 420 nM for GalR2 and GalR1, respectively. M871 can be used for research on GalR2-related diseases (such as epilepsy, pain) .
|
-
- HY-P5849
-
αA-OIVA
|
nAChR
|
Neurological Disease
|
αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR. αA-Conotoxin OIVA is a peptide that can be derived from conotoxin. αA-Conotoxin OIVA paralyzes muscles .
|
-
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P1480
-
-
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P1328A
-
|
Keap1-Nrf2
|
Others
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P1112
-
-
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
-
- HY-P4210
-
ALRN-6924; MP-4897
|
MDM-2/p53
|
Cancer
|
Sulanemadlin (ALRN-6924) is a potent and cell-permeating p53-based peptidomimetic macrocycles. Sulanemadlin is a inhibitor of the p53-MDM2, p53-MDMX, or both p53 and MDM2 and MDMX protein-protein interactions. Sulanemadlin can be used for cancers research .
|
-
- HY-P4352
-
|
HIV
|
Others
|
HIV-2 Peptide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4805
-
-
- HY-P1190
-
|
JNK
Apoptosis
|
Inflammation/Immunology
|
c-JUN peptide is a cell-permeable c-JUN-JNK interaction inhibitor. c-JUN peptide inhibits serum-induced c-Jun phosphorylation. c-JUN peptide induces apoptosis .
|
-
- HY-P5577
-
-
- HY-P5615
-
|
Bacterial
|
Infection
|
XT-2 peptide is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-2 peptide has strong activity against E.coli, the vaule of MIC is 8 μM .
|
-
- HY-P5641
-
|
Bacterial
|
Infection
|
Pleurocidin is an antibacterial peptide derived from skin secretions of Winter Flounder .
|
-
- HY-P5696
-
|
Bacterial
Parasite
Fungal
|
Infection
|
Xenopsin precursor fragment is an antimicrobial peptide, and has antibacterial/antifungal (10-500 μg/mL) and anti-protozoal (MIC: 2-20 μg/mL) activity .
|
-
- HY-P1011
-
-
- HY-P6009A
-
|
Integrin
|
Cancer
|
Cys-αvβ6-BP TFA is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P1098
-
Ac2-26
3 Publications Verification
|
NF-κB
|
Inflammation/Immunology
|
Ac2-26, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
-
- HY-P1098A
-
|
NF-κB
|
Inflammation/Immunology
|
Ac2-26 TFA, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
-
- HY-P2222
-
-
- HY-P0184A
-
|
NO Synthase
|
Neurological Disease
|
Camstatin TFA, a functionally active 25-residue fragment of PEP-19's IQ motif, binds calmodulin and inhibits neuronal nitric oxide (NO) synthase .
|
-
- HY-P5589
-
PlnA
|
Bacterial
|
Infection
|
Plantaricin A is an antimicrobial peptide derived from LactobacifZus plantarum against bacteria .
|
-
- HY-P5682
-
|
Bacterial
|
Infection
|
Maximin 41 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus (MIC: 75 μg/mL). Maximin 41 has hemolytic activities against human red cells .
|
-
- HY-P1098B
-
|
IKK
|
Inflammation/Immunology
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-P10049
-
|
Akt
|
Cancer
|
TAT-TCL1-Akt-in is an Akt inhibitor .
|
-
- HY-P2222A
-
-
- HY-P1566
-
|
HIV
|
Infection
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
-
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
-
- HY-P2700
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin GIIIB is a 22-residue polypeptide that can be isolated from the venom of piscivorous cone snail Conus geographus. μ-Conotoxin GIIIB is a NaV1.4 channel inhibitor. μ-Conotoxin GIIIB blocks muscle cell's contraction .
|
-
- HY-P10074
-
|
ERK
|
Inflammation/Immunology
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
-
- HY-P0176A
-
PACAP 1-27 TFA
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
PACAP (1-27), human, ovine, rat TFA (PACAP 1-27 TFA) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively .
|
-
- HY-P1135
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
M1145, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 has an additive effect on the signal transduction of galanin .
|
-
- HY-P1135A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
M1145 TFA, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 TFA shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 TFA has an additive effect on the signal transduction of galanin .
|
-
- HY-P5133
-
SSTN92-119
|
Integrin
|
Cancer
|
Synstatin (92-119) is an anti-tumor agent that inhibits angiogenesis and cancer cell invasion. Synstatin (92-119) down-regulates integrin α?β3 and reduces the activation of angiogenic growth factors VEGF and FGF-2 .
|
-
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P5588
-
|
Fungal
|
Infection
|
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5580
-
|
Bacterial
|
Infection
Cancer
|
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (MIC: 1.3, 2.3, 5.0, 2.6, 2.3 μM for S. aureus, P. aeruginosa, P. aeruginosa, E. (ATCC 25922), E. (54127) respectively). Dermaseptin-B3 also inhibits tumor cell proliferation .
|
-
- HY-P5621
-
|
Bacterial
|
Infection
|
Maximin 63 is an antimicrobial peptide derived from the brain of a toad. Maximin 63 has strong activity against S.aureus (MIC: 18.8 μg/mL) .
|
-
- HY-P5685
-
|
Bacterial
|
Infection
|
Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P1339
-
-
- HY-P1349
-
-
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
-
- HY-P1339A
-
-
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
-
- HY-P1340
-
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
[Ala11,D-Leu15]-Orexin B(human) is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
-
- HY-P1340A
-
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
[Ala11,D-Leu15]-Orexin B(human) TFA is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) TFA shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
-
- HY-P4129
-
|
nAChR
|
Others
|
Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide. Rabies Virus Matrix Protein Fragment targets the acetylcholine receptor (AChR) that exists on the cell surface .
|
-
- HY-P5894
-
Galanin-like peptide (3-32)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
human GALP (3-32) (Galanin-like peptide (3-32)) is a potent galanin receptor agonist with high affinity for both GalR1 (IC50=33 nM) and GalR2 (IC50=15 nM) in a competitive binding study. human GALP (3-32) exhibits the high potency in altering the extracellular acidification rate of SH-SY5Y cells transfected with GalR2 (EC50=360 nM) .
|
-
- HY-P5552
-
|
Bacterial
Parasite
Fungal
|
Infection
|
Melimine is a hybrid antimicrobial peptide of Melittin (HY-P0233) and Protamine. Melimine is active against P. aeruginosa and S. aureus. Melimine has broad spectrum activity against bacteria, fungi and protozoa .
|
-
- HY-P10006
-
|
Opioid Receptor
|
Neurological Disease
|
Leumorphin, human is a potent kappa opioid receptor (κ opioid receptor) agonist. Leumorphin, human inhibits the contraction of the myenteric plexus-longitudinal muscle preparation of the guinea pig ileum .
|
-
- HY-P10138
-
-
- HY-P10138A
-
-
- HY-P4385
-
|
PTHR
|
Metabolic Disease
|
(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent PTH-1R antagonist .
|
-
- HY-P5074
-
|
GCGR
|
Metabolic Disease
|
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets .
|
-
- HY-P5724
-
|
Bacterial
|
Infection
|
Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality .
|
-
- HY-P2080
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide,human is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P2080B
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P2317
-
|
Bacterial
Endogenous Metabolite
|
Infection
|
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection .
|
-
- HY-P2541
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
-
- HY-P2541A
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
-
- HY-P0062B
-
-
- HY-P5336
-
-
- HY-P2080C
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30)-Myr is the Myr-modified GIP (1-30), which is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P4966
-
-
- HY-P4858
-
|
GSK-3
|
Cancer
|
C-Peptide 1 (rat), a peptide, is aβ-catenin/GSK-3β activator. C-Peptide 1 (rat) can regulate the Wnt/β-catenin signaling pathway. C-Peptide 1 (rat) can be used for the research of cancer .
|
-
- HY-P10108
-
Hxk2VBD peptide
|
Hexokinase
|
Neurological Disease
|
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth .
|
-
- HY-P1106
-
|
CRFR
|
Cardiovascular Disease
|
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 can be used for hypotension study .
|
-
- HY-P1106A
-
|
CFTR
|
Cardiovascular Disease
|
K41498 TFA is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 TFA is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 TFA can be used for hypotension study .
|
-
- HY-P1107
-
aSvg-30
|
CRFR
|
Neurological Disease
|
Antisauvagine-30 (aSvg-30) is a potent, competitive and selective CRF2 receptor antagonist with Kd values of 1.4 nM and 153.6 nM for mouse CRF2β and rat CRF1 receptors, respectively .
|
-
- HY-P5207
-
|
Bacterial
|
Infection
|
Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P5559
-
|
PROTACs
|
Cancer
|
ND1-YL2 is a PROTAC that selectively degrades SRC-1 via the N-degron pathway. ND1-YL2 significantly inhibits cancer invasion and migration in vitro and in vivo. ND1-YL2 can be used in cancer research .
|
-
- HY-P5828
-
-
- HY-P5864
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
-
- HY-P4700
-
-
- HY-P5825
-
-
- HY-P5799
-
SNX-238
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIID (SNX-238) is a Conus peptide that blocks an ω-Conotoxin-GVIA-sensitive, high-threshold Ca 2+ current in fish retinal ganglion cells .
|
-
- HY-P5803
-
|
Bacterial
|
Infection
|
Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM .
|
-
- HY-P5014
-
-
- HY-P5817
-
|
Sodium Channel
|
Neurological Disease
|
ω-Conotoxin CVIB is a non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs) antagonist. ω-Conotoxin CVIB inhibits depolarization-activated whole-cell VGCC currents in dorsal root ganglion (DRG) neurons with a pIC50 of 7.64 .
|
-
- HY-P10025
-
-
- HY-P1229
-
-
- HY-P0220
-
|
PACAP Receptor
|
Neurological Disease
|
PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
-
- HY-P0220A
-
|
PACAP Receptor
|
Neurological Disease
|
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
-
- HY-P1021A
-
-
- HY-P2311
-
-
- HY-P1294A
-
|
CRFR
|
Neurological Disease
|
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM .
|
-
- HY-P5206
-
|
Bacterial
|
Infection
|
Garvicin KS, GakB is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS, GakB with GakA, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P5714
-
|
Bacterial
|
Infection
|
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain .
|
-
- HY-P1021
-
-
- HY-108742A
-
BA 058 TFA; BIM 44058 TFA
|
Thyroid Hormone Receptor
Arrestin
|
Metabolic Disease
Endocrinology
|
Abaloparatide TFA (BA 058 TFA) is a parathyroid hormone receptor 1 (PTHR1) analogue. Abaloparatide TFA also is a selective PTHR1 activator. Abaloparatide TFA enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide TFA enhances bone formation and cortical structure in mice. Abaloparatide TFA has the potential for the research of osteoporosis .
|
-
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-P0188A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
-
- HY-P2543
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor .
|
-
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P10000
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion .
|
-
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-108742
-
BA 058; BIM 44058
|
Thyroid Hormone Receptor
Arrestin
|
Metabolic Disease
|
Abaloparatide (BA 058) is a parathyroid hormone receptor 1 (PTHR1) analog. Abaloparatide also is a selective PTHR1 activator. Abaloparatide enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide enhances bone formation and cortical structure in mice. Abaloparatide has the potential for the research of osteoporosis .
|
-
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P5143
-
|
Calcium Channel
|
Inflammation/Immunology
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
-
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
-
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
-
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
-
- HY-P5878
-
|
Biochemical Assay Reagents
|
Metabolic Disease
|
RG33 Peptide is a diabetes inhibitor that significantly improves glucose clearance in insulin-resistant mice. RG33 Peptide effectively solubilizes lipid vesicles and promotes cholesterol efflux in cultured macrophages. RG33 Peptide is used in research into type 2 diabetes (T2D) .
|
-
- HY-P5020
-
|
Bacterial
|
Infection
Cancer
|
Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer .
|
-
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
-
- HY-P5822
-
-
- HY-P1601
-
-
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
-
- HY-P2196
-
-
- HY-P4715
-
|
PTHR
|
Endocrinology
|
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand .
|
-
- HY-P5149
-
αC-PrXA
|
nAChR
|
Neurological Disease
|
αC-Conotoxin PrXA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 1.8 nM (α1β1εδ, adult) and 3.0 nM (α1β1γδ, fetal), respectively. αC-Conotoxin PrXA competes with α-bungarotoxin at the α/δ and α/γ subunit interfaces of the nAChR, shows high specificity against neuromuscular nAChR .
|
-
- HY-P5497
-
|
HIV
|
Others
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
-
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
-
- HY-P5942
-
-
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P10158
-
Porcine cathelicidin PMAP-36
|
Bacterial
|
Infection
|
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
|
-
- HY-P1514
-
-
- HY-P0198A
-
-
- HY-P1222
-
|
Bacterial
|
Infection
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P1222A
-
|
Bacterial
|
Infection
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P1513A
-
|
Bacterial
|
Infection
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P0212A
-
|
GCGR
|
Metabolic Disease
|
Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
-
- HY-P1323
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) can increase blood pressure in anesthetized rats and increases food intake .
|
-
- HY-P1323A
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) TFA is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA can increase blood pressure in anesthetized rats and increases food intake .
|
-
- HY-P0208
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
[Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects .
|
-
- HY-P3877
-
-
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively .GrTx1 can be used for neurological disease research .
|
-
- HY-P5836
-
|
Interleukin Related
Bacterial
Enterovirus
|
Inflammation/Immunology
|
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B .
|
-
- HY-P5837
-
|
Interleukin Related
Enterovirus
|
Inflammation/Immunology
|
Citrullinated LL-37 2cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 2cit reduces LL-37 activity against HRV at 10 μg/mL and reduces the antibacterial effect of LL-37. Citrullinated LL-37 2cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B. Citrullinated LL-37 2cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
-
- HY-P5842
-
|
Bacterial
Influenza Virus
|
Infection
|
Citrullinated LL-37 3cit is a host defense peptide (HDP) with broad immunomodulatory and antimicrobial activities. Citrullinated LL-37 3cit exhibits direct antiviral effects against human rhinoviruses (HRV) .
|
-
- HY-P5843
-
|
Enterovirus
|
Infection
|
Citrullinated LL-37 3cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 3cit lacks all antiviral activity at 10 μg/mL and retains some activity against HRV at 30 μg/mL. Citrullinated LL-37 3cit reduces the immunomodulatory activity of LL-37. Citrullinated LL-37 3cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
-
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
-
- HY-P3877A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM .
|
-
- HY-P0052
-
T20; DP178
|
HIV
|
Infection
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P1539
-
-
- HY-P0052A
-
T20 acetate; DP178 acetate
|
HIV
|
Infection
|
Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P0198B
-
-
- HY-P4744
-
|
Bacterial
|
Infection
Cancer
|
LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research .
|
-
- HY-P0221B
-
|
PACAP Receptor
|
Endocrinology
|
PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
-
- HY-P0221C
-
|
PACAP Receptor
|
Endocrinology
|
PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
-
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P2785
-
-
- HY-P3037
-
|
Calcium Channel
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs)? enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P2785A
-
-
- HY-P4744A
-
|
Bacterial
|
Infection
Cancer
|
LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used for cancer research .
|
-
- HY-P0221
-
Pituitary Adenylate Cyclase Activating Polypeptide 38
|
PACAP Receptor
|
Neurological Disease
|
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
-
- HY-P0221A
-
Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
|
PACAP Receptor
|
Neurological Disease
|
PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
-
- HY-P2847
-
|
CRFR
|
Metabolic Disease
Endocrinology
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow .
|
-
- HY-P5363
-
Prostatic Acid Phosphatase(248-286)
|
HIV
|
Others
|
PAP 248–286 is a biological active peptide. (Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.)
|
-
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
-
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
-
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
-
- HY-P5007
-
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the carboxyl terminus of the arginine vasopressin (AVP) precursor peptide. Copeptin (human) can be used in the study of cardiovascular disease .
|
-
- HY-P5177
-
-
- HY-P10141
-
|
JNK
|
Cancer
|
JNK-IN-15, Cell-Permeable, Negative Control is a negative control of JNK-IN-15, Cell-Permeable (HY-P10140). JNK-IN-15, Cell-Permeable is an inhibitor of JNK .
|
-
- HY-P10140
-
|
JNK
|
Cancer
|
JNK-IN-15, Cell-Permeable (JNK inhibitor III) is an inhibitor of JNK. JNK-IN-15, Cell-Permeable can used in study age-related neurodegenerative diseasev .
|
-
- HY-P1298
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P2609F
-
|
PACAP Receptor
|
Others
|
PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221)
|
-
- HY-P1681
-
-
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
-
- HY-P5793
-
-
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P2786A
-
-
- HY-P1542
-
Catostomus urotensin I
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
-
- HY-P1378
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
-
- HY-P1378A
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
-
- HY-P1298A
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1542B
-
Catostomus urotensin I TFA
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
-
- HY-P5285
-
|
Parasite
|
Infection
Inflammation/Immunology
Cancer
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells .
|
-
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
-
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
-
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
-
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
-
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
-
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
-
- HY-P3684A
-
|
CRFR
|
Neurological Disease
|
[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat .
|
-
- HY-P10093
-
|
PI3K
|
Others
|
Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system diseases .
|
-
- HY-P0089
-
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
-
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P2538
-
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
- HY-P0089A
-
Growth Hormone Releasing Factor human TFA; Somatorelin (1-44) amide (human) (TFA)
|
GHSR
|
Endocrinology
|
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
-
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
-
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
-
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P1368
-
Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)
|
CRFR
|
Endocrinology
|
Stressin I (Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)) is a potent CRF1 receptor-selective agonist with a Ki of 1.7 nM. Stressin I induces increases in adrenocorticotropic hormone (ACTH) levels in rats .
|
-
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
-
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
-
- HY-P1368A
-
Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41) TFA
|
CRFR
|
Endocrinology
|
Stressin I (Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)) TFA is a potent CRF1 receptor selective agonist, Ki is 1.7 nM. Stressin I induces an increase in adrenocorticotropic hormone (ACTH) levels in rats .
|
-
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
-
- HY-P4157
-
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-P4157A
-
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
-
- HY-P4884
-
-
- HY-P5710
-
|
Bacterial
|
Infection
|
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo .
|
-
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P10078
-
-
- HY-P3465
-
Myrcludex B
|
HBV
|
Infection
|
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research .
|
-
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
-
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
-
- HY-P1304
-
-
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
-
- HY-P1022
-
Metastin(human)
|
GnRH Receptor
|
Endocrinology
Cancer
|
Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion .
|
-
- HY-P1022A
-
Metastin(human) TFA
|
GnRH Receptor
|
Endocrinology
Cancer
|
Kisspeptin-54(human) TFA (Metastin(human) TFA) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) TFA binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) TFA hinders tumor metastasis and stimulates gonadotropin secretion .
|
-
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P1156A
-
-
- HY-P4933
-
|
Tau Protein
|
Others
|
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P2291
-
|
Bacterial
|
Inflammation/Immunology
|
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
-
- HY-P2291A
-
|
Bacterial
|
Inflammation/Immunology
|
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
-
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
-
- HY-P4890
-
-
- HY-P4890A
-
-
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
-
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
-
-
-
HY-L081
-
|
132 compounds
|
Protein phosphorylation is a key post-translational modification underlying the regulation of many cellular processes. Phosphatases and kinases contribute to the regulation of protein phosphorylation homeostasis in the cell. This reversible regulation of protein phosphorylation is critical for the proper control of a wide range of cellular activities, including cell cycle, proliferation and differentiation, metabolism, cell-cell interactions, etc.
Protein phosphatases have evolved in separate families that are structurally and mechanistically distinct. Based on substrate specificity and functional diversity, protein phosphatases are classified into two superfamilies: Protein serine/threonine phosphatases and Protein tyrosine phosphatases. Ser/Thr phosphatases are metalloenzymes belonging to two major gene families termed PPP (phosphoprotein phosphatase) and PPM (metal-dependent protein phosphatases), whereas protein tyrosine phosphatases (PTPs) belong to distinct classes of enzymes that utilize a phospho-cysteine enzyme intermediate as a part of their catalytic action.
MCE supplies a unique collection of 132 phosphatase inhibitors that mainly targeting protein tyrosine phosphatases (PTPs) and serine/threonine-specific protein phosphatases. MCE Phosphatase Inhibitor Library is a useful tool for phosphatase drug discovery and related research.
|
Cat. No. |
Product Name |
Type |
-
- HY-D0846
-
|
Biochemical Assay Reagents
|
Diethyl pyrocarbonate is a potent, orally active, non-specific chemical inhibitor of RNase. Diethyl pyrocarbonate has been useful in vitro as an agent relatively specific for binding to imidazole of histidine. Diethyl pyrocarbonate inhibits central chemosensitivity in rabbits. Diethyl pyrocarbonate can modify Ser, Thr, His and Tyr residues. Diethyl pyrocarbonate can be used for modeling .
|
-
- HY-W145586
-
GlcNAc beta(1-3)GalNAc-alpha-THR
|
Biochemical Assay Reagents
|
GlcNAcβ(1-3)GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-P2948
-
Ser/THR protein kinase
|
Biochemical Assay Reagents
|
Protein serine/threonine kinase (Ser/Thr protein kinase) is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-W145539
-
GlcNAc beta(1-3)[GlcNAc beta(1-6)]GalNAc-alpha-THR
|
Biochemical Assay Reagents
|
GlcNAcβ(1-3)[GlcNAcβ(1-6)]GalNAc-α-Thr is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
-
- HY-E70018
-
|
Biochemical Assay Reagents
|
Picornain 3C is a protease found in picornaviruses, which cleaves peptide bonds of non-terminal sequences. Picornain 3C is an intermediate between the serine peptidase chymotrypsin and the cysteine peptidase papain. Picornain 3C shows endopeptidase activity by selectively cleaving Gln-Gly bonds in the polyprotein of poliovirus and with substitution of Glu for Gln, and Ser or Thr for Gly in other picornaviruses .
|
-
- HY-P3021
-
|
Biochemical Assay Reagents
|
Human milk lysozyme is the lysozyme found in human milk. Human milk lysozyme is thought to be a key defense factor in protecting the gastrointestinal tract of newborns against bacterial infection .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P3467
-
-
- HY-P4699
-
-
- HY-148337
-
-
- HY-P4695
-
-
- HY-P5309
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
(Thr(GalNAc)4,7,15,Ser(GalNAc)9,11)-IgA1 Hinge Region Peptide is a synthetic glycopeptide and can be used for detection of gender difference and epitope specificity of IgG antibody activity against IgA1 hinge portion in IgA nephropathy patients .
|
-
- HY-P5309A
-
|
Peptides
|
Inflammation/Immunology
|
(Thr(GalNAc)4,7,15,Ser(GalNAc)9,11)-IgA1 Hinge Region Peptide (TFA) (GN5) is a synthetic glycopeptide and can be used for detection of gender difference and epitope specificity of IgG antibody activity against IgA1 hinge portion in IgA nephropathy patients .
|
-
- HY-P5322
-
|
Peptides
|
Others
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a biological active peptide. (This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It is cyclized through a disulfide bond. Thrombospondin is a matrix-bound glycoprotein involved in cancer metastasis, tumor adhesion, and angiogenesis. This peptide has been shown to competitively inhibit platelet aggregation and tumor metastasis.)
|
-
- HY-P4438
-
-
- HY-125083
-
-
- HY-P3727
-
|
Peptides
|
Inflammation/Immunology
|
Lys-Pro-Pro-Thr-Pro-Pro-Pro-Glu-Pro-Glu-Thr is a undecapeptide, corresponding to the carboxy terminus of simian virus 40 large T antigen. Lys-Pro-Pro-Thr-Pro-Pro-Pro-Glu-Pro-Glu-Thr can be targeted by antibodies secreted from three mouse hybridomas, designated KT1, KT3, and KT4, produced antibodies that immunoprecipitated large T antigen .
|
-
- HY-W005883
-
-
- HY-W008086
-
-
- HY-W008297
-
-
- HY-W008696
-
-
- HY-W012437
-
-
- HY-W048671
-
|
Amino Acid Derivatives
|
Others
|
Fmoc-Thr(TBDMS)-OH is a Threonine derivative. Fmoc-Thr(TBDMS)-OH can be used for the preparation of sugar ligand-tethered functional nucleic acid conjugates for targeted research .
|
-
- HY-22296
-
-
- HY-W016731
-
-
- HY-W007706
-
-
- HY-W008800
-
-
- HY-W042013
-
-
- HY-W011606
-
-
- HY-W011892
-
-
- HY-W013198
-
-
- HY-W008464
-
-
- HY-W018650
-
-
- HY-P1332
-
[D-Ser2, Leu5, THR6]-enkephalin
|
Opioid Receptor
|
Neurological Disease
|
DSLET ([D-Ser2, Leu5, Thr6]-enkephalin) is a highly specific agonist of the δ-receptor. DSLET is an enkephalin-related peptide selectively bound to the δ opioid receptor .
|
-
- HY-P2673
-
KRTLRR
|
EGFR
|
Others
|
Lys-Arg-Thr-Leu-Arg-Arg (KRTLRR) is a hexapeptide. Lys-Arg-Thr-Leu-Arg-Arg is a substrate of protein kinase C from EGF receptor. Lys-Arg-Thr-Leu-Arg-Arg can be used to determine the activity of protein kinase C .
|
-
- HY-P4462
-
|
Peptides
|
Others
|
D-Leu-Thr-Arg-pNA is a substrate for γ-Tryptase, and can be used to measure the effects of small molecule inhibitors on γ-Tryptase activity .
|
-
- HY-P3703
-
|
Peptides
|
Others
|
H-Val-Thr-Cys-Gly-OH is a cell attachment peptide. H-Val-Thr-Cys-Gly-OH is a bioactive molecule used for cell adhesion or other cell interactions .
|
-
- HY-W051350
-
-
- HY-W051351
-
-
- HY-P5050
-
|
Peptides
|
Others
|
Cyclo(Pro-Thr) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5519
-
|
Peptides
|
Others
|
[Thr28, Nle31]-Cholecystokinin (25-33) is a biological active peptide. (Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.)
|
-
- HY-W013745
-
-
- HY-W010770
-
-
- HY-P4502
-
|
Peptides
|
Others
|
(Des-Thr5)-Glucagon is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4504
-
|
Peptides
|
Others
|
(Des-Thr7)-Glucagon is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-W048700
-
-
- HY-P4539
-
|
Peptides
|
Others
|
H-Thr-Asp-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4626
-
|
Peptides
|
Others
|
H-Thr-Phe-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4619
-
|
Peptides
|
Others
|
H-Thr-Glu-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4630
-
|
Peptides
|
Others
|
H-Thr-Pro-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4533
-
|
Peptides
|
Others
|
H-Thr-Ala-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4537
-
|
Peptides
|
Others
|
H-Thr-Arg-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4624
-
|
Peptides
|
Others
|
H-Thr-Met-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4622
-
|
Peptides
|
Others
|
H-Thr-Gly-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-120833
-
|
Caspase
|
Others
|
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .
|
-
- HY-P4349
-
|
Peptides
|
Others
|
Pyr-Arg-Thr-Lys-Arg-AMC is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .
|
-
- HY-P4022
-
- HY-P4561
-
|
Cathepsin
|
Others
|
H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH is a water-soluble polypeptide that can serve as a substrate for cathepsin D, pepsin and pepsinogen. H-Pro-Thr-Glu-Phe-p-nitro-Phe-Arg-Leu-OH has potential applications in biochemical analysis .
|
- HY-P5111
-
|
Peptides
|
Neurological Disease
|
Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) is a high-affinity and selective VPAC2 receptor antagonist .
|
- HY-P5104
-
|
Peptides
|
Others
|
Glu-Thr-Tyr-Ser-Lys is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2396
-
- HY-P2400
-
- HY-P2393
-
- HY-P2409
-
- HY-P4349A
-
|
Peptides
|
Others
|
Pyr-Arg-Thr-Lys-Arg-AMC TFA is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .
|
- HY-P2402
-
- HY-P3083
-
|
PKC
|
Inflammation/Immunology
|
N-Myristoyl-Lys-Arg-Thr-Leu-Arg is a protein kinase C (PKC) inhibitor with an IC50 value of 75 μM. N-Myristoyl-Lys-Arg-Thr-Leu-Arg inhibits IL-2 receptor induction and IL-2 production in the human leukemic cell line Jurkat .
|
- HY-P2395
-
- HY-P2397
-
- HY-P2399
-
- HY-P2404
-
- HY-P2408
-
- HY-P2388
-
- HY-P2411
-
- HY-P10001
-
Z-Ile-Glu-THR-Asp-pNA
|
Caspase
|
Cancer
|
Z-IETD-pNA (Z-Ile-Glu-Thr-Asp-pNA) is a colorimetric caspase-8 and granzyme B substrate. Z-IETD-pNA is hydrlyzed by caspase 8 to generate pNA .
|
- HY-P4725
-
|
Peptides
|
Others
|
Abz-Thr-Ile-Nle-p-nitro-Phe-Gln-Arg-NH2 is a fluorogenic substrate, that can be used for the fluorescence screening assay .
|
- HY-P2394
-
- HY-P2392
-
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
- HY-15400
-
- HY-P2948
-
Ser/THR protein kinase
|
Peptides
|
Others
|
Protein serine/threonine kinase (Ser/Thr protein kinase) is a biochemical reagent that can be used as a biological material or organic compound for life science related research.
|
- HY-P2014
-
- HY-P3941
-
|
Peptides
|
Others
|
Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr is a peptide. Ala-Arg-Arg-Pro-Glu-Gly-Arg-Thr-Trp-Ala-Gln-Pro-Gly-Tyr can easily be formed with more than one positive charge .
|
- HY-P5045
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
Fmoc-Thr(GalNAc(Ac)3-β-D)-OH inhibits cancer cell growth, through targeting intricate cancer-specific pathways while simultaneously strengthening immunologic response .
|
- HY-P10215
-
|
Peptides
|
Infection
|
Ac-{Cpg}-Thr-Ala-{Ala(CO)}-Asp-{Cpg}-NH2 (compound 40) is a potent Plasmodium subtilisin-like protease 1 (SUB1) inhibitor. SUB1-IN-1 shows IC50 values of 12 nM and 10 nM against P. vivax and P. falciparum SUB1 (Pv- and PfSUB1), respectively .
|
- HY-P3760
-
|
Peptides
|
Others
|
H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH is an peptide. H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH can be used for the research of various biochemical studies .
|
- HY-P5123
-
|
Peptides
|
Others
|
Arg-Glu(edans)-Ile-His-Pro-Phe-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(dabcyl)-Ar is a fluorogenic renin substrate based on the N-terminal tetradecapeptide sequence of human angiotensinogen (hTDP) .
|
- HY-P5123A
-
|
Peptides
|
Others
|
Arg-Glu(edans)-Ile-His-Pro-Phe-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Lys(dabcyl)-Ar TFA is a fluorogenic renin substrate based on the N-terminal tetradecapeptide sequence of human angiotensinogen (hTDP) .
|
- HY-P4686
-
|
Peptides
|
Others
|
(Ser(PO3H2)202,Thr(PO3H2)205)-Tau Peptide (194-213) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3818
-
|
PKC
|
Others
|
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
|
- HY-P3811A
-
|
CaMK
|
Neurological Disease
|
Autocamtide-3 acetate, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
- HY-P2019
-
|
Peptides
|
Neurological Disease
|
Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus .
|
- HY-P0232
-
- HY-P5525
-
Autocamtide-3 Derived Inhibitory Peptide
|
CaMK
|
Others
|
AC3-I, myristoylated is a biological active peptide. (This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.)
|
- HY-P1115A
-
|
Akt
|
Others
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
- HY-P3811
-
|
CaMK
|
Neurological Disease
|
Autocamtide-3, a 13-amino-acid peptide containing Thr287, is a selective CaMKII (Ca 2+/calmodulin-dependent kinase II) (CaMK) substrate .
|
- HY-P1230
-
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity .
|
- HY-P3766
-
|
PKC
|
Others
|
Protein kinase C α peptide (TFA) is a peptide of PKC-α. PKC-α acts as a lipid-dependent ser/thr protein kinase, can modulate various cellular processes, including cell survival, proliferation, differentiation, migration, adhesion and so on .
|
- HY-P5126
-
|
Somatostatin Receptor
|
Cancer
|
DOTA-LM3 is a somatostatin receptor (SSTR) antagonist. LM3 refers to p-Cl-Phe- cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr- NH2, as well as a somatostatin antagonist. DOTA-LM3 is often isotopically labeled for tracing tumors in vivo, such as 177Lu-DOTA-LM3 and 68 Ga-DOTA-LM3. 68 Ga-DOTA-LM3 shows favorable biodistribution, high tumor uptake, good tumor retention, and few safety concerns. 177Lu-DOTA-LM3 can be used for research in DOTATOC-negative liver metastases, such as pancreatic NET and extensive tumor thrombosis .
|
- HY-P5126A
-
|
Somatostatin Receptor
|
Cancer
|
DOTA-LM3 TFA is a somatostatin receptor (SSTR) antagonist. LM3 refers to p-Cl-Phe- cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr- NH2, as well as a somatostatin antagonist. DOTA-LM3 TFA is often isotopically labeled for tracing tumors in vivo, such as 177Lu-DOTA-LM3 TFA and 68 Ga-DOTA-LM3 TFA. 68 Ga-DOTA-LM3 TFA shows favorable biodistribution, high tumor uptake, good tumor retention, and few safety concerns. 177Lu-DOTA-LM3 TFA can be used for research in DOTATOC-negative liver metastases, such as pancreatic NET and extensive tumor thrombosis .
|
- HY-P1906
-
|
CDK
|
Neurological Disease
|
[pThr3]-CDK5 Substrate is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
- HY-P1906A
-
|
CDK
|
Neurological Disease
|
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
- HY-P5272
-
|
Bacterial
|
Inflammation/Immunology
|
Histatin-3 TFA, a 32 amino acid peptide, possesses powerful antimicrobial properties. Histatin-3 TFA behaves as a substrate for proprotein convertase 1 (PC1), being cleaved by this endoprotease primarily at a site carboxy terminal to the single Arg25 residue (HRGYR decrease SN). Histatin-3 TFA is a moderately potent, reversible and competitive inhibitor of the furin-mediated cleavage of the pentapeptide pGlu-Arg-Thr-Lys-Arg-MCA fluorogenic substrate, with an estimated inhibition constant Ki of 1.98 μM .
|
- HY-P2967
-
|
Peptides
|
Others
|
α-Hemolysin (Staphylococcus aureus) is one of the most characteristic virulence factors secreted by Staphylococcus aureus, a polypeptide capable of destroying the host cell plasma membrane. After α-Hemolysin binds to the cell surface, its monomers assemble into a homoheptamer to form a front pore, which then transforms into a mature transmembrane pore water channel, allowing K + and Ca 2+ ion transport, leading to necrotic death of target cells .
|
- HY-P5562
-
|
Bacterial
|
Infection
|
PP102 is an antimicrobial peptide is active against gram-positive B. subtilis (MIC: 25 uM), S. aureus (MIC: 13.3 uM), S. lutea (MIC: 63 uM), and B. pumilu (MIC: 23 uM) .
|
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
- HY-P5473
-
|
Peptides
|
Others
|
EA2 is a biological active peptide. (This is a peptide substrate for polypeptide N-acetylgalactosaminyltransferase (polypeptide GalNAc-T).)
|
- HY-P0280
-
- HY-P5150
-
|
Peptides
|
Neurological Disease
|
alpha-Cobratoxin is a neurotoxin, which can be isolated from the venom of the Thailand cobra. alpha-Cobratoxin exhibits neuromodulatory, antiviral, and analgesic activity. alpha-Cobratoxin also shows potent immunosuppressive activity for acute and chronic multiple sclerosis. alpha-Cobratoxin is further on research in adrenomyeloneuropathy .
|
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P5507
-
Erktide
|
Peptides
|
Others
|
ERK2 Substrate (Erktide) is a biological active peptide. (Erktide is a peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.)
|
- HY-P5508
-
|
Peptides
|
Others
|
MUC5AC-13 is a biological active peptide. (This glycopeptide is an N-acetyl galactosamine (GalNAc)-modified MUC5AC mucin peptide containing the single site of threonine 13 labeled with GalNAc (T*). Polypeptide N-acetylgalactosaminyltransferase (ppGaNTase) catalyzes the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to threonine. The MUC5AC gene is mainly expressed in gastric and tracheo-bronchial mucosae, and some tumors.)
|
- HY-P5512
-
|
Peptides
|
Others
|
MUC5AC-3 is a biological active peptide. (glycopeptide transferase, ppGaNTase-T9 substrate)
|
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
- HY-P3012
-
|
Cathepsin
|
Inflammation/Immunology
|
Cathepsin G acts as a potent agonist of human platelet activation leading to their aggregation., and can be used for screening of relevant inhibitors .
|
- HY-P10155
-
|
Peptides
|
Others
|
VT5 is a β-sheet amphipathic peptide consisting of 26 amino acids. VT5 has the ability to form β-sheets for cellular internalization .
|
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
FITC-α-Bungarotoxin is the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P1264F1
-
|
nAChR
|
Neurological Disease
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Inflammation/Immunology
|
Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
- HY-P4972
-
- HY-P4800
-
- HY-P5332
-
UB311 immunogen II
|
Peptides
|
Others
|
Aβ1-14-εK-HBsAg3 Th (UB311 immunogen II) is a biological active peptide. (one of UB-311's Aβ1–14–targeting peptides (B-cell epitope))
|
- HY-P2258
-
|
Peptides
|
Others
|
Histone H3 (1-34) is a peptide derived from human histone isotype 3.1. Histones are the main protein components of eukaryotic chromatin. Histone variants and histone modifications modulate chromatin structure, ensuring the precise operation of cellular processes associated with genomic DNA .
|
- HY-P2465
-
|
Peptides
|
Cancer
|
Histone H3 (1-35) is a 35-residue peptide of histone H3. Histone H3 is one of the five main histones involved in the structure of chromatin in eukaryotic cells .
|
- HY-P4704
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (61-95) (human) is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
- HY-P4704A
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (61-95) (human) TFA is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) TFA can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
- HY-P5797
-
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
- HY-P0272
-
|
HIV
|
Infection
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
- HY-P0272A
-
|
HIV
|
Infection
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
- HY-P4973
-
|
Peptides
|
Others
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4066
-
|
Peptides
|
Cancer
|
Emfilermin is a recombinant human leukaemia inhibitory factor (LIF) that can be used in chemotherapy-induced peripheral neuropathy studies .
|
- HY-P1034
-
DAPTA
1 Publications Verification
D-Ala-peptide T-amide; Adaptavir
|
CCR
HIV
|
Infection
Endocrinology
|
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
|
- HY-P0058A
-
- HY-P0058
-
- HY-P0058B
-
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P4928
-
|
Peptides
|
Others
|
Biotinyl-Amylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4863
-
|
Peptides
|
Others
|
Biotinyl-Amylin (human) is abiotinylated Amylin, amide, human (HY-P1070).
|
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
- HY-P4732
-
|
Peptides
|
Others
|
5-FAM-Amylin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P6013
-
|
Calcium Channel
|
Others
|
wt hMLN is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
- HY-P6013A
-
|
Peptides
|
Others
|
wt hMLN (TFA) is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
- HY-P5310A
-
|
Peptides
|
Others
|
VPSTPPTPSPSTPPTPSPS (TFA) is an IgA1 hinge region peptide .
|
- HY-P5310
-
- HY-P5511
-
|
Peptides
|
Others
|
MUC5AC-3/13 is a biological active peptide. (glycopeptide transferase, ppGaNTase-T9 substrate)
|
- HY-P5904
-
Caveolin-1 scaffolding domain peptide
|
c-Met/HGFR
|
Others
|
Caveolin-1 (82-101) amide (human, mouse, rat) (Caveolin-1 scaffolding domain peptide) is a peptide that reverses aging-associated deleterious changes in multiple organs. Caveolin-1 (82-101) amide (human, mouse, rat) inhibits tyrosine kinases .
|
- HY-P5954
-
|
Peptides
|
Others
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
- HY-P1782
-
- HY-P2285
-
- HY-P2479
-
|
Peptides
|
Inflammation/Immunology
|
Peripheral Myelin Protein P2 (53-78), bovine is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. Peripheral Myelin Protein P2 (53-78), bovine is a T cell epitope for the induction of experimental autoimmune neuritis (EAN) in Lewis rats .
|
- HY-P5173
-
|
Peptides
|
Others
|
MitTx-beta is a peptide can be isolated from the venom of the Texas coral snake (Micrurus tener tener). MitTx-beta can form a complex with MitTx-α, MitTx. MitTx has ASIC1 channel activating activity on capsaicin-sensitive nerve fibers .
|
- HY-P1393
-
|
Amylin Receptor
|
Endocrinology
|
AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has neuroprotective effects .
|
- HY-P1393A
-
|
Amylin Receptor
|
Endocrinology
|
AC 187 TFA is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 TFA shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 TFA has neuroprotective effects .
|
- HY-P4977
-
- HY-P1265
-
Vc1.1
|
nAChR
|
Neurological Disease
|
ACV1 (Vc1.1), an α-Conotoxin, is a selective α9α10 nAChR antagonist with an IC50 of 19 nM. ACV1 is ~100-fold less potent on human α9α10 vs. rat nAChRs .
|
- HY-P5081
-
|
Peptides
|
Inflammation/Immunology
|
Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and proinflammatory genes .
|
- HY-P1764
-
|
Peptides
|
Neurological Disease
|
Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes .
|
- HY-P1142
-
|
Apoptosis
|
Others
|
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
- HY-P1142A
-
|
Apoptosis
|
Others
|
GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
- HY-P0263
-
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration .
|
- HY-P0263A
-
|
Bacterial
Fungal
|
Infection
|
Dermaseptin TFA, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration .
|
- HY-P1142S1
-
|
Isotope-Labeled Compounds
|
Others
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
- HY-P1142S
-
|
Isotope-Labeled Compounds
|
Others
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
- HY-P5593
-
|
Fungal
|
Infection
|
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5594
-
|
Fungal
|
Infection
|
Dermaseptin-S1 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5084
-
|
Peptides
|
Neurological Disease
|
Neuromedin S (human) is a neuropeptide that contains 33 amino acids.? Neuromedin S (human)has been identified in the brain as an endogenous ligand for the orphan G-protein coupled receptor (GPCR) FM-4/TGR-1 and acts on the neuromedin U (NMU) receptor 2 (NMUR2) in the regulation of body weight homeostasis .
|
- HY-P0007
-
Carbocalcitonin
|
Peptides
|
Metabolic Disease
|
Elcatonin (Carbocalcitonin) is a synthetic analog of eel calcitonin. Elcatonin increases bone mineral density, inhibits bone resorption and processes a central analgesic effect .
|
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
- HY-P1463
-
Thyrocalcitonin eel
|
Peptides
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P1532
-
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Peptides
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
- HY-P0203
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1071
-
Calcitonin gene-related peptid
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
- HY-P1071A
-
Calcitonin gene-related peptid TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
- HY-P2221
-
ZP1848
|
GCGR
|
Inflammation/Immunology
|
Glepaglutide (ZP1848), a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide reduces faecal output and increases intestinal absorption. Glepaglutide alleviates small intestinal inflammation. Glepaglutide can be used in the research of inflammatory bowel disease (IBD) and Crohn’s disease .
|
- HY-P2221B
-
ZP1848 acetate
|
GCGR
|
Inflammation/Immunology
|
Glepaglutide (ZP1848) acetate, a long-acting GLP-2 analogue, is a potent GLP-2R agonist. Glepaglutide acetate reduces faecal output and increases intestinal absorption. Glepaglutide acetate alleviates small intestinal inflammation. Glepaglutide acetate can be used in the research of inflammatory bowel disease (IBD) and Crohn’s disease .
|
- HY-P4058
-
CGRP free acid
|
Peptides
|
Neurological Disease
|
Calcitonin gene-related peptide (CGRP) free acid is a neuropeptide. Calcitonin gene-related peptide can be used for the research of nociception, ingestive behaviour and modulation of the endocrine systems .
|
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P4946
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4941
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3071
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-P4815
-
|
Endogenous Metabolite
|
Neurological Disease
Metabolic Disease
|
Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity .
|
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
- HY-P0191A
-
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P1805
-
|
Calmodulin
|
Neurological Disease
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
- HY-P5920
-
α-KTx 6.21
|
Peptides
|
Neurological Disease
|
Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel .
|
- HY-P3384
-
|
Antibiotic
|
Others
Inflammation/Immunology
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
- HY-P5046
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (71-82) (human) is the 71-82 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) .
|
- HY-163423S
-
- HY-P1534
-
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
- HY-P4853
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) .
|
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P5451
-
|
Peptides
|
Others
|
PLP (178-191) is a biological active peptide. (This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.)
|
- HY-P5304A
-
- HY-P2123A
-
|
Bacterial
Antibiotic
|
Infection
|
Colistin A sulfate hydrate is a major component of Colistin. Colistin is a polymyxin antibiotic and can be used to combat infections caused by problematic gram-negative bacteria .
|
- HY-P2508
-
|
Mucin
|
Cancer
|
MUC1, mucin core is the region of the MUC1 mucin core. MUC1 is a type I transmembrane glycoprotein, and is overexpressed and aberrantly glycosylated in carcinoma cells. MUC1, mucin core protein binds to domain 1 of ICAM-1 .
|
- HY-P1819
-
- HY-P4767
-
|
Peptides
|
Metabolic Disease
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
- HY-P10111A
-
H3(1-15)K9me3 TFA
|
Peptides
|
Others
|
Histone H3K9me3 (1-15) (H3(1-15)K9me3) TFA is used as substrate. Histone H3K9me3 is a histone posttranslational modification (PTM) that has emerged as hallmark of pericentromeric heterochromatin .
|
- HY-P10111
-
H3(1-15)K9me3
|
Peptides
|
Inflammation/Immunology
Cancer
|
Histone H3K9me3 (1-15) (H3(1-15)K9me3) is a histone posttranslational modification (PTM) that has emerged as hallmark of pericentromeric heterochromatin. Trimethylation of histone H3 at lysine 9 is associated with gene repression, prevents transcription factor binding .
|
- HY-12523
-
|
Peptides
|
Others
|
Peptide M is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen: DTNLASSTIIKEGIDKTV), is capable of inducing experimental autoimmune uveitis in monkeys and Hartley guinea pigs as well as Lewis rats .
|
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
- HY-P4152
-
- HY-P5276
-
|
PD-1/PD-L1
|
Cancer
|
Human membrane-bound PD-L1 polypeptide can be used as an antigen to induce PD-L1 antibody production .
|
- HY-P0222
-
|
PKA
|
Others
|
PKI(5-24) is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
- HY-P0222A
-
|
PKA
|
Others
|
PKI(5-24) TFA is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) TFA corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
- HY-P5087
-
|
Peptides
|
Others
|
Histone H3 (1-20) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5462
-
|
Peptides
|
Others
|
PLP (180-199) is a biological active peptide. (This is amino acids 180-199 fragment of myelin proteolipid protein (PLP). PLP, the most abundant myelin protein of the central nervous system, has been used in multiple sclerosis (MS) studies. MS is a chronic inflammatory demyelinating disease of the CNS.)
|
- HY-P5472
-
|
Peptides
|
Others
|
Tumour-associated MUC1 epitope is a biological active peptide. (This sequence is the hallmark of MUC1 mucin. MUC1 is a highly glycosylated type I transmembrane glycoprotein with a unique extracellular domain consisting of a variable number of tandem repeats (VNTR) of this 20 amino acid peptide. It is overexpressed on the cell surface of many human adenocarcinomas and hematological malignancies, including multiple myeloma and B-cell lymphoma, making MUC1 broadly applicable target for immunotherapeutic strategies.)
|
- HY-P1848
-
- HY-P2552
-
|
Peptides
|
Others
|
Histone H3 (1-21), derived from Histone H3 1-21 amino acids, is usually used as a substrate for methyltransferase (Histone 3 K4 and K9) and acetyltransferase (Histone 3 K9 and K14) assays .
|
- HY-P4984
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) is a T cell proliferation activator. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) promotes the in vitro proliferation of human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) can be used in research on inflammatory and immunity, as well as cancer .
|
- HY-P2255
-
|
Peptides
|
Others
|
H3K4(Me) (1-20), a histone peptide. H3K4me is an intricately regulated posttranslational modification, which is broadly associated with enhancers and promoters of actively transcribed genomic loci .
|
- HY-P2256
-
|
Peptides
|
Others
|
H3K4(Me2) (1-20) is a histone peptide. H3K4me2 regulates the recovery of protein biosynthesis and homeostasis following DNA damage .
|
- HY-P2257
-
|
Peptides
|
Others
|
H3K4(Me3) (1-20) is a histone peptide. Trimethylation of histone H3 on lysine 4 (H3K4 me3) is found in active euchromatin but not in silent heterochromatin .
|
- HY-P5560
-
|
Bacterial
|
Infection
|
PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. subtilis (MIC: 13.3 uM), S. aureus (MIC: 23.3 uM), S. lutea (MIC: 8.0 uM), and B. pumilu (MIC: 9.0 uM) .
|
- HY-P4119
-
|
Peptides
|
Others
|
Pep-1-Cysteamine is a chimeric cell-penetrating peptide (CPP) with a primary amphipathicity. Pep-1-Cysteamine has the ability to translocate across biological membranes and introduce active proteins inside cells .
|
- HY-P3965A
-
- HY-P5176
-
LtTx-1a
|
Peptides
|
Neurological Disease
|
Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity .
|
- HY-P10016
-
HS-20039; EPO-018B
|
Peptides
|
Endocrinology
|
Pegmolesatide(HS-20039; EPO-018B) a synthetic peptide-based erythropoiesis-stimulating agent, can be used for ??the study of anemia in chronic kidney disease .
|
- HY-P4872
-
|
Peptides
|
Neurological Disease
|
Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP .
|
- HY-P3517
-
β-EP (6-31), human
|
Opioid Receptor
|
Neurological Disease
Endocrinology
|
β-Endorphin, an endogenous opioid neuropeptide, is an opioid receptor agonist. β-Endorphin binds preferentially to μ-opioid receptors and is produced in certain neurons of the central and peripheral nervous system and is one of three endorphins produced in humans. β-Endorphin can be used to reduce stress and maintain homeostasis in the body and is involved in neurological pain perception regulation .
|
- HY-P5113
-
|
Peptides
|
Others
|
Histone H3 (1-21)-Gly-Gly-Lys(biotinyl) amide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5492
-
Delta-lysin
|
Peptides
|
Others
|
Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin is a model in the study of peptides interacting with membranes. Delta-hemolysin is poorly active against bacteria .
|
- HY-P5892
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin (1-27) (human) is an opioid antagonist that binds μ-, δ-, and κ-opioid receptors with Kis of 5.31, 6.17, and 39.82 nM, respectively. β-Endorphin (1-27) (human) inhibits β-Endorphin (HY-P1502)-induced and etorphine-induced analgesia .
|
- HY-P5492A
-
Delta-lysin TFA
|
Peptides
|
Others
|
Delta-hemolysin (Delta-lysin) TFA, a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin TFA may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin TFA is a model in the study of peptides interacting with membranes. Delta-hemolysin TFA is poorly active against bacteria .
|
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
- HY-P3383A
-
PL-5 acetate
|
Bacterial
|
Infection
|
Peceleganan (PL-5) acetate is an artificial antimicrobial cecropin A (1-10) × melittin B (3-18) hybrid (10+16)-peptide analogue. Peceleganan acetate inhibits wound infection .
|
- HY-P4620
-
|
Peptides
|
Others
|
(Lys(Me)24)-Histone H3 (1-21)-Gly-Gly-Lys(biotinyl) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4627
-
|
Peptides
|
Others
|
(Lys(Me)29)-Histone H3 (1-21)-Gly-Gly-Lys(biotinyl) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5604
-
|
Bacterial
|
Infection
|
Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5605
-
|
Bacterial
|
Infection
|
Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 2 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5668
-
|
Bacterial
|
Infection
|
Maximin 28 is an antimicrobial peptide derived from the toad brain. Maximin 28 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 4.7, 9.4, 75 μg/mL, respectively .
|
- HY-P5672
-
|
Bacterial
|
Infection
|
Maximin 39 is an antimicrobial peptide derived from the toad brain. Maximin 39 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 18.8, 37.5 μg/mL, respectively .
|
- HY-P5612
-
- HY-P0091
-
Thymosin α1
|
Influenza Virus
|
Cancer
|
Thymalfasin is an immunomodulating agent able to enhance the Thl immune response.
|
- HY-P0082
-
Glucagon
|
GCGR
|
Metabolic Disease
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation .
|
- HY-P0285
-
|
RABV
|
Infection
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
- HY-P1874
-
|
Calmodulin
|
Neurological Disease
|
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II) .
|
- HY-P0285A
-
|
RABV
|
Infection
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
- HY-P0082A
-
Glucagon hydrochloride
|
GCGR
|
Metabolic Disease
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation .
|
- HY-P1143
-
|
GCGR
|
Metabolic Disease
|
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes .
|
- HY-P1143A
-
|
GCGR
|
Metabolic Disease
|
[Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA is potentially useful in the study of the pathogenesis of diabetes .
|
- HY-P1015
-
Vasoactive Intestinal Peptide, guinea pig
|
Peptides
|
Neurological Disease
Metabolic Disease
|
VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
- HY-P1015A
-
Vasoactive Intestinal Peptide, guinea pig TFA
|
Peptides
|
Neurological Disease
Metabolic Disease
|
VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
- HY-P3469
-
|
Peptides
|
Metabolic Disease
|
Dasiglucagon is a human glucagon analog, and can increase plasma glucose. Dasiglucagon can be used in hypoglycemia research .
|
- HY-P4636
-
|
Peptides
|
Others
|
(Lys(Me)34)-Histone H3 (1-21)-Gly-Gly-Lys(biotinyl) amide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4638
-
|
Peptides
|
Others
|
(Lys(Me)39)-Histone H3 (1-21)-Gly-Gly-Lys(biotinyl) amide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4389
-
|
Peptides
|
Metabolic Disease
|
(Asp28)-Glucagon (1-29) (human, rat, porcine) is an optimized structure of glucagon, the 28th position is replaced by aspartic acid (Asp) which significantly increases the aqueous solubility of glucagon in a physiological pH buffer, has the same activity as glucagon .
|
- HY-P4590
-
- HY-P4592
-
- HY-P5623
-
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
- HY-P5623B
-
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
- HY-P5623A1
-
RVG29-Cys acetate; RDP-Cys acetate; Rabies Virus Glycoprotein-29-Cys acetate
|
RABV
|
Others
|
RVG-Cys (RVG29-Cys;RDP-Cy) acetate is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
- HY-P5623A
-
RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys
|
RABV
|
Others
|
RVG-Cys (RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
- HY-P1473
-
Amylin (8-37) (mouse, rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
|
- HY-P1502
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
- HY-P2260
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P2501
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological hallmark of type II diabetes mellitus .
|
- HY-P1728
-
|
YAP
|
Cancer
|
Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model .
|
- HY-P4672
-
|
GCGR
|
Metabolic Disease
|
(Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .
|
- HY-P2260B
-
|
HIV
|
Infection
|
Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
- HY-P2260C
-
|
HIV
|
Infection
|
Tat-beclin 1 scrambled TFA is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
- HY-P0082F
-
|
Peptides
|
Others
|
Glucagon (1-29), FAM-labeled is a biological active peptide. (FAM labeled HY-P0082)
|
- HY-P2046
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction .
|
- HY-W019878
-
β-Lipotropin 61-91
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats .
|
- HY-P4831
-
|
Peptides
|
Others
|
Acetyl-β-Endorphin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4785
-
- HY-P2625S1
-
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
- HY-P2625S
-
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
- HY-P5366
-
|
Peptides
|
Others
|
PEP1 is a biological active peptide. (PEP1 binds to POPC SLBs at Low Concentration, High Concentration of PEP1 Leads to POPC SLBs Lysis)
|
- HY-P5407
-
|
Peptides
|
Others
|
HD5 is a biological active peptide. (a natural lectin-like human defensins-5 (HD5) peptide secreted by the Paneth cells in the crypts of Lieberkuhn, could interact with glycosylated proteins and lipid components)
|
- HY-P1502F
-
|
Peptides
|
Others
|
Biocytin-β-endorphin, human is abiotinylated β-Endorphin, human (HY-P1502).
|
- HY-P4689
-
|
Peptides
|
Metabolic Disease
|
Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) reduces fasting-induced food intake, increases plasma levels of LH, FSH, and testosterone in rats .
|
- HY-P5693
-
|
Bacterial
CMV
HSV
|
Infection
|
HBA(111-142), an antimicrobial peptide, is a C-terminal 32-mer fragment of alpha-hemoglobin. HBA(111-142) has antibacterial activity against the ESKAPE panel of pathogens. HBA(111-142) forms amyloid fibrils, and has antiviral activities. HBA(111-142) inhibits measles and herpes viruses (HSV-1, HSV-2, HCMV) .
|
- HY-P10110
-
|
Autophagy
|
Neurological Disease
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
- HY-P1024
-
GLP-2 (human); Glucagon-like peptide 2 (human)
|
GCGR
|
Metabolic Disease
|
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
|
- HY-P1841
-
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
- HY-P5821
-
- HY-P10076
-
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
- HY-P4839
-
|
Peptides
|
Metabolic Disease
|
GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes .
|
- HY-P1714A
-
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
- HY-P1714
-
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
- HY-P1239A
-
|
Peptides
|
Neurological Disease
|
Neuromedin S(rat) TFA is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1
|
- HY-P4116
-
pHLIP
|
Peptides
|
Others
|
pH-Low Insertion Peptide (pHLIP) used as a specific ligand to target the tumor acidic microenvironment for tumors at early and metastatic stages .
|
- HY-P5660
-
|
Peptides
|
Infection
|
Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P10079
-
- HY-P1144
-
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
- HY-P3050
-
|
Peptides
|
Cardiovascular Disease
|
Helospectin II is a neuropeptide of the vasoactive intestinal peptide (VIP) family. Helospectin II has vasodilatory and antihypertensive activities, and decreases blood pressure. Helospectin II is originally isolated from the salivary gland venom of the lizard Heloderma suspectum .
|
- HY-P5203
-
EntK1
|
Bacterial
|
Infection
|
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections .
|
- HY-P5204
-
K1-EJ hybrid
|
Bacterial
|
Infection
|
Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus .
|
- HY-P5902
-
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
- HY-P4796
-
Proglucagon (33-69)
|
Peptides
|
Metabolic Disease
|
Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids.
|
- HY-P1295
-
Urocortin (human); Human urocortin; Human urocortin 1; Human urocortin I
|
CRFR
|
Neurological Disease
Endocrinology
|
Urocortin, human, a 40-aa neuropeptide, acts as a selective agonist of endogenous CRF2 receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively.
|
- HY-P1296
-
Urocortin (Rattus norvegicus); Rat urocortin
|
CRFR
|
Neurological Disease
Endocrinology
|
Urocortin, rat (Urocortin (Rattus norvegicus)) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively .
|
- HY-P3498
-
ZP1846
|
GCGR
|
Others
|
Elsiglutide (ZP1846) is a GLP-2 analogue, an orally active and selective GLP-2 receptor agonist, increases cell proliferation and reduces apoptosis in the intestine. Elsiglutide improves Lapatinib (HY-50898)-induced diarrhoea in rat model .
|
- HY-P4086
-
|
RABV
|
Infection
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction .
|
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
- HY-P10032
-
- HY-P10032A
-
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
- HY-P5901
-
- HY-P10090
-
|
Akt
PI3K
Apoptosis
|
Cancer
|
Apoptin-derived peptide is an antitumor polypeptide with cytotoxicity. Apoptin-derived peptide promotes apoptosis and necrosis of gastric cancer (GC) cells by regulating PI3K/AKT/ARNT signaling. Apoptin-derived peptide inhibited the invasion and migration of cancer cells, and inhibited the expression and phosphorylation of the subunit p85 of PI3K, which further inhibited the PI3K/AKT pathway involved in the development of gastric cancer .
|
- HY-P1457
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
|
- HY-P4211
-
|
Bacterial
|
Infection
|
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties .
|
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
- HY-P6008
-
MLN peptide
|
Calcium Channel
|
Cardiovascular Disease
|
Myoregulin (MLN peptide) is a member of the regulin family. Myoregulin regulates muscle performance by modulating intracellular calcium handling. Myoregulin interactes directly with sarcoplasmic reticulum Ca 2+-ATPase (SERCA) and impedinf Ca 2+ uptake into the sarcoplasmic reticulum .
|
- HY-P6008A
-
MLN peptide TFA
|
Calcium Channel
|
Cardiovascular Disease
|
Myoregulin (MLN peptide) TFA is a member of the regulin family. Myoregulin TFA regulates muscle performance by modulating intracellular calcium handling. Myoregulin TFA interactes directly with sarcoplasmic reticulum Ca 2+-ATPase (SERCA) and impedinf Ca 2+ uptake into the sarcoplasmic reticulum .
|
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
- HY-P1727
-
|
YAP
|
Cancer
|
Super-TDU is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU suppresses tumor growth in gastric cancer mouse model .
|
- HY-P4327
-
|
Bacterial
|
Infection
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative .
|
- HY-P4587
-
|
Peptides
|
Metabolic Disease
|
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism .
|
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
- HY-P1455
-
Human adrenomedullin-(1-52)-NH2
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer.
|
- HY-P1455A
-
Human adrenomedullin-(1-52)-NH2 TFA
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
|
- HY-P4766
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (porcine) is a peptide that regulates vasodilation. Adrenomedullin (porcine) induces endothelium-dependent relaxation in rat aorta with IC50 value of 2.4 nM. Adrenomedullin (porcine) induces endothelium-independent relaxation of porcine coronary arteries with an IC50 of 27.6 nM .
|
- HY-P7060
-
TPPT
|
iGluR
|
Neurological Disease
|
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases.
|
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P5065
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P0045
-
Matrixyl; Palmitoyl pentapeptide 3; Matrixyl (Palmitoyl Pentapeptide)
|
Peptides
|
Others
|
Palmitoyl pentapeptide 4 (Matrixyl; Palmitoyl pentapeptide 3; Matrixyl (Palmitoyl Pentapeptide) is a bioactive peptide with anti-ageing effect and has been reported used as a cosmetic ingredient [1]
|
- HY-P5239
-
|
Peptides
|
Metabolic Disease
|
Myristoyl pentapeptide-4 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
- HY-P0017
-
- HY-108719
-
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I is a potent K + channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes .
|
- HY-P5899
-
- HY-P1228
-
- HY-P2463
-
|
Arp2/3 Complex
|
Inflammation/Immunology
|
Fequesetide, a peptide segment, is the active site within the protein thymosin β4 responsible for actin binding, cell migration and wound healing .
|
- HY-P5235
-
|
Peptides
|
Others
|
Myristoyl hexapeptide-16 is a bioactive peptide with stimulate eyelash growth effect and has been reported used as a cosmetic ingredient .
|
- HY-P1589
-
|
Peptides
|
Cancer
|
β-catenin peptide is a 8-aa peptide, and can promote thymocyte positive selection.
|
- HY-P3333
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
KSPWFTTL is an immunodominant Kb-restricted epitope from the p15E transmembrane protein. KSPWFTTL can restore susceptibility of a tumor line to anti-AKR/Gross MuLV cytotoxic T lymphocytes .
|
- HY-P3333A
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
KSPWFTTL TFA is an immunodominant Kb-restricted epitope from the p15E transmembrane protein. KSPWFTTL TFA can restore susceptibility of a tumor line to anti-AKR/Gross MuLV cytotoxic T lymphocytes .
|
- HY-P5314
-
|
EGFR
STAT
|
Others
|
OK2, a specific inhibitor of the CCN2/EGFR interaction, efficiently blocks CCN2/EGFR interaction through binding to the CT domain of CCN2. OK2 can be used for kidney fibrosis and chronic kidney disease research .
|
- HY-P0170
-
TB500
1 Publications Verification
|
Peptides
|
Metabolic Disease
|
TB500 is a synthetic version of an active region of thymosin β4. TB500 is claimed to promote endothelial cell differentiation, angiogenesis in dermal tissues, keratinocyte migration, collagen deposition and decrease inflammation .
|
- HY-P0313
-
|
Influenza Virus
|
Infection
|
CEF6 is a 9-aa-long peptide corresponding to aa 418-426 of the influenza A virus (H1N1) nucleocapsid protein.
|
- HY-P1509
-
|
Peptides
|
Neurological Disease
|
Rhodopsin Epitope Tag is a 9-amino acid peptide localized within the C-terminal region of bovine rhodopsin . Rhodopsin Epitope Tag is widely used as an epitope tag and can be recognized by a number of anti-rhodopsin antibodies.
|
- HY-P1757
-
|
HIV
|
Infection
|
HIV p17 Gag (77-85) is an HLA-A*0201(A2)-restricted CTL epitope, used in the research of anti-HIV .
|
- HY-P1762
-
- HY-P1762A
-
- HY-P4100
-
|
Somatostatin Receptor
|
Others
|
Cyclic SSTR agonist octreotide is a Octreotide (HY-P0036), serving as the cyclic Somatostatin Receptor SSTR agonist .
|
- HY-P5090
-
|
Peptides
|
Others
|
Exendin-4 (1-8) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5449
-
|
Peptides
|
Others
|
p70 S6 Kinase substrate is a biological active peptide. (This peptide is a substrate for p70 ribosomal S6 kinase.)
|
- HY-P5482
-
|
EBV
|
Others
|
Epstein-barr virus BRLF1 (134-142) is a biological active peptide. (HLA-A11 restricted epitope from Epstein-Barr Virus BRLF1 (134-142).)
|
- HY-P5540
-
|
Peptides
|
Cancer
|
Oximbomotide is an immunological agent for active immunization (antineoplastic) .
|
- HY-P5249
-
|
Peptides
|
Metabolic Disease
|
KLKKTETQ is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
- HY-P1881
-
|
HPV
|
Cancer
|
HPV16-E711-20 epitope is a well-known HLA-A *0201-restricted human cytotoxic T lymphocyte (CTL) epitope of the HPV16 E7 protein that shows high-affinity binding to HLA-A2 in vitro. HPV16 CTL epitopes may be good candidates for the development of an effective peptide-based antitumor vaccine .
|
- HY-P4851
-
Manse-AKH
|
Peptides
|
Others
|
Adipokinetic Hormone (Apis mellifera ligustica, Bombyx mori, Heliothis zea, Manduca sexta) is a common peptide among various insects. Adipokinetic Hormone induces strong adipokinetic/hypertrehalosemic response. However Adipokinetic Hormone has no a glycogen-mobilizing function nor an adequate glycogen store in fat body for its effective utilization .
|
- HY-P5245
-
- HY-P10132
-
|
Ferroptosis
|
Metabolic Disease
|
PRDX3(103-112), human is a marker for ferroptosis. PRDX3 is hyperoxidated by mitochondrial lipid peroxides. PRDX3 inhibits cystine uptake after hyperoxidization .
|
- HY-P0139
-
Gap 27
5 Publications Verification
|
Gap Junction Protein
|
Cardiovascular Disease
|
Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment .
|
- HY-P1224
-
- HY-P10097
-
|
Peptides
|
Others
|
Flt2?11 is a anti‐angiogenic peptide, and specifically binds NRP‐1. Flt2?11 inhibits NRP‐1/sVEGFR‐1 interaction.
|
- HY-P1776
-
|
Insulin Receptor
|
Metabolic Disease
|
[pTyr1146][pTyr1150][pTyr1151]Insulin Receptor (1142-1153) binds to insulin and can be used as insulin receptor tyrosine kinase substrates .
|
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P1191
-
TI-JIP; JIP-1 peptide; JIPtide
|
JNK
|
Others
|
JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
- HY-P1191A
-
TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA
|
JNK
|
Others
|
JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
- HY-P2275B
-
- HY-P5431
-
|
Peptides
|
Others
|
Insulin receptor (1142-1153), pTyr1150 is a biological active peptide. (Peptide used as insulin receptor tyrosine kinase substrate.)
|
- HY-P3258
-
|
Cholinesterase (ChE)
|
Infection
|
SP-10 is a small peptide derived from S protein with an IC50 value of 1.88 nM for blocks the interaction between S protein and ACE2. SP-10 can be used for SARS-CoV research .
|
- HY-P5043
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (67-78) (human) is the 67-78 fragment of α-Synuclein. α-Synuclein (67-78) (human) promotes network activity drive and blocks KCl-induced syt1L-ab uptake .
|
- HY-P5964
-
- HY-P10133
-
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
- HY-P5144
-
- HY-P1598
-
|
Peptides
|
Others
|
GroES mobile loop is a highly flexible region of free GroES, which binds to GroEL through the residues at the tip of the loop.
|
- HY-106783
-
|
Bacterial
Antibiotic
|
Infection
|
Polymyxin B nonapeptide is a cyclic peptide obtained from Polymyxin B by proteolytic removal of its terminal amino acyl residue. Polymyxin B nonapeptide is less toxic, lacks bactericidal activity, and retains its ability to render gram-negative bacteria susceptible to several antibiotics by permeabilizing their outer membranes .
|
- HY-P1749
-
|
Influenza Virus
|
Infection
|
Influenza HA (307-319) is 13 amino acids 307 to 319 fragment of Influenza HA. Influenza HA is a glycoprotein found on the surface of influenza viruses .
|
- HY-P1736
-
|
Influenza Virus
|
Infection
|
Influenza HA (126-138) is a influenza virus hemagglutinin (HA) peptide comprising amino acids 126-138, induces thymic and peripheral T-cell apoptosis .
|
- HY-P1052A
-
|
Peptides
|
Inflammation/Immunology
|
Myelin Basic Protein(87-99) TFA is an encephalitogenic peptide that induces basic protein-specific T cell proliferation. Myelin Basic Protein(87-99) TFA causes a Th1 polarization in peripheral blood mononuclear cells with is implicated of multiple sclerosis (MS) .
|
- HY-P10212
-
UCCB01-125
|
iGluR
|
Neurological Disease
|
AVLX-125 (UCCB01-125) is a PSD-95 and PDZ domain inhibitor with Kd value of 10 nM. AVLX-125 can be used in the study of inflammatory pain .
|
- HY-P1342
-
|
Peptides
|
Neurological Disease
|
Prosaptide Tx14(A), a prosaposin-derived peptide, is a potent GPR37L1 and GPR37 agonist with EC50s of 5 and 7 nM, respectively. Prosaptide Tx14(A) increases both ERK1 and ERK2 phosphorylation in Schwann cells .
|
- HY-P1342A
-
|
Peptides
|
Neurological Disease
|
Prosaptide Tx14(A) TFA, a prosaposin-derived peptide, is a potent GPR37L1 and GPR37 agonist with EC50s of 5 and 7 nM, respectively. Prosaptide Tx14(A) TFA increases both ERK1 and ERK2 phosphorylation in Schwann cells .
|
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P4917
-
SST 14
|
Peptides
|
Others
|
Somatostatin-14 (reduced) (SST 14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5691
-
|
Bacterial
|
Infection
|
P1 is a broad-spectrum antimicrobial peptide. P1 shows antibacterial activity against Gram-positive and Gram-negative bacteria,such as B. anthracis spores and Carbapenem-resistant A. baumannii and K. pneumoniae .
|
- HY-156345S1
-
- HY-P10056
-
Human ezrin peptide (324-337)
|
HIV
|
Infection
|
HEP-1 (Human ezrin peptide (324-337)) is an orally active peptide with anti-HIV activity. HEP-1 enhances antibody titers generated by hepatitis B vaccination. HEP-1 has the potential to be studied against viral infections .
|
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
- HY-P0123
-
|
Peptides
|
Others
|
SPACE peptide is a skin penetrating peptide (SPPs). SPACE peptide can enhance topical delivery of a macromolecule, hyaluronic acid .
|
- HY-P1445
-
- HY-P2276
-
- HY-P4916
-
|
Peptides
|
Others
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2276A
-
|
Peptides
|
Others
|
Pep2-8 is a peptide which has enhanced the antagonistic activity of proprotein convertase subtilin/ kexin 9 type (PCSK9) .
|
- HY-P5259
-
|
Peptides
|
Metabolic Disease
|
Oligopeptide-6 is a bioactive peptide with moisturizing effect and has been reported used as a cosmetic ingredient .
|
- HY-P10055
-
PSMA-1
|
Peptides
|
Cancer
|
PSMA-1 is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells.?PSMA-1 is selected and polyarginine sequences R6?or R9?were added at the C terminus to generate the CTPs. FITC labeling of the peptide with an aminohexanoic acid (Ahx) linker at the N terminus produced FITC-PSMA-1, to track PSMA binding on PCa cells .?
|
- HY-P10055A
-
PSMA-1 TFA
|
PSMA
|
Cancer
|
PSMA targeting peptide TFA (PSMA-1 TFA) is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells .
|
- HY-P1560
-
Lysozyme C (46-61) (chicken)
|
Bacterial
|
Infection
|
Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
|
- HY-P1592
-
G3-C12
1 Publications Verification
|
Galectin
|
Cancer
|
G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
- HY-P4027
-
|
HCV
|
Infection
|
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
- HY-P4079
-
- HY-P4027A
-
|
HCV
|
Infection
|
HCV-1 e2 Protein (554-569) TFA is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) TFA contains a putative N-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
- HY-P5555
-
|
Bacterial
|
Infection
|
LMW peptide is an antimicrobial peptide. LMW peptide is active against Gram-positive and Gram-negative bacterial, such as B. subtilis, L. monocytogenes, E. coli, P. aeruginosa, V. cholera .
|
- HY-P1770
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (16-31), human is amino acid residues 16-31 fragment of human adrenomedullin (hADM). Adrenomedullin has appreciable affinity for the CGRP1 receptor. Adrenomedullin (16-31), human possesses pressor activity in the systemic vascular bed of the rat, but not the cat .
|
- HY-P3062
-
|
Peptides
|
Neurological Disease
|
[Tyr11]-Somatostatin is a neuroavtive peptide for proteomics research. Somatostatin is one of many neuroactive substances that influence retinal physiology .
|
- HY-163427S
-
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
- HY-P0084
-
SRIF-14; Somatostatin-14
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline with an IC50 value of 13 nM. Cyclic somatostatin can be used for the research of cardiovascular disease .
|
- HY-P1777
-
Insulin-like Growth Factor I (24-41)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) regulates somatic growth and behavioral development .
|
- HY-P1777A
-
Insulin-like Growth Factor I (24-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) TFA regulates somatic growth and behavioral development .
|
- HY-P2545
-
- HY-P4038
-
|
HCV Protease
|
Infection
|
Hepatitis C Virus S5A/5B is a synthetic peptide substrate. Hepatitis C Virus S5A/5B mimics the NS5A/5B junction of the nonstructural protein (NS), served as the substrate for the study of HCV NS3 protease activity .
|
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
- HY-P5650
-
|
Peptides
|
Infection
|
Bombolitin I is an antimicrobial peptide derived from bumblebee venom. Bombolitin I can lysate erythrocyte and liposome .
|
- HY-P0121
-
ReACp53
2 Publications Verification
|
MDM-2/p53
|
Cancer
|
ReACp53 could inhibit p53 amyloid formation and rescue p53 function in cancer cell lines.
|
- HY-P0182
-
|
Peptides
|
Others
|
NH2-QGGYTMHQDQEGDTDAGLK-COOH is a synthetic peptide chain with an amine group attached to lysine and an carboxyl group attached to glutamine.
|
- HY-P1600
-
|
Peptides
|
Others
|
Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.
|
- HY-P1886
-
|
Peptides
|
Neurological Disease
|
Kv3, Channel Containing Protein (567-585) corresponds to amino acids 567 to 585 fragment of the Kv3.1b channel containing protein. Kv3 channel protein is expressed by parvalbumin (PV)-containing pallidal neurons .
|
- HY-P2243
-
- HY-P2341
-
|
Peptides
|
Cancer
|
Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
- HY-P2464
-
|
Peptides
|
Inflammation/Immunology
|
Myosin H Chain Fragment, mouse is a fragment of the α-Myosin heavy chain peptide. Myosin H Chain Fragment can be used to induce experimental autoimmune myocarditis (EAM) mouse model .
|
- HY-P1820
-
|
Peptides
|
Infection
|
SNAP-25 (187-203), a peptide corresponding to residues 187–203 of SNAP-25, is a substrate for botulinum neurotoxin (BoNT)/A and can be used as a substrate for quantifying the activity of BoNT/C1(1-430) .
|
- HY-P4098
-
|
Peptides
|
Others
|
SynB1 is a cell penetrating polypeptide, internalized by, or is associated with lipid vesicle (LV). SynB1 can be used to lipid vesicle-mediated delivery to cells .
|
- HY-P2464A
-
|
Peptides
|
Cardiovascular Disease
|
Myosin H Chain Fragment, mouse acetate salt is a fragment of the α-Myosin heavy chain peptide. Myosin H Chain Fragment can be used to induce experimental autoimmune myocarditis (EAM) mouse model .
|
- HY-P4351
-
|
HIV
|
Others
|
HIV-1 gag Protein p24 (194-210) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4562
-
|
Peptides
|
Others
|
(D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4942
-
|
Peptides
|
Others
|
Biotinyl-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5121
-
|
Peptides
|
Cardiovascular Disease
|
γ-Fibrinogen377-395 is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation .
|
- HY-P5121A
-
|
Peptides
|
Cardiovascular Disease
|
γ-Fibrinogen377-395 TFA is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 TFA blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 TFA can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation .
|
- HY-P5495
-
|
Peptides
|
Others
|
Uroguanylin-15 (Rat) is a biological active peptide. (Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.)
|
- HY-P1479
-
|
Autophagy
CaMK
|
Neurological Disease
|
Calmodulin-Dependent Protein Kinase II (290-309) is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II .
|
- HY-P1389A
-
|
Peptides
|
Neurological Disease
|
Neuropeptide S human TFA, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human TFA can be used for Alzheimer's disease (AD) research .
|
- HY-P1389
-
|
Peptides
|
Neurological Disease
|
Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer's disease (AD) research .
|
- HY-P4156
-
|
mAChR
|
Neurological Disease
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA .
|
- HY-P4997
-
|
Peptides
|
Others
|
Tyr-Uroguanylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5396
-
|
Peptides
|
Others
|
GAD65 (524-543) is a biological active peptide. (This is amino acids 524 to 543 fragment of glutamic acid decarboxylase 65 (GAD65). It is one of the first fragments of this islet antigen to induce proliferative T cell responses in the non-obese diabetic (NOD) mouse model of spontaneous autoimmune diabetes. This peptide is a specific, possibly low affinity, stimulus for the spontaneously arising diabetogenic T cell clone BDC2.5. Immunization with p524–543 increases the susceptibility of the NOD mice to type 1 diabetes induced by the adoptive transfer of BDC2.5 T cells.)
|
- HY-P5457
-
|
Peptides
|
Others
|
BMP-2 Epitope (73-92) is a biological active peptide. (This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-b). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cells.)
|
- HY-P5766
-
- HY-P5766A
-
|
Peptides
|
Metabolic Disease
|
AChRα(97-116) TFA, a peptide, can be used to induce experimental autoimmune myasthenia gravis (EAMG)
|
- HY-P5315
-
|
Peptides
|
Others
|
eNOS pT495 decoy peptide is a specific decoy peptide to prevent T495 phosphorylation reduced eNOS uncoupling and mitochondrial redistribution. eNOS pT495 decoy peptide is used in ventilator-induced lung injury research .
|
- HY-P1351
-
|
Peptides
|
Cancer
|
Angiopep-2-cys is a conjugate of Angiopep-2 hydrochloride (HY-P2341) and cysteine. Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
- HY-P1894
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid Protein Precursor 770 (135-155) is a peptide of amyloid precursor protein isoform (APP 770). APP 770 produces Aβ40/42 .
|
- HY-P2265
-
|
Ras
|
Cancer
|
SAH-SOS1A is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM), directly and independently blocks nucleotide association, impairs KRAS-driven cancer cell viability, and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
- HY-P2265A
-
|
Ras
|
Cancer
|
SAH-SOS1A TFA is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A TFA binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM). SAH-SOS1A TFA directly and independently blocks nucleotide association. SAH-SOS1A TFA impairs KRAS-driven cancer cell viability and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
- HY-P3789
-
|
Peptides
|
Metabolic Disease
|
Prolactin-Releasing Peptide (12-31), rat is a fragment of the prolactin releasing peptide (PrRP). Prolactin-Releasing Peptide (12-31), rat shows high affinity for GPR10 receptors. Prolactin-Releasing Peptide (12-31), stimulates calcium mobilization in CHOK1 cells transfected with the PrRP receptor .
|
- HY-P4915
-
|
Peptides
|
Others
|
Big Endothelin-3 (22-41) amide (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5832
-
|
Peptides
|
Others
|
BMP2-derived peptide is a functional motif from positions 73 to 92 of the amino acid sequence of BMP-2. BMP2-derived peptide promotes osteogenic differentiation of bone marrow stromal cells (BMSCs) and enhances bone regeneration .
|
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
- HY-P5547
-
|
Bacterial
|
Infection
|
Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection
|
- HY-P10153
-
|
Peptides
|
Others
|
gH625 is a cell-penetrating viral peptide which is a part of glycoprotein H of Herpes simplex virus type I. gH625 is able to cross the cell membrane and to transport many conjugated cargoes into the cytosol. gH625 is permeable to the blood-brain barrier (BBB) and can enter the rat brain in vivo without toxic effects. gH625 can be used for siRNA delivery research .
|
- HY-P2247
-
|
JNK
|
Cancer
|
JTP10-△-R9 TFA is a selective JNK2 peptide inhibitor, with an IC50 of 89 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3 .
|
- HY-P2254
-
|
Peptides
|
Cancer
|
H3K27(Me3) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me) .
|
- HY-P2252
-
|
Peptides
|
Cancer
|
H3K27(Me) (15-34), a histone peptide, is a repressive chromatin markderived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me) .
|
- HY-P2253
-
|
Peptides
|
Cancer
|
H3K27(Me2) (15-34), a histone peptide, is a repressive chromatin mark derived from human histone. Polycomb Repressive Complex 2 (PRC2) is a multiprotein complex that catalyzes the methylation of H3K27(Me) .
|
- HY-P1206
-
|
Somatostatin Receptor
|
Neurological Disease
|
CH 275 is a peptide analog of somatostatin and binds preferably to somatostatin receptor 1 (sst1) with a Ki of 52 nM . CH 275 acts as a potent and selective sst1 agonist (IC50=30.9 nM) and also displays IC50 values of 345 nM, >1 μM, >10 μM, >10 μM for human sst3, sst4, sst2 and sst5, respectively . CH 275 can be used for the research of alzheimer’s disease .
|
- HY-P10081
-
- HY-P1783A
-
|
Influenza Virus
|
Infection
|
M2e, human TFA, consisting of the 23 extracellular residues of M2 (the third integral membrane protein of influenza A), has been remarkably conserved in all human influenza A. M2e, human TFA is a valid and versatile vaccine candidate to protect against any strain of human influenza A .
|
- HY-P10048
-
- HY-P1023
-
|
Peptides
|
Metabolic Disease
|
VIP(6-28)(human, rat, porcine, bovine) is an effective antagonist of the actions of exogenous vasoactive intestinal peptide (VIP) on cAMP.
|
- HY-P2284
-
|
Peptides
|
Cancer
|
AD 01, a 24 amino acid peptide of FKBPL (FK506-binding protein like), possesses potent anti-angiogenic activity. AD 01 bind to the CD44 receptor and inhibit tumour cell migration in a CD44 dependant manner .
|
- HY-P4913
-
SQ 19301
|
Peptides
|
Others
|
Secretin (5-27, porcine) (SQ 19301) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0259
-
- HY-P1949A
-
|
Peptides
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
- HY-P3129
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
KRAS G13D peptide, 25 mer, a KRAS activating oncogene mutation peptide, is an immune potentiator extracted from patent WO2018144775A1. KRAS G13D peptide, 25 mer can be used to prepare KRAS vaccine .
|
- HY-P1949
-
|
Peptides
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
- HY-P2719
-
|
Peptides
|
Neurological Disease
|
Fibronectin Type III Connecting Segment Fragment 1-25 is a peptide that is responsible for melanoma cell adhesion, and plays an important role in development of the peripheral nervous system in chicken .
|
- HY-P5003
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Collagen Type II Fragment is an anti-inflammatory peptide that potently inhibits collagen-induced arthritis (CIA) in mice. Collagen Type II Fragment can be used for research on inflammation and immunity .
|
- HY-P5054
-
- HY-P10101
-
APTscr
|
Peptides
|
Others
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
- HY-P10115
-
|
STAT
|
Cancer
|
APT STAT3 is a specific STAT3-binding peptide. APT STAT3 can bind STAT3 with high specificity and affinity (~231 nmol/L). APT STAT3 is a tractable agent for translation to target the broad array of cancers harboring constitutively activated STAT3 .
|
- HY-P0233
-
- HY-P0204
-
- HY-P0204A
-
- HY-P0233A
-
|
Phospholipase
|
Infection
Cancer
|
Melittin TFA is a PLA2 activator, stimulates the activity of the low molecular weight PLA2, while it does not the increase activity of the high molecular weight PLA2 .
|
- HY-P5379
-
|
Proteasome
|
Others
|
Calpastatin subdomain B is a biological active peptide. (inhibit calpain activity)
|
- HY-P5606
-
|
Bacterial
|
Infection
|
Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 3 has cytotoxicity on tumor cells and spermicidal effect. Maximin 3 has significant anti-HIV activity .
|
- HY-P5609
-
|
Bacterial
|
Infection
|
Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 5 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5656
-
|
Peptides
|
Infection
|
Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P10160
-
chCATH-2
|
Bacterial
|
Infection
|
Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates .
|
- HY-P0238
-
|
Peptides
|
Cancer
|
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
|
- HY-P1244
-
Secretin (rat)
|
Secretin Receptor
|
Neurological Disease
|
Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K + from the pancreas.
|
- HY-P1465
-
- HY-P1535
-
Porcine secretin acetate
|
Secretin Receptor
|
Inflammation/Immunology
|
Secretin, porcine (Porcine secretin acetate) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid.
|
- HY-P1784
-
|
Secretin Receptor
|
Endocrinology
|
Secretin, canine is an endocrine hormone that stimulates the secretion of bicarbonate-rich pancreatic fluids. Secretin, canine can regulates gastric chief cell function and paracellular permeability in canine gastric monolayers by a Src kinase-dependent pathway .
|
- HY-P1244A
-
Secretin (rat) (TFA)
|
Secretin Receptor
|
Neurological Disease
|
Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K + from the pancreas .
|
- HY-P1465A
-
- HY-P1535A
-
Porcine secretin TFA
|
Secretin Receptor
|
Inflammation/Immunology
|
Secretin, porcine TFA (Porcine secretin TFA) is a 27-amino acid peptide, acting on pancreatic acinar cells and ductal epithelial cells stimulating the production of bicarbonate rich fluid .
|
- HY-P5910
-
|
MDM-2/p53
Apoptosis
|
Cancer
|
Azurin p28 peptide is a tumor-penetrated antitumor peptide. Azurin p28 peptide redues proteasomal degradation of p53 through formation of a p28: p53 complex. Azurin p28 peptide induces apoptosis or cell cycle arrest. Azurin p28 peptide inhibits p53-positive tumor growths. Azurin p28 peptide shows antiangiogenic effect by inhibiting phosphorylation of VEGFR-2, FAK and Akt .
|
- HY-P5611
-
|
Peptides
|
Infection
|
Maximin 7 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5614
-
|
Peptides
|
Infection
|
Maximin 9 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5666
-
|
Bacterial
|
Infection
|
Maximin 15 is an antimicrobial peptide derived from the toad brain. Maximin 15 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 9.4, 18.8, 75 μg/mL, respectively .
|
- HY-P5671
-
|
Bacterial
|
Infection
|
Maximin 32 is an antimicrobial peptide derived from the toad brain. Maximin 32 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 9.4, 18.8 μg/mL, respectively .
|
- HY-P5683
-
|
Bacterial
|
Infection
|
Maximin 45 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus, E. coli, B. subtilis (MIC: 4.7, 9.4, 75 μg/mL). Maximin 45 has hemolytic activities against human and rabbit red cells .
|
- HY-P5689
-
|
Bacterial
|
Infection
|
Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells .
|
- HY-P10106
-
|
PAK
|
Cancer
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
- HY-P10107
-
|
Peptides
|
Others
|
TAT-PAK18 R192A is an inactive Tat-Pak peptide. TAT-PAK18 R192A does not have any effect in the translocation of Rac1 triggered by any of the interrogated proteins .
|
- HY-P1547
-
|
Peptides
|
Neurological Disease
|
Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone.
|
- HY-P1141A
-
|
GCGR
|
Metabolic Disease
|
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor .
|
- HY-P1081
-
|
Proteasome
|
Inflammation/Immunology
|
Acetyl-Calpastatin(184-210)(human) is a potent, selective and reversible calpain inhibitor with Ki values of 0.2 nM and 6 μM for µ-calpain and cathepsin L, respectively .
|
- HY-P1081A
-
|
Proteasome
|
Inflammation/Immunology
|
Acetyl-Calpastatin(184-210)(human) TFA is a potent, selective and reversible calpain inhibitor with Ki values of 0.2 nM and 6 μM for µ-calpain and cathepsin L, respectively .
|
- HY-P1133
-
Rat galanin(2-29)
|
Peptides
|
Others
|
Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM) .
|
- HY-P5587
-
|
Fungal
|
Infection
|
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5005
-
|
Biochemical Assay Reagents
|
Cancer
|
VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study of cancers such as non-small cell lung cancer (NSCLC) .
|
- HY-P10080
-
- HY-P10169
-
|
Proteasome
|
Others
|
Acetyl-Calpastatin(184-210)(human), Negative Control is a control scramble peptide of Acetyl-Calpastatin(184-210)(human) (HY-P1081). Acetyl-Calpastatin(184-210)(human) is a potent, selective and reversible calpain inhibitor .
|
- HY-P1014
-
- HY-P1127
-
- HY-P1132A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect .
|
- HY-P1159
-
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
[D-p-Cl-Phe6,Leu17]-VIP is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP has no activity on glucagon, secretin or GRF receptors .
|
- HY-P1159A
-
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
[D-p-Cl-Phe6,Leu17]-VIP TFA is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP TFA has no activity on glucagon, secretin or GRF receptors .
|
- HY-P4634
-
|
Peptides
|
Others
|
(Lys(Me)327)-Histone H3 (21-44)-Gly-Lys(biotinyl) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5115
-
|
Peptides
|
Others
|
(Lys(Me,Me)27)-Histone H3 (21-44)-Gly-Lys(Biotinyl) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4927
-
- HY-P4969
-
- HY-P0165
-
ITM077; R1583; BIM51077
|
GCGR
|
Metabolic Disease
|
Taspoglutide is a long-acting glucagon-like peptide 1 (GLP-1) receptor agonist developed for treatment of type 2 diabetes, with an EC50 value of 0.06 nM.
|
- HY-P0054
-
Glucagon-like peptide-1 (GLP-1)(7-36), amide acetate; Human GLP-1 (7-36), amide acetate
|
GCGR
|
Metabolic Disease
|
GLP-1(7-36), amide acetate is a major intestinal hormone that stimulates glucose-induced insulin secretion from β cells.
|
- HY-P0055
-
|
GCGR
|
Metabolic Disease
|
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
|
- HY-P0209
-
- HY-P0054A
-
Glucagon-like peptide-1 (GLP-1)(7-36), amide; Human GLP-1 (7-36), amide
|
GCGR
|
Metabolic Disease
|
GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretion.
|
- HY-P0055A
-
|
GCGR
|
Metabolic Disease
|
GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion .
|
- HY-P1866
-
- HY-P1866A
-
|
Opioid Receptor
|
Neurological Disease
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .
|
- HY-108795A
-
GLP-1-Gly8 TFA; GLP-1 (7-36) analog TFA
|
GLP Receptor
|
Metabolic Disease
|
Albiglutide fragment (GLP-1 (7-36) analog) TFA is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment TFA significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies .
|
- HY-P3141
-
- HY-108795
-
GLP-1-Gly8; GLP-1 (7-36) analog
|
GLP Receptor
|
Metabolic Disease
|
Albiglutide fragment (GLP-1 (7-36) analog) is an active fragment of Albiglutide (7-36) and a glucagon-like peptide-1 (GLP-1) analog (a long-acting GLP-1 receptor agonist). Albiglutide is produced by the fusion of DPP-4 resistant GLP-1 dimer with the human albumin gene. Moreover, Albiglutide fragment significantly reduces glycosylated hemoglobin (A1C) and is used in type 2 diabetes (T2D) studies .
|
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
- HY-P4924
-
- HY-P1471
-
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
- HY-P1520
-
|
GnRH Receptor
|
Neurological Disease
|
Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
- HY-P0069A
-
- HY-P1471A
-
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
- HY-P1160A
-
|
GCGR
|
Metabolic Disease
|
Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes .
|
- HY-P1160
-
|
GCGR
|
Metabolic Disease
|
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes .
|
- HY-P1520A
-
|
GnRH Receptor
|
Neurological Disease
|
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
- HY-P4830
-
|
Peptides
|
Others
|
Acetyl-Tau Peptide (244-274) (Repeat 1 Domain) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4691
-
|
Peptides
|
Others
|
(Ser(PO3H2)396,404)-Tau Peptide (379-408) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
- HY-P5848
-
|
nAChR
|
Neurological Disease
|
αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10. αO-Conotoxin GeXIVA shows analgesic in animal models of pain .
|
- HY-P5578
-
|
GCGR
|
Metabolic Disease
|
A8SGLP-1 is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 reduces blood glucose in db/db mice without affecting its function .
|
- HY-P5578A
-
|
GCGR
|
Metabolic Disease
|
A8SGLP-1 TFA is an orally active GLP-1 analogue that the alanine at position 8 substituted with serine. A8SGLP-1 TFA reduces blood glucose in db/db mice without affecting its function .
|
- HY-P5820
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
- HY-P2535
-
|
GLP Receptor
|
Metabolic Disease
|
Glucagon-Like Peptide 1 (GLP-1) (7-36)-Lys (Biotin), amide, human is an C-terminal-labelled biotinylated GLP-1 (7-36) amide.
|
- HY-P5802
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin FVIA is an N-type Ca 2+channel (Ca v 2.2)
inhibitor. ω-Conotoxin FVIA reduces mechanical and thermal pain abnormalities
in a rat model of caudal nerve injury. ω-Conotoxin FVIA can be used in the
study of highly effective pain relievers with low side effects
.
|
- HY-P5805
-
- HY-P0069
-
AM-111; XG-102
|
JNK
|
Others
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
- HY-P4807
-
Hez-PBAN
|
Peptides
|
Neurological Disease
|
Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) (PBAN), a member of the PBAN/Pyrokinin neuropeptide family, characterized by a common amino acid sequence FXPRLamide motif in the C-terminus .
|
- HY-P4813
-
|
Peptides
|
Metabolic Disease
|
Preptin, an osteogenic peptide product of the pancreatic beta-cell, corresponds to Asp 69-Leu 102 of pro-IGF-II .
|
- HY-P4720
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis .
|
- HY-P4841
-
|
GLP Receptor
|
Others
|
GLP-1 (7-36)-Lys(biotinyl) amide (human, bovine, guinea pig, mouse, rat) is a biotinylated GLP-1 fragment, corresponding to the 7-36 sequence of GLP-1.
|
- HY-P5804
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin CVIF is a selective Cav2.2 channel inhibitor with an IC50 of 34.3 nM in rat isolated DRG neurons. ω-Conotoxin CVIF block of Cav2.2 channels is weakly reversible .
|
- HY-P1231
-
- HY-P1065A
-
|
HIV
Apelin Receptor (APJ)
|
Infection
Cardiovascular Disease
Metabolic Disease
|
Apelin-36(rat, mouse) TFA is an endogenous orphan G protein-coupled receptor APJ agonist. Apelin-36(rat, mouse) TFA binds to APJ receptors with an IC50 of 5.4 nM, and potently inhibits cAMP production with an EC50 of 0.52 nM. Apelin-36(rat, mouse) TFA blocks entry of some HIV-1 and HIV-2 strains into NP-2/CD4 cells expressing APJ .
|
- HY-P0189A
-
- HY-P2497
-
|
GCGR
|
Neurological Disease
|
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats .
|
- HY-P0173
-
|
Peptides
|
Cancer
|
Chlorotoxin(linear) is a linear 36 amino-acid peptide which can be used in Chlorotoxin related research.
|
- HY-P0199
-
- HY-P1537
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
Endocrinology
|
Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4.
|
- HY-P1145
-
HuGLP-1
|
GCGR
|
Metabolic Disease
|
Glucagon-like peptide 1 (1-37), human is a highly potent agonist of the GLP-1 receptor.
|
- HY-P1833
-
|
Peptides
|
Neurological Disease
|
Egg Laying Hormone, aplysia is a neuropeptide synthesized by the bag cell neurons, which contains 36 amino acids and can stimulate egglaying and ovulation in Aplysia via electrical discharge triggering of neurons. Egg-laying hormone of Aplysia induces a voltage-dependent slow inward current carried by Na' in an identified motoneuron .
|
- HY-P1145A
-
HuGLP-1 TFA
|
GCGR
|
Metabolic Disease
|
Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.
|
- HY-P2231A
-
MEDI0382 acetate
|
GCGR
|
Metabolic Disease
|
Cotadutide (MEDI0382) acetate is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide acetate exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide acetate can be used in the research of obesity and type 2 diabetes (T2D) .
|
- HY-P3366
-
XW003
|
GCGR
|
Metabolic Disease
|
Ecnoglutide (XW003) is a long-acting, cAMP-biased glucagon-like peptide 1 (GLP-1) receptor agonist. Ecnoglutide can be used for research of T2DM and obesity .
|
- HY-P2231
-
MEDI0382
|
GCGR
|
Metabolic Disease
|
Cotadutide (MEDI0382) is a potent dual agonist of glucagon-like peptide-1 (GLP-1) and GCGR with EC50 values of 6.9 pM and 10.2 pM, respectively. Cotadutide exhibits ability to facilitate both weight loss and glycaemic control, and alleviate fibrosis. Cotadutide can be used in the research of obesity and type 2 diabetes (T2D) .
|
- HY-P4060
-
- HY-P5333
-
UB311 immunogen I
|
Peptides
|
Others
|
Aβ1-14-εK-KKK-MvF5 Th (UB311 immunogen I) is a biological active peptide. (one of UB-311's Aβ1–14–targeting peptides (B-cell epitope))
|
- HY-P5815
-
Glucagon-like Peptide 1 (1-36) amide (human, rat)
|
GLP Receptor
GCGR
|
Metabolic Disease
|
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)
) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells .
|
- HY-P5662
-
|
Peptides
|
Infection
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
- HY-P0014
-
- HY-P1157
-
- HY-P1858
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
- HY-P1858A
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
- HY-P3019
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with Ki values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion .
|
- HY-P3365
-
|
Bacterial
|
Inflammation/Immunology
Cancer
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory .
|
- HY-P4459
-
- HY-P5009
-
|
Peptides
|
Others
|
Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5450
-
|
PDK-1
|
Others
|
PDKtide is a biological active peptide. (This peptide is a substrate for PDK1 (Phosphatidylinositide-Dependent Kinase 1).)
|
- HY-107528
-
|
β-catenin
GSK-3
|
Cancer
|
FRATtide is a peptide derived from the GSK-3 binding protein that inhibits the phosphorylation of Axin and β-catenin. FRATtide inhibits GSK-3 binding to Axin .
|
- HY-P5791
-
- HY-P5786
-
- HY-P5815A
-
Glucagon-like Peptide 1 (1-36) amide (human, rat) (TFA)
|
GLP Receptor
GCGR
|
Metabolic Disease
|
GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat)
) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells .
|
- HY-P0014S2
-
|
Isotope-Labeled Compounds
|
Others
|
Liraglutide- 13C6, 15N (TFA)is the 13C and 15N labeledLiraglutide(HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
- HY-13443
-
Exenatide
|
GCGR
|
Metabolic Disease
|
Exendin-4 (Exenatide), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
- HY-13443A
-
Exenatide acetate
|
GCGR
|
Metabolic Disease
|
Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-acting glucagon-like peptide-1 receptor agonist with an IC50 of 3.22 nM.
|
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P1543
-
|
Peptides
|
Neurological Disease
|
Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.
|
- HY-P2282
-
|
STAT
|
Cancer
|
APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity .
|
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
- HY-P2542
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo .
|
- HY-P1440A
-
|
Potassium Channel
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
- HY-P1440
-
- HY-P0014S
-
- HY-P4790
-
|
PI3K
Akt
|
Metabolic Disease
|
Acetyl-Exenatideyes is an acetylated derivative of Exenatide. Exenatide has the function similar to insulin, which can be used for research of type 2 diabetes. Exenatide can promote Th17 differentiation, inhibits Tregs differentiation, downregulates PI3K/Akt/FoxO1 phosphorylation .
|
- HY-P4724
-
|
Peptides
|
Metabolic Disease
|
(β-Asp28)-Exenatide is a potential degradation product of exenatide produced by the formation and cleavage of asparagine.
|
- HY-P4386
-
|
GLP Receptor
|
Metabolic Disease
|
(Asp28)-Exenatide is a degradation product of exenatide (HY-13443). (Asp28)-Exenatide can be used as a GLP-1R agonist .
|
- HY-P4407
-
|
Peptides
|
Metabolic Disease
|
(D-Asn28)-Exenatide is an Exenatide (HY-13443) impurity. Exenatide is a long-acting glucagon-like peptide-1 receptor agonist .
|
- HY-P4410
-
|
Peptides
|
Metabolic Disease
|
(D-Asp28)-Exenatide is an Exenatide (HY-13443) impurity. Exenatide is a long-acting glucagon-like peptide-1 receptor agonist .
|
- HY-P4503
-
- HY-P4856
-
|
PKC
|
Endocrinology
|
pTH-Related Protein (1-40) (human, mouse, rat) stimulates calcium uptake in rat intestinal cells through PTHR1 receptor and PKCα/β signaling pathways. pTH-Related Protein (1-40) up-regulates parathyroid hormone 1 receptor (PTHR1) protein, four transcellular calcium transporters, potential vanillin member 6 (TRPV6), calcium-binding protein-D9K (CaBP-D9k), sodium-calcium Exchanger 1 (NCX1) and plasma membrane calcium ATPase 1 (PMCA1) .
|
- HY-P4929
-
|
Peptides
|
Others
|
Biotinyl-(Gln1)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0014S1
-
|
Isotope-Labeled Compounds
|
Others
|
Liraglutide- 13C5, 15N (tetraTFA)is the 13C and 15N labeledLiraglutide(HY-P0014) . Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
- HY-13443F
-
|
Peptides
|
Others
|
Exendin 4, biotin labeled is a biological active peptide. (Biotin labeled HY-13443)
|
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
- HY-P5809
-
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
- HY-P10116
-
APTscr-9R
|
Peptides
|
Others
|
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
|
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
- HY-P0276
-
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
- HY-P1533
-
- HY-P1533A
-
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P1282
-
- HY-P0276A
-
Gastric Inhibitory Peptide (GIP), human TFA
|
Insulin Receptor
|
Metabolic Disease
|
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
- HY-P3580
-
Human N-acetyl GIP
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .
|
- HY-P3584
-
(Pro3) Gastric Inhibitory Peptide, human
|
Insulin Receptor
|
Metabolic Disease
|
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes .
|
- HY-P4398
-
|
Peptides
|
Others
|
(Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4657
-
|
Peptides
|
Endocrinology
|
Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like activity. Human Growth Hormone (1-43) can be used to study the function and metabolic pathways of growth hormone, a potential obesity-related factor .
|
- HY-P4730
-
|
Peptides
|
Others
|
(β-D-Asp28)-Exenatide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4753
-
|
Peptides
|
Others
|
Met(O)14-Exenatide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5080
-
|
Peptides
|
Others
|
Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3580A
-
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .
|
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
- HY-P5390
-
|
Peptides
|
Others
|
GIP, rat is a biological active peptide. (GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.)
|
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
- HY-P1434
-
|
Insulin Receptor
|
Metabolic Disease
|
[Pro3]-GIP (Mouse) is a GIP receptor antagonist (IC50: 2.6 μM). [Pro3]-GIP (Mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (Mouse) can be used for research of type 2 diabetes .
|
- HY-P3247
-
|
Insulin Receptor
|
Neurological Disease
Metabolic Disease
|
[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc
|
- HY-P5563
-
|
Bacterial
|
Infection
|
PP113 is an antimicrobial peptide is active against Gram-negative and Gram-positive bacteria, E.coli (MIC: 73.3 uM), B. subtilis (MIC: 23.3 uM), S. aureus (MIC: 13 uM), S. lutea (MIC: 16.7 uM), and B. pumilu (MIC: 23.3 uM) .
|
- HY-P5390A
-
|
Peptides
|
Others
|
GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as gastric inhibitory polypeptide) is a 42-amino acid peptide released by K cells in the duodenum and jejunum in response to food intake. GIP and GLP (gastric-like peptide) are both intestinal A member of the insulinotropic hormone peptide family that stimulates insulin secretion from pancreatic beta cells and appears to also promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity function in the mechanism.
|
- HY-P3491
-
PEX 168
|
GLP Receptor
|
Metabolic Disease
|
Pegloxenatide is a glucagon-like peptide-1 receptor (GLP-1 RA) agonist. Pegloxenatide can be used for type 2 diabetes research .
|
- HY-P3584A
-
(Pro3) Gastric Inhibitory Peptide, human TFA
|
Insulin Receptor
|
Metabolic Disease
|
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes .
|
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
- HY-P0119
-
|
GCGR
MEK
Akt
MMP
JNK
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe −/− Irs 2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation .
|
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P5161A
-
|
GCGR
|
Metabolic Disease
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
- HY-P5161
-
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
- HY-P5584
-
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P5645
-
Human liver expressed antimicrobial peptide-2
|
Peptides
|
Infection
|
LEAP-2 is an antimicrobial peptide derived from human blood .
|
- HY-P5747
-
|
Peptides
|
Others
|
Glycocin F is a antimicrobial peptide with activity against L. plantarum .
|
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P1731
-
LY3298176
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide (LY3298176) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
- HY-P1731B
-
LY3298176 hydrochloride
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide hydrochloride (LY3298176 hydrochloride) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide hydrochloride has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
- HY-P1731A
-
LY3298176 TFA
|
GLP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
Tirzepatide TFA (LY3298176 hydrochloride) is a glucose-dependent insulin nutritive polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptor dual agonist. Tirzepatide TFA has neuroprotective effects and can be used in the study of type 2 diabetes, diabetes-related neuropathy and obesity .
|
- HY-P3255
-
- HY-P3506
-
LY3437943
|
GCGR
GLP Receptor
|
Metabolic Disease
|
Retatrutide (LY3437943) is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide can be used for the research of obesity .
|
- HY-P3506A
-
LY3437943 TFA
|
GLP Receptor
GCGR
|
Metabolic Disease
|
Retatrutide (LY3437943) TFA is a triple agonist peptide of the glucagon receptor (GCGR), glucosedependent insulinotropic polypeptide receptor (GIPR), and glucagon-like peptide-1 receptor (GLP-1R). Retatrutide TFA binds human GCGR, GIPR, and GLP-1R with EC50 values of 5.79, 0.0643 and 0.775 nM, respectively. Retatrutide TFA can be used for the research of obesity .
|
- HY-P10018
-
SAR425899
|
GLP Receptor
GCGR
|
Metabolic Disease
|
Bamadutide (SAR425899) is a potent dual glucagon-like peptide-1 receptor/glucagon receptor agonist. Bamadutide (SAR425899) improves postprandial glucose control by significantly enhancing β-cell function and slowing glucose absorption rate in vivo. Bamadutide (SAR425899)can be used for type 2 diabetes research .
|
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
- HY-P1838
-
|
Peptides
|
Cardiovascular Disease
|
Proadrenomedullin (45-92), human, a mid-regional fragment of proadrenomedullin (MR-proADM), comprises amino acids 45–92 of pre-proADM. Proadrenomedullin (45-92), human has a longer half-life, is relatively stable and is produced in equimolar amounts to adrenomedullin (ADM), making it a surrogate for plasma levels of ADM gene products .
|
- HY-P2469
-
BNP-45, mouse
|
Peptides
|
Cardiovascular Disease
|
Brain Natriuretic Peptide-45, mouse (BNP-45, mouse) is a circulating form of mouse brain natriuretic peptide isolated from mouse heart with potent hypotensive and natriuretic potency .
|
- HY-P5818
-
- HY-P2312
-
HβD-3
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml .
|
- HY-P4723
-
|
Peptides
|
Others
|
Intermedin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
- HY-P5824
-
- HY-P5808
-
|
Peptides
|
Neurological Disease
|
lota-conotoxin RXIA is an agonist of voltage-gated
sodium channels (Nav1.2, 1.6, 1.7). Iota-conotoxin RXIA
can induce repetitive action potential and seizure in motor axons of frogs
after intracranial injection in mice .
|
- HY-P5808A
-
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
- HY-P4976
-
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
- HY-P3479
-
- HY-P5551
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells .
|
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P5151
-
|
Peptides
|
Others
|
LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae .
|
- HY-P5063
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
- HY-P5064
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide that was first isolated from the porcine hypothalamus. Galanin-Like Peptide (porcine) has a high affinity for the GALR2 receptor (IC50 of 0.24 nM) and a lower affinity for the GALR1 receptor (IC50 of 4.3 nM) .
|
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
- HY-108814
-
DX-88
|
Ser/Thr Protease
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
- HY-P5807
-
β-Mammal toxin Cn2
|
Peptides
|
Neurological Disease
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
- HY-P5354
-
|
Peptides
|
Others
|
FRETS-VWF73 is a biological active peptide. (FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.)
|
- HY-P5267
-
|
Peptides
|
Metabolic Disease
|
Palmitoyl dipeptide-7 is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
- HY-P0240
-
- HY-P0240A
-
- HY-P5244
-
- HY-P5248
-
- HY-P0275
-
- HY-P4664
-
|
Peptides
|
Inflammation/Immunology
|
VHLTP is the N-terminal pentapeptide of human hemoglobin beta. VHLTP binds to cell membranes and serves as a ligand for anti-HbA1c antibodies .
|
- HY-P4684
-
PTHRP (107–111)
|
PTHR
|
|
Osteostatin, a fragment of parathyroid hormone-related protein (PTHrP) 107-111, promotes bone repair in animal models of bone defects and prevents bone erosion in inflammatory arthritis, inhibits collagen-induced arthritis and inhibits osteoclastic bone resorption directly. Osteostatin can be used for inflammation and immunology research .
|
- HY-P5269
-
|
Peptides
|
Metabolic Disease
|
Palmitoyl tetrapeptide-10isa bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
- HY-P5070
-
|
Peptides
|
Neurological Disease
|
Gluten Exorphin A5 is a fragment from wheat gluten with neuroprotective effects. Gluten Exorphin A5 produces various effects not only in the peripheral nervous systems but also in the central nervous system .
|
- HY-P10015
-
|
Peptides
|
Endocrinology
|
Orenetide is an innovative peptide drug developed in the study to restore sexual desire and concomitant functions in women with HSDD (Hypoactive desire disorder)
|
- HY-P0226
-
- HY-101297
-
Z-IE(OMe)TD(OMe)-FMK
|
Caspase
|
Cancer
|
Z-IETD-FMK (Z-IE(OMe)TD(OMe)-FMK) is a selective and cell permeable caspase-8 inhibitor . Z-IETD-FMK is also a granzyme B inhibitor .
|
- HY-P1347
-
|
Peptides
|
Metabolic Disease
|
RETF-4NA, a chymase-specific substrate, is a sensitive and selective substrate for chymase when free or bound to α2M .
|
- HY-P1347A
-
|
Peptides
|
Metabolic Disease
|
RETF-4NA TFA, a chymase-specific substrate, is a sensitive and selective substrate for chymase when free or bound to α2M .
|
- HY-P1311
-
|
Peptides
|
Others
|
RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
|
- HY-P1311A
-
|
Peptides
|
Others
|
RLLFT-NH2 TFA is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
|
- HY-P2518
-
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
Protease-Activated Receptor-1, PAR-1 Agonist is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
- HY-P2518A
-
|
Protease Activated Receptor (PAR)
|
Cancer
|
Protease-Activated Receptor-1, PAR-1 Agonist TFA is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist TFA corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
- HY-P4798
-
Human PTHRP(107-111) amide
|
PTHR
|
Others
|
Osteostatin (1-5) amide (human, bovine, dog, horse, mouse, rabbit, rat) (Human PTHrP (107-111) amide) is a C-terminal parathyroid hormone-related protein fragment that can inhibit bone resorption .
|
- HY-P5106
-
|
Peptides
|
Others
|
α-Synuclein (32-37) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4279
-
- HY-P5702
-
|
Bacterial
Apoptosis
Fungal
|
Infection
|
EP3 is an antimicrobial peptide. EP3 has antibacterial and antifungal activities. EP3 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 12.85 μg/mL. EP3 also shows antitumor activity against cancer cells, and induces cell apoptosis .
|
- HY-113963
-
|
Apoptosis
|
Cancer
|
Ac-?IETD-?CHO is a potent, reversible inhibitor of granzyme B and caspase-8. Ac-?IETD-?CHO inhibits Fas-mediated apoptotic cell death, hemorrhage, and liver failure. Ac-?IETD-?CHO also inhibits cytotoxic T lymphocytes induced cell death .
|
- HY-P10082
-
|
Caspase
|
Others
|
Ac-VETD-AMC is a synthetic peptide substrate for caspase 8. Ac-VETD-AMC also has potential to assess functional activity of recombinant phytaspase .
|
- HY-P10096
-
PYLKTK
|
Peptides
|
Others
|
STAT3-IN-22, negative control (PYLKTK) is a peptide that serves as a control peptide for phosphotyrosine .
|
- HY-P10146
-
|
Caspase
|
Cancer
|
Ac-LETD-CHO
is a caspases 8 inhibitor. Ac-LETD-CHO has specific inhibition to casp-8 with
an IC50 value of 6.71 nM. Ac-LETD-CHO
can be used for the research of anticancer .
|
- HY-P0318
-
- HY-P0141
-
|
Akt
|
Others
|
Akt/SKG Substrate Peptide is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or
MAPK1 .
|
- HY-P0141A
-
|
Akt
|
Others
|
Akt/SKG Substrate Peptide TFA is a synthetic peptide suitable as a substrate for Akt/PKB, which is not phosphorylated by p70S6K or MAPK1 .
|
- HY-P1044A
-
LVV-hemorphin-4 TFA
|
Peptides
|
Neurological Disease
|
Spinorphin TFA is an inhibitor of enkephalin-degrading enzymes. Spinorphin inhibits aminopeptidase, dipeptidyl aminopeptidase III, angiotensin-converting enzyme and enkephalinase. Spinorphin possesses an antinociceptive effect .
|
- HY-P1319
-
|
Opioid Receptor
|
Inflammation/Immunology
|
Nociceptin (1-7) is the N-terminal bioactive fragment of nociceptin (HY-P0183). Nociceptin (1-7) is a potent ORL1 (NOP) receptor agonist with antinociceptive activity. Nociceptin (1-7) combines with nociceptin reduces hyperalgesia in vivo .
|
- HY-P1319A
-
|
Opioid Receptor
|
Inflammation/Immunology
|
Nociceptin (1-7) TFA is the N-terminal bioactive fragment of nociceptin (HY-P0183). Nociceptin (1-7) TFA is a potent ORL1 (NOP) receptor agonist with antinociceptive activity. Nociceptin (1-7) TFA combines with nociceptin reduces hyperalgesia in vivo .
|
- HY-105042
-
- HY-P4082
-
HER2-binding peptide
|
EGFR
|
Cancer
|
ErbB-2-binding peptide (HER2-binding peptide) is a tumor-binding peptide. ErbB-2-binding peptide has the potential for cancer research .
|
- HY-P1663
-
|
Peptides
|
Others
|
ATWLPPR Peptide is a biological active peptide. (This peptide is a specific VEGFR2/KDR heptapeptide antagonist, it binds VEGFR2 (KDR/flk), completely inhibiting VEGF binding to KDR and preventing VEGF-induced angiogenesis in-vivo. It specifically inhibits human endothelial cell proliferation in-vitro and totally abolishes VEGF-induced angiogenesis in-vivo.)
|
- HY-P5360
-
- HY-P5481
-
|
Peptides
|
Others
|
DABCYL-LPETG-EDANS is a biological active peptide. (This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.)
|
- HY-P5965
-
|
Peptides
|
Others
|
BiP substrate is a peptide substrate of BiP that can be used to measure the BiP ATPase activity .
|
- HY-105042A
-
Selanc diacetate; TP-7 diacetate
|
Peptides
|
Neurological Disease
|
Selank (Selanc) acetate is a synthetic peptide derived from tuftsin. Selank acetate has anxiolytic activity, and is a nootropic, neuropsychotropic, antidepressant, and antistress compound .
|
- HY-P1452A
-
|
Bacterial
|
Infection
|
RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
|
- HY-P1778
-
|
HPV
|
Infection
|
HPV16 E7 (86-93) is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) is immunogenic in cervical carcinomas .
|
- HY-P1816
-
|
Integrin
|
Cancer
|
The connecting segment 1 (CS-1) is a cell attachment domain located in the type III homology connecting segment (IIICS) of fibronectin. Fibronectin CS1 Peptide lacks the Arg-Gly-Asp-containing domain, actively inhibits tumor metastases in spontaneous and experimental metastasis models .
|
- HY-P1778A
-
|
HPV
|
Infection
|
HPV16 E7 (86-93) TFA is a human leukocyte antigen (HLA)-A2.1 restricted HPV16 E7-derived peptide. HPV16 E7 (86-93) TFA is immunogenic in cervical carcinomas .
|
- HY-P1077
-
|
mGluR
Phosphodiesterase (PDE)
Apoptosis
Calmodulin
|
Inflammation/Immunology
|
CALP1 is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca 2+-binding site. CALP1 blocks calcium influx and apoptosis (IC50 of 44.78 µM) through inhibition of calcium channel opening. CALP1 blocks glutamate receptor channels and blocks a store-operated nonselective cation channel. CALP1 activates CaM-dependent phosphodiesterase activity .
|
- HY-P1077A
-
|
mGluR
Phosphodiesterase (PDE)
Apoptosis
Calmodulin
|
Inflammation/Immunology
|
CALP1 TFA is a calmodulin (CaM) agonist (Kd of 88 µM) with binding to the CaM EF-hand/Ca 2+-binding site. CALP1 TFA blocks calcium influx and apoptosis (IC50 of 44.78 µM) through inhibition of calcium channel opening. CALP1 TFA blocks glutamate receptor channels and blocks a store-operated nonselective cation channel. CALP1 TFA activates CaM-dependent phosphodiesterase activity .
|
- HY-P2521
-
|
Influenza Virus
|
Infection
Inflammation/Immunology
|
NS2 (114-121), Influenza, the 114-121 fragment of influenza nonstructural protein 2 (NS2), is a influenza-derived epitope. NS2 (114-121), Influenza can be used for the research of CD8 + cytotoxic T lymphocyte (CTL) in antiviral immune responses .
|
- HY-P3342
-
|
PD-1/PD-L1
Apoptosis
|
Inflammation/Immunology
|
[D-Leu-4]-OB3 inhibits expressions of pro-inflammatory, proliferative and metastatic genes and PD-L1 expression. [D-Leu-4]-OB3 stimulates expression of pro-apoptotic genes .
|
- HY-P5293
-
|
Peptides
|
Others
|
Acetyl sh-heptapeptide-1 is a polypeptide. Acetyl sh-heptapeptide-1 is effective against facial aging .
|
- HY-P5321
-
|
Peptides
|
Others
|
bFGF (119-126) is a biological active peptide. (This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.)
|
- HY-P5364
-
|
Peptides
|
Others
|
B8R 20-27 is a biological active peptide. (This is amino acids 20 to 27 fragment of B8R, a vaccinia virus (VV) gene that encodes a secreted protein related to gamma interferon receptor. B8R binding to IFN-g neutralizes its antiviral activity.)
|
- HY-P5411
-
SIITFEKL, OVA (257-264) Variant
|
Peptides
|
Others
|
OVA-T4 Peptide (SIITFEKL, OVA (257-264) Variant) is a biological active peptide. (T4 peptide (SIITFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).)
|
- HY-P5225
-
|
PGC-1α
|
Others
|
Acetyl hexapeptide-38 is a bioactive peptide with upregulate adipogenesis effect and has been reported used as a cosmetic ingredient .
|
- HY-P5253
-
- HY-P4914
-
|
Peptides
|
Others
|
Sex Pheromone Inhibitor iPD1 is a sex pheromone inhibitor. Sex Pheromone Inhibitor iPD1 inhibits the sex pheromone cPD1 .
|
- HY-P5737
-
|
Bacterial
|
Infection
|
ASP-1 is a strong antistaphylococcal peptide with minimum inhibitory concentrations (MICs) of the purified peptide against S. aureus and methicillin-resistant S. aureus (MRSA) ranged from 2 μg/mL to 64 μg/mL .
|
- HY-P10064
-
|
Peptides
|
Others
|
Akt Substrate (Akt/SKG substrate) is a 7 amino acid synthetic peptide suitable as a substrate for Akt .
|
- HY-P10113
-
|
STAT
|
Cancer
|
STAT3-IN-23 (PY*LKTK) is a potent STAT3 inhibitor .
|
- HY-P10177
-
|
Opioid Receptor
|
Neurological Disease
|
Acetalin-3 (Ac-RFMWMT-NH2), a hexapeptide, is a μ opioid receptor antagonist with high affinity for μ and κ3 opioid receptor, weak affinity for κ1 receptors and no affinity for κ2 receptors .
|
- HY-P0323
-
|
Arenavirus
|
Infection
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
- HY-P0303
-
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
Crustacean cardioactive peptide,free acid is a highly conserved, amidated cyclic nonapeptide, first isolated from the pericardial organs of the shore crab Carcinus maenas, where it has a role in regulating heartbeat; Crustacean cardioactive peptide,free acid also modulates the neuronal activity in other arthropods.
|
- HY-P1569
-
|
Arenavirus
|
Inflammation/Immunology
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P1794
-
|
Peptides
|
Cancer
|
G280-9 is a 9 amino acid native epitope peptide. G280-9 is a relevant target expressed on melanoma.
|
- HY-P0137
-
|
Influenza Virus
|
Infection
|
CEF1, Influenza Matrix Protein M1 (58-66) is an epitope derived from the matrix protein of the influenza A virus .
|
- HY-P1780
-
|
CMV
|
Infection
|
CEF20 is an HLA-A*0201-restricted epitope from cytomegalovirus pp65 (495-503).
|
- HY-P1788
-
|
Influenza Virus
|
Infection
|
Influenza A NP(366-374) Strain A/PR/8/35 is an H2-Db-restricted epitope from Influenza A/PR/8/35 nucleoprotein .
|
- HY-P1837
-
|
Influenza Virus
|
Infection
|
Influenza HA (518-526) is an H-2K d-restricted epitope of the influenza virus hemagglutinin comprised amino acids 533 to 541 .
|
- HY-P1919
-
|
Peptides
|
Cancer
|
Tyrosinase 369-377, human is a HLA-A2.1-restricted epitope derived from tyrosinase, has been used to develop tumor-targeted vaccines with mixed efficacy .
|
- HY-P1907
-
|
HPV
|
Cancer
|
Human Papillomavirus (HPV) E7 protein (49-57) is the H-2 d-restricted human papillomavirus (HPV) E749-57 epitope (short peptide spanning the 49th to 57th amino acid residues in the E7 protein) .
|
- HY-P1569A
-
|
Arenavirus
|
Inflammation/Immunology
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P2456
-
|
p38 MAPK
|
Others
|
MBP MAPK Substrate is used as an exogenous substrate for MAPK .
|
- HY-P2528
-
|
Fluorescent Dye
|
Others
|
Enhanced Green Fluorescent Protein (EGFP) (200-208) is a marker gene product derived from the jellyfish Aequorea Victoria. Enhanced Green Fluorescent Protein (EGFP) (200-208) is a common reporter protein and is easy to detect .
|
- HY-P1911
-
|
EBV
|
Infection
|
CEF27, Epstein-Barr Virus BRLF-1 lytic 148-156 corresponding to amino acids 148-156 of the BRLF1 protein. BRLF1 is a transcriptional activator that binds directly to a GC-rich motif present in some Epstein-Barr virus (EBV) lytic gene promoters .
|
- HY-P4088
-
|
Peptides
|
Cancer
|
LyP-2 is a peptide that homes to tumor lymphatics. LyP2 homes to lymphatics of C8161 melanomas and cervical carcinomas and K14-HPV16 skin, but not to MDA-MB435 tumors, showing heterogeneity in the molecular markers of tumor cells and lymphatics .
|
- HY-105436
-
- HY-P4677
-
|
Peptides
|
Cancer
|
GP100 (209-217) is a 9-aa peptide derived from human gp100 beginning at position 20 .
|
- HY-P2006
-
|
Peptides
|
Others
|
Abecomotide is a biological active peptide. (an immunological agent for active immunization)
|
- HY-P5439
-
|
PKC
|
Others
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5470
-
|
EBV
|
Others
|
LMP2A (426-434) is a biological active peptide. (HLA A2.1-restricted epitope from Epstein-Barr Virus latent membrane protein LMP2 (426-434).)
|
- HY-P5475
-
|
EBV
|
Others
|
BMLF1 (280–288) is a biological active peptide. (HLA A2.1-restricted epitope from Epstein-Barr Virus lytic protein BMLF1 (280-288).)
|
- HY-P5476
-
|
Peptides
|
Others
|
Influenza virus NP (44-52) is a biological active peptide. (HLA-A*01 restricted epitope from influenza virus nucleoprotein (44-52).)
|
- HY-P5489
-
|
Peptides
|
Others
|
IGRP(206-214) is a biological active peptide. (This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.)
|
- HY-P5496
-
|
Peptides
|
Others
|
AAV2 Epitope is a biological active peptide. (This peptide is the capsid derived immunodominant adeno-associated virus 2 (AAV2), CD8 T cell epitope. Liver toxicity observed in a clinical trial of AAV2 delivered systemically to patients with hemophilia was ascribed to killing of vector-transduced hepatocytes by capsid-specific T-cells.)
|
- HY-P5745A
-
|
Peptides
|
Cancer
|
TYVPANASL TFA is a MHC I-binding CD8 T cell epitope of nine amino acids from HER2/neu. TYVPANASL TFA can be used to prepare J-LEAPS vaccine .
|
- HY-P5745
-
|
Peptides
|
Cancer
|
TYVPANASL is a MHC I-binding CD8 T cell epitope of nine amino acids from HER2/neu. TYVPANASL can be used to prepare J-LEAPS vaccine .
|
- HY-P5881
-
|
PKC
|
Cardiovascular Disease
|
PKCα (C2-4) inhibitor peptide is a PKCα‐specific inhibitor peptide that blocks the inhibition of IKr by the α1A‐adrenoreceptor agonist A-61603 (HY-101366) .
|
- HY-P5888
-
Myr‐PKCɛ-
|
PKC
|
Inflammation/Immunology
|
PKCε inhibitor peptide,myristoylated (Myr‐PKC?-) is a cell permeable myristic acid conjugated PKC? peptide inhibitor that attenuates NO release in cultured human umbilical vein endothelial cells (HUVECs) .
|
- HY-P5988
-
|
PKC
|
Cancer
|
N-myristoyl-RKRTLRRL inhibits binding of PKC substrates. N-myristoyl-RKRTLRRL inhibits Ca 2+- and phosphatidylserine (PS)-dependent histone phosphorylation with IC50 of 5 μM.? histone phosphorylation with IC50 of 80 μM .
|
- HY-106128
-
BN 52080
|
Peptides
|
Infection
|
Lagatide (BN 52080), a heptapeptide, is a short C-terminal analog of sorbin. Lagatide has proabsorptive and antisecretory effect in the different parts of the intestine. Lagatide can be used for the research of chronic diarrhea .
|
- HY-P10085
-
|
PKC
|
Inflammation/Immunology
|
PKC-ε translocation inhibitor peptide is a PKC-ε translocation inhibitor. PKC-ε translocation inhibitor peptide can regulate the rate of FcγR-mediated internalization of opsonized beads, has no effect of FcαR trafficking .
|
- HY-P0138
-
- HY-P0304
-
|
Influenza Virus
|
Infection
|
CEF4 is a peptide that corresponds to aa 342-351 of the influenza A virus nucleocapsid protein.
|
- HY-P1755
-
|
MDM-2/p53
|
Cancer
|
p53 (17-26) is amino acids 17 to 26 fragment of p53. p53 (17-26) is mdm-2-binding domain .
|
- HY-P1813
-
PSA-Peptide
|
Peptides
|
Cancer
|
PSA1 (141-150), a prostate specific antigen 1 peptide, is used in the immunotherapy of cancer experiments .
|
- HY-P1900
-
|
Peptides
|
Infection
|
SEB Domain (152-161) is Staphylococcal Enterotoxin B domain amino acid residue 152-161. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus. SEB Domain (152-161) is highly conserved and can inhibit transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1 .
|
- HY-P0138A
-
|
Peptides
|
Others
|
MART-1 (26-35) (human) TFA is amino acid residue 26 to 35 of MART-1 protein.
|
- HY-P1883A
-
|
Fluorescent Dye
|
Infection
|
Bacterial Sortase Substrate III, Abz/DNP TFA is an internally quenched fluorescent peptide substrate. Staphylococcus aureus transpeptidase sortase A (SrtA) reacts with its native substrate Bacterial Sortase Substrate III, Abz/DNP, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this substrate can be monitored at Ex/Em=320 nm/420 nm.
|
- HY-P1900A
-
|
Peptides
|
Infection
|
SEB Domain (152-161) TFA is Staphylococcal Enterotoxin B domain amino acid residue 152-161. Staphylococcal enterotoxin B (SEB) is a toxin produced by Staphylococcus aureus. SEB Domain (152-161) TFA is highly conserved and can inhibit transcytosis of multiple staphylococcal enterotoxins, SEA, SEE, and TSST-1 .
|
- HY-P1883
-
|
Fluorescent Dye
|
Infection
|
Bacterial Sortase Substrate III, Abz/DNP is an internally quenched fluorescent peptide substrate. Staphylococcus aureus transpeptidase sortase A (SrtA) reacts with its native substrate Bacterial Sortase Substrate III, Abz/DNP, cleaving it and catalyzing the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Cleavage of this substrate can be monitored at Ex/Em=320 nm/420 nm.
|
- HY-P3828
-
|
Fluorescent Dye
|
Neurological Disease
|
Biotin-myelin basic protein (94-102) is a peptide fragemt. Myelin basic protein is responsible for adhesion of the cytosolic surfaces of multilayered compact myelin, it plays an important role in the process of myelination of nerves in the nervous system. Myelin basic protein also acts as a membrane actin-binding protein, which might allow it to participate in transmission of extracellular signals to the cytoskeleton in oligodendrocytes and tight junctions in myelin .
|
- HY-P2668
-
|
Peptides
|
Others
|
Cdk5 Substrate is a biological active peptide. (substrate for the cdc2 protein kinase)
|
- HY-P5428
-
|
Peptides
|
Others
|
Cdc2 kinase substrate is a biological active peptide. (The native peptide HATPPKKKRK is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1).)
|
- HY-P5471
-
[Leu27]-Melan-A, MART-1 (26-35)
|
Peptides
|
Others
|
Melan-A/MART-1 analog ([Leu27]-Melan-A, MART-1 (26-35)) is a biological active peptide. (This Melan-A (26-35) analog, Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the natural Melan-A (26-35).Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5488
-
|
Peptides
|
Others
|
BDC2.5 Mimotope 1040-63 is a biological active peptide. (The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet b cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.)
|
- HY-P5044
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (45-54) (human) is the 45-54 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a biomarker for Parkinson's disease (PD) .
|
- HY-P3199
-
|
PKC
|
Inflammation/Immunology
|
PKCβII Peptide Inhibitor I is a PKCβII inhibitor. PKCβII Peptide Inhibitor I shows cardioprotective effects in rat cardiac Ischemia/reperfusion injury model. PKCβII Peptide Inhibitor I also prevents vascular endothelial dysfunction .
|
- HY-P10036
-
|
PKG
|
Others
|
G-Subtide is a G-substrate peptide localized in Purkinje cells of the cerebellum. G-Subtide has little activity distinct from background and is a preferentially phosphorylated peptide substrate of recombinant PfPKG2 protein .
|
- HY-P10092
-
- HY-P10098
-
|
PKA
|
Cancer
|
PKA Substrate is a potent and selective substrate peptide of PKA that can be used to detect PKA activity .
|
- HY-P10201
-
|
STAT
|
Cancer
|
Ac-GpYLPQTV-NH2 is a STAT3 inhibitor with an IC50 value of 0.33 μM. Ac-GpYLPQTV-NH2 has antitumor activity .
|
- HY-P0328
-
|
VSV
|
Infection
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
- HY-P0327
-
|
Peptides
|
Others
|
T7 Tag Peptide is a protein tag derived from the N-terminal 11 residues of the major T7 capsid protein, gp 10. T7 Tag Peptide can be used in different immunoassays as well as affinity purification .
|
- HY-P0241
-
- HY-P0315
-
|
Akt
|
Others
|
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
|
- HY-P0197
-
Substance K; Neurokinin α; Neuromedin L
|
Neurokinin Receptor
|
Neurological Disease
Endocrinology
|
Neurokinin A (Substance K), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues .
|
- HY-P0150
-
- HY-P1800
-
|
Peptides
|
Metabolic Disease
|
Caerulein, desulfated is the desulfurated form of Caerulein. Caerulein is a decapeptide having the same five carboxyl-terminal amino acids as gastrin and cholecystokinin (CCK) .
|
- HY-P1800A
-
|
Peptides
|
Metabolic Disease
|
Caerulein, desulfated TFA is the desulfurated form of Caerulein. Caerulein is a decapeptide having the same five carboxyl-terminal amino acids as gastrin and cholecystokinin (CCK) .
|
- HY-P0197A
-
Substance K TFA; Neurokinin α TFA; Neuromedin L TFA
|
Neurokinin Receptor
|
Neurological Disease
Endocrinology
|
Neurokinin A TFA (Substance K TFA), a peptide neurotransmitter of the tachykinin family, acts via the NK-2 receptor. Neurokinin A acts as a major mediator in human airway and gastrointestinal tissues .
|
- HY-P4628
-
LRH-1 peptide
|
Peptides
|
Inflammation/Immunology
|
TPNQRQNVC is a nonapeptide and is the epitope of HLA-B0702. TPNQRQNVC induces a CD8+ T cell immune response .
|
- HY-P4190
-
|
GnRH Receptor
|
Endocrinology
|
FSH receptor-binding inhibitor fragment(bi-10) is a potent FSH antagonist. FSH receptor-binding inhibitor fragment(bi-10) blocks the binding of FSH to FSHR, and alteres FSH action at the receptor level. FSH receptor-binding inhibitor fragment(bi-10) results in the suppression of ovulation and causes follicular atresia of mice. FSH receptor-binding inhibitor fragment(bi-10) has the potential for utilizing to restrain the carcinogenesis of ovarian cancer by down-regulating overexpression of FSHR and ERβ in the ovaries .
|
- HY-P5371
-
|
Thrombin
|
Others
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
- HY-P5389
-
|
Peptides
|
Others
|
Connexin mimetic peptide 40GAP27 is a biological active peptide. (This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40), designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered, 40Gap27attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.)
|
- HY-P5485
-
|
Peptides
|
Others
|
Dabcyl-QALPETGEE-Edans is a biological active peptide. (Sortase Substrate)
|
- HY-P1129
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
- HY-P5896
-
- HY-P5909
-
- HY-P5909F
-
|
Keap1-Nrf2
|
Others
|
FITC-labelled Keap1-Nrf2 probe is aFITC-labeled Keap1-Nrf2 probe (HY-P5909).
|
- HY-P5533
-
|
Peptides
|
Cancer
|
CRT, an iron peptide mimic, can bind to apo-transferrin (apo-Tf). CRT can be used to modify nanoparticles, and enhances drug delivery efficiency .
|
- HY-P5750
-
|
Peptides
|
Neurological Disease
|
Hypertrehalosemic neuropeptide (Nauphoeta cinerea) is a neuropeptide in the adipokinetic hormone/red pigment-concentrating hormone (AKH/RPCH) family, and can stimulate the synthesis of trehalose .
|
- HY-P5260
-
|
Peptides
|
Metabolic Disease
|
Oligopeptide-74 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
- HY-P10202
-
|
STAT
|
Cancer
|
5-FAM-GpYLPQTV-NH2 is a fluorescently labeled peptide and has STAT3 inhibitory activity. 5-FAM-GpYLPQTV-NH2 can be used in cancer research .
|
- HY-A0190
-
- HY-P0317
-
- HY-P1773
-
Insulin-like Growth Factor I (30-41)
|
Peptides
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (30-41) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I). IGF-I is partly responsible for systemic GH activities although it possesses a wide number of own properties (anabolic, antioxidant, anti-inflammatory and cytoprotective actions) .
|
- HY-P1773A
-
Insulin-like Growth Factor I (30-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
IGF-I (30-41) (TFA) is amino acids 30 to 41 fragment of Insulin-like Growth Factor I (IGF-I). IGF-I is partly responsible for systemic GH activities although it possesses a wide number of own properties (anabolic, antioxidant, anti-inflammatory and cytoprotective actions) .
|
- HY-P2297
-
- HY-P2297A
-
- HY-P1198A
-
|
Neurokinin Receptor
|
Neurological Disease
|
Hemokinin 1, human TFA is a selective tachykinin neurokinin 1 (NK1) receptor full agonist. Hemokinin 1, human TFA is a full agonist at NK2 and NK3 receptor. Hemokinin 1, human TFA can produces an opioid-independent analgesia .
|
- HY-P3212
-
|
Peptides
|
Cancer
|
Allo-aca, a leptin peptidomimetic, is a potent, specific leptin receptor antagonist peptide. Allo-aca blocks leptin signaling and action in numerous in vitro and in vivo models .
|
- HY-P4092
-
|
Peptides
|
Cancer
|
HN-1 is a 12-mer peptide with specific activity to head and neck squamous cell cancer (HNSCC) cells. HN-1, as a tumor-specific peptide, is capable of penetrating tumor tissues. HN-1 is capable of translocating agents across cell membranes .
|
- HY-P4094
-
CTP
1 Publications Verification
|
Peptides
|
Cardiovascular Disease
|
CTP is a cardiac targeting peptide. CTP transduces cardiomyocytes in vitro. CTP leads to efficient and specific transduction of heart tissue in mice model. CTP can be used to deliver therapeutic peptides, proteins and nucleic acid specifically to the heart .
|
- HY-P4096
-
|
Peptides
|
Inflammation/Immunology
|
HAP-1 is a synovial-targeted transduction peptide. HAP-1 facilitates specific internalization of protein complexes into human and rabbit synovial cells. HAP-1 fused to an antimicrobial peptide, (KLAK)2, to generate a proapoptotic peptide DP2 .
|
- HY-P2054
-
|
HIV Protease
|
Infection
|
Mvt-101 is a hexapeptide-based inhibitor of HIV-1 protease. Mvt-101 is also reduced-peptide-bond inhibitor. Mvt-101 inhibits reproduction of the HIV virus by blocking protease action .
|
- HY-P3929A
-
|
PKA
|
Cancer
|
PKI (14-24)amide TFA is a potent PKA inhibitor. PKI (14-24)amide strongly inhibited cyclic AMP-dependent protein kinase activity in the cell homogenate .
|
- HY-P4847
-
|
Peptides
|
Others
|
pTH (73-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4714
-
|
Peptides
|
Others
|
(Tyr27)-α-CGRP (27-37) (canine, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5041
-
|
α-synuclein
|
Neurological Disease
|
α-Synuclein (34-45) (human) is the 34-45 fragment of α-Synuclein. α-Synuclein is an abundant neuronal protein that is highly abundant in presynaptic nerve terminals. α-Synuclein is a Parkinson's disease (PD) biomarker .
|
- HY-P5170
-
- HY-P5323
-
|
Peptides
|
Others
|
Dabcyl-AGHDAHASET-Edans is a biological active peptide. (This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.)
|
- HY-P5344
-
Fluorigenic PEXEL peptide
|
Peptides
|
Others
|
Dabcyl-LNKRLLHETQ-Edans (Fluorigenic PEXEL peptide) is a biological active peptide. (This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.)
|
- HY-P5352
-
|
Peptides
|
Others
|
Hyaluronan-IN-1 is a biological active peptide. (This 12 amino acids peptide is a hyaluronan inhibitor (HA), a high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces. This peptide shows specific binding to soluble, immobilized, and cell-associated forms of HA, and it inhibits leukocyte adhesion to HA substrates almost completely.)
|
- HY-P0315F
-
|
Peptides
|
Others
|
Biotin-Crosstide is abiotinylated Crosstide (HY-P0315).
|
- HY-P3047
-
|
Peptides
|
Others
|
Ac-Decapeptide is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
- HY-P4909
-
|
Peptides
|
Infection
|
Autoinducing Peptide I is a cyclic octapeptide secreted by Staphylococcus aureus and can be used in vaccine research .
|
- HY-P5251
-
|
Peptides
|
Metabolic Disease
|
Oligopeptide-68 is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient .
|
- HY-P5261
-
KP1
|
Peptides
|
Metabolic Disease
|
SA1-III(KP1) is a bioactive peptide withanti-agingeffect and has been reported used as a cosmetic ingredient .
|
- HY-P4992
-
|
Somatostatin Receptor
|
Cancer
|
Tyr-(D-Dab4,Arg5,D-Trp8)-cyclo-Somatostatin-14 (4-11) is a somatostatin agonist that can be used in cancer research .
|
- HY-P10128
-
|
Peptides
|
Inflammation/Immunology
|
GE11 is a active peptide and combines with colloidal drug delivery systems as smart carriers for antitumor drugs and can be used for cancer study .
|
- HY-P0225
-
Autocamtide II
|
CaMK
Autophagy
|
Neurological Disease
|
Autocamtide 2 is a highly selective peptide substrate of calcium/calmodulin-dependent protein kinase II (CaMKII). It can be used in the CaMKII activity assay.
|
- HY-P1583
-
- HY-P1337
-
- HY-P1774
-
|
HBV
|
Infection
|
Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
|
- HY-P1337A
-
- HY-P2480
-
|
Peptides
|
Others
|
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDKs .
|
- HY-P2548
-
|
EGFR
|
Others
|
pp60 (v-SRC) Autophosphorylation Site, Phosphorylated is the phosphorylated peptide of an EGFR substrate. pp60 (v-SRC) Autophosphorylation Site, Phosphorylated can be used for the screening of EGFR Kinase inhibitors via phosphorylated-substrate quantification .
|
- HY-P4133
-
|
ERK
MEK
|
Cancer
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable .
|
- HY-P4072
-
|
PD-1/PD-L1
|
Cancer
|
(D)-PPA 1 is a hydrolysisresistant d-peptide antagonist. (D)-PPA 1 serves as a potent PD-1/PD-L1 inhibitor. (D)-PPA 1 binds to PD-1 with the affinity 0f 0.51 μM with in vitro and in vivo efficacy .
|
- HY-P4072A
-
|
PD-1/PD-L1
|
Cancer
|
(D)-PPA 1 TFA is a hydrolysisresistant d-peptide antagonist. (D)-PPA 1 TFA serves as a potent PD-1/PD-L1 inhibitor. (D)-PPA 1 TFA binds to PD-1 with the affinity 0f 0.51 μM with in vitro and in vivo efficacy .
|
- HY-P3211B
-
LR12-scr
|
Peptides
|
Inflammation/Immunology
|
Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .
|
- HY-P2112
-
DOTA-Nal3-octreotide
|
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging .
|
- HY-P1755F
-
- HY-P5440
-
|
ERK
|
Others
|
ERKtide is a biological active peptide. (ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.)
|
- HY-P5530
-
|
Peptides
|
Others
|
2Abz-SVARTLLV-Lys(Dnp)-NH2 is a biological active peptide. (C1-inhibitor P4-P4′ substrate)
|
- HY-P5521
-
|
Peptides
|
Cardiovascular Disease
|
mLR12 is a Trem1 inhibitory peptide. mLR12 decreases aortic rupture rate in BAPN-induced Thoracic aortic aneurysm and dissection (TAAD) mice model .
|
- HY-P5258
-
|
EGFR
|
Metabolic Disease
|
Oligopeptide-41 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
- HY-P5217
-
|
Peptides
|
Others
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
- HY-P5997
-
|
Peptides
|
Inflammation/Immunology
|
XQ2B is a cGAS inhibitor targeting protein-DNA interactions and phase separation. XQ2B inhibits herpes simplex virus 1 (HSV-1)-induced antiviral immune responses and enhances HSV-1 infection in vitro and in vivo .
|
- HY-P10051
-
|
Ras
Raf
|
Cancer
|
Cyclorasin 9A5 is an 11-residue cell-permeable cyclic peptide that orthosterically inhibits the Ras-Raf protein interaction with an IC50 of 120 nM .
|
- HY-P10050
-
|
Peptides
|
Others
|
Calpain substrate is the membrane non-permeable fluorogenic calpain substrate and can be used in Calpain enzymatic activity assay .
|
- HY-P10131
-
|
FAP
|
Cancer
|
3BP-3940 is a highly potent fibroblast activation protein (FAP)-targeting peptide for theranostics. 3BP-3940 is often coupled with radionuclides for tumor diagnosis and treatment .
|
- HY-P0325
-
|
Peptides
|
Others
|
V5 Epitope Tag Peptide (TFA) is a tag peptide derived from a small epitope present on the P and V proteins of the paramyxovirus of simian virus 5.
|
- HY-P1528
-
- HY-P1563
-
|
Peptides
|
Inflammation/Immunology
|
Osteogenic Growth Peptide, OGP is a short, naturally occurring 14-mer growth factor peptide found in serum at μM concentrations.
|
- HY-P1597
-
|
PKA
PKC
|
Cancer
|
Malantide is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts . Malantide is also an efficient substrate for PKC with a Km of 16 μM .
|
- HY-P1754
-
|
Peptides
|
Neurological Disease
|
Tetanus toxin (830-843) is a powerful neurotoxin that reaches by retroaxonal transport and transcytosis the cytoplasm ofspinal inhibitory intemeurons and blocks their ability to release neurotransmitters .
|
- HY-P1828
-
|
Peptides
|
Cancer
|
EGFRvIII peptide (PEPvIII) is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide represents a truly tumor-specific target for antitumor immunotherapy .
|
- HY-P1754A
-
|
Peptides
|
Neurological Disease
|
Tetanus toxin (830-843) TFA is a powerful neurotoxin that reaches by retroaxonal transport and transcytosis the cytoplasm ofspinal inhibitory intemeurons and blocks their ability to release neurotransmitters .
|
- HY-P1597A
-
|
PKA
PKC
|
Cancer
|
Malantide TFA is a synthetic dodecapeptide derived from the site phosphorylated by cAMP-dependent protein kinase (PKA) on the β-subunit of phosphorylase kinase. Malantide TFA is a highly specific substrate for PKA with a Km of 15 μM and shows protein inhibitor (PKI) inhibition >90% substrate phosphorylation in various rat tissue extracts . Malantide TFA is also an efficient substrate for PKC with a Km of 16 μM .
|
- HY-P1233A
-
|
Motilin Receptor
|
Metabolic Disease
|
ANQ-11125 TFA is a potent and selective antagonist of motilin, with the pKd of 8.24. ANQ-11125 TFA blocks motilide-induced contractions in vitro in the rabbit .
|
- HY-P0118A
-
P144 TFA
|
TGF-beta/Smad
PI3K
Apoptosis
|
Cancer
|
Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis inducer .
|
- HY-P1317A
-
|
Opioid Receptor
|
Neurological Disease
|
Nociceptin (1-13), amide TFA is a potent ORL1 receptor (opioid receptor-like 1 receptor, OP4) agonist with a pEC50 of 7.9 for mouse vas deferens and a Ki of 0.75 nM for binding to rat forebrain membranes .
|
- HY-P3912A
-
|
Peptides
|
Infection
|
Endotoxin inhibitor TFA is a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor TFA inhibits the febrile response to LPS with very low toxicity and lethality .
|
- HY-P4136
-
|
ERK
|
Cancer
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM .
|
- HY-P1828A
-
|
Peptides
|
Cancer
|
EGFRvIII peptide (PEPvIII) TFA is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide TFA represents a truly tumor-specific target for antitumor immunotherapy .
|
- HY-P5433
-
|
Peptides
|
Others
|
IRS1-derived peptide is a biological active peptide. (This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.)
|
- HY-P5461
-
|
Bacterial
|
Others
|
CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
|
- HY-P5464
-
|
Peptides
|
Others
|
SRC-1 NR box peptide is a biological active peptide. (This peptide is a 14-amino acid fragment from the steroid receptor cofactor SRC-1 NR II.)
|
- HY-P5480
-
|
Keap1-Nrf2
|
Others
|
Keap1-Nrf2-IN-16 is a biological active peptide. (KEAP1 binding activity)
|
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
- HY-P4979
-
|
Biochemical Assay Reagents
|
Cancer
|
Cdc25A (80-93) (human) is a polypeptide that controls the cell proliferation and tumorigenesis by a change in expression of proteins involved in cyclin D1 regulation and G1/S transition. Cdc25A (80-93) (human) can be used in cancer research .
|
- HY-P5085
-
|
Peptides
|
Others
|
Acetyl-octreotide is a reduced linear peptide. Acetyl-octreotide can synthesize Re(V)-cyclized peptides in aqueous methanol solutions with low Sst receptor binding affinities .
|
- HY-P1962
-
[Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)
|
Beta-secretase
|
Neurological Disease
|
β-Secretase inhibitor ([Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)) is a β-secretase and BACE1 inhibitor (IC50: 25 nM for β-secretase) .
|
- HY-P5998
-
|
Myosin
|
Cancer
|
Myosin Light Chain Kinase Substrate (smooth muscle) is a smooth muscle myosin light chain kinase (MLCK) synthetic peptide substrate .
|
- HY-P10045
-
|
Peptides
|
Cardiovascular Disease
|
Integrin signaling inhibitor, mP13 is an inhibitor of integrin signaling. Integrin signaling inhibitor, mP13 inhibits inside-out and outside-in signaling, including fibrinogen binding, platelet adhesion, and clot retraction .
|
- HY-163422S
-
- HY-P0326
-
|
Peptides
|
Others
|
S Tag Peptide is a 15 amino acid peptide derived from RNase A.
|
- HY-P0271
-
|
CaMK
Autophagy
|
Neurological Disease
|
Syntide 2, a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected .
|
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P1164
-
- HY-P1797A
-
|
Peptides
|
Others
|
Sakamototide substrate peptide TFA is a peptide substrate for members of the AMPK family of kinases, used in kinase activity assays .
|
- HY-P1164A
-
- HY-P1826
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
CLIP (86-100) is amino acids 86 to 100 fragment of class II-associated invariant chain peptide (CLIP). CLIP is a small self-peptide and cleavage product of the invariant chain that resides in the HLA-II antigen binding groove and is believed to play a critical role in the assembly and transport of MHC class II alphabetaIi complexes through its interaction with the class II peptide-binding site .
|
- HY-P1901
-
|
Peptides
|
Metabolic Disease
|
Insulin alpha-chain (1-13) is a human leucocyte antigen (HLA)-DR4-restricted epitope comprising the first 13 amino acids of the insulin A-chain .
|
- HY-P1918
-
|
Peptides
|
Cardiovascular Disease
|
Activated Protein C (390-404), human is a peptide of the activated protein C (a vitamin K-dependent serine protease), potently inhibits APC anticoagulant activity .
|
- HY-P1918A
-
|
Peptides
|
Cardiovascular Disease
|
Activated Protein C (390-404), human TFA, a peptide of the activated protein C (a vitamin K-dependent serine protease), potently inhibits APC anticoagulant activity .
|
- HY-P1948
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
Thioredoxin reductase peptide corresponds to residues 53–67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research. Thioredoxin reductase acts as a reductant of disulfide-containing proteins and plays crucial role in cellular antioxidant defense .
|
- HY-P0271A
-
|
CaMK
|
Neurological Disease
|
Syntide 2 (TFA), a Ca 2+- and calmodulin (CaM)-dependent protein kinase II (CaMKII) substrate peptide, selectively inhibits the gibberellin (GA) response, leaving constitutive and abscisic acid-regulated events unaffected .
|
- HY-P1959A
-
BIM 23014 acetate
|
Peptides
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
- HY-P1826A
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
CLIP (86-100) TFA is amino acids 86 to 100 fragment of class II-associated invariant chain peptide (CLIP). CLIP is a small self-peptide and cleavage product of the invariant chain that resides in the HLA-II antigen binding groove and is believed to play a critical role in the assembly and transport of MHC class II alphabetaIi complexes through its interaction with the class II peptide-binding site .
|
- HY-P2161A
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 TFA is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 TFA is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 TFA depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P2547
-
|
Src
|
Others
|
Tyrosine Kinase Peptide 1 is a control substrate peptide for c-Src assay .
|
- HY-P2161
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P2161B
-
|
Kisspeptin Receptor
|
Cancer
|
TAK-683 acetate is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 acetate is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 acetate depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P4736
-
|
Peptides
|
Others
|
Leptin (116-130) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4974
-
|
Peptides
|
Others
|
Tau Peptide (512-525) amide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4967
-
|
Peptides
|
Others
|
Tau Peptide (307-321) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P5419
-
|
Peptides
|
Others
|
WAAG-3R is a biological active peptide. (Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage. This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.)
|
- HY-P5421
-
|
Peptides
|
Others
|
Caloxin 1B1 is a biological active peptide. (Caloxin 1b1 is obtained by screening for binding to extracellular domain 1 of PMCA4, which inhibited PMCA extracellularly, selectively, and had a higher affinity for PMCA4 than PMCA1. Because caloxin 1b1 had been selected to bind to an extracellular domain of PMCA, it could be added directly to cells and tissues to examine its effects on smooth muscle and endothelium.)
|
- HY-P5425
-
|
Peptides
|
Others
|
Tetanus Toxin (830–844) is a biological active peptide. (tetanus toxin-derived peptide TT830–844 CD4+ T-cell epitope. This promiscuous CD4+ T-cell epitope can bind to a wide range of HLA–DRB molecules and is thus expected to activate CD4+ T-cell responses in a large part of the human population)
|
- HY-P5448
-
|
Peptides
|
Others
|
MOG (92–106), mouse, rat is a biological active peptide. (This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein (MOG) from mouse/rat. Mice with MOG (92–106)-induced experimental autoimmune encephalomyelitis develop extensive B cell reactivity against secondary myelin antigens. Despite the fact that this MOG peptide induces only weak T cell responses, MOG-induced autoimmunity is very severe. This peptide is encephalitogenic in SJL mice, DA rats, and rhesus monkeys.)
|
- HY-P5453
-
|
Peptides
|
Others
|
CFP10 (71–85) is a biological active peptide. (CFP1071–85, that elicited IFN-γ production and CTL activity by both CD4+ and CD8+ T cells from persons expressing multiple MHC class II and class I molecules)
|
- HY-P5558
-
|
VEGFR
|
Inflammation/Immunology
|
KLTWQELYQLKYKGI (QK) is a VEGF mimicking peptide, binds to the VEGF receptors and competes with VEGF. KLTWQELYQLKYKGI is active in gastric ulcer healing in rodents when administered either orally or systemically. KLTWQELYQLKYKGI shows the ability to induce capillary formation and organization in vitro .
|
- HY-103276
-
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
Alytesin, a bombesin-like peptide, is found in extracts of the skin of Alytes obstetricans. Alytesin reduces gastric acid secretion and induces hypertension. Alytesin also induces short-term anorexigenic effects in neonatal chicks
|
- HY-P5564
-
|
Fungal
|
Infection
|
BTL peptide is an antifungal peptide. BTL peptide is active against B. maydis, A. brassicae, A. niger and C. personata .
|
- HY-P4773
-
|
HSV
|
Infection
|
HSV-1 Protease substrate is a peptide substrate for HSV-1 (Herpes Simplex Virus Type 1) protease, and the specificity constant (kcat/Km) at pH 7.5 for cleavage is 5.2 M -1 s -1 .
|
- HY-P5201S1
-
|
Isotope-Labeled Compounds
|
Others
|
VTSEGAGLQLQK- 13C6, 15N2 (TFA) is the 13C- and 15N-labeled VTSEGAGLQLQK. VTSEGAGLQLQK is an amino acid sequence in the C-terminal region of recombinant human alpha-acid glucosidase (rhGAA), which can be used to bind anti-drug antibodies in plasma and quantitatively analyze the therapeutic effect .
|
- HY-P5969
-
- HY-P5977
-
Ste-MPKKKPTPIQLNP-NH₂; ERK Activation Inhibitor Peptide
|
ERK
|
Cancer
|
STE-MEK1(13) (Ste-MPKKKPTPIQLNP-NH?) is a cell permeable ERK1/2 inhibitor (IC50: 13-30?μM). STE-MEK1(13) inhibits ERK1/2 phosphorylation .
|
- HY-P5979
-
- HY-P10021
-
- HY-P10022
-
hTERT (651-665)
|
Peptides
|
Cancer
|
Riletamotide is an immunological agent for active immunization .
|
- HY-P10105
-
|
Akt
Apoptosis
|
Cancer
|
TCL1(10-24) is a encompassing the betaA strand of human TCL1. TCL1(10-24) is a Akt inhibitor. TCL1(10-24) interacts with the Akt PH domain prevented phosphoinositide binding and hence inhibits membrane translocation and activation of Akt. TCL1(10-24) inhibits cellular proliferation and anti-apoptosis. TCL1(10-24) has tumor growth in vivo .
|
- HY-P10109A
-
hG6PI (325-339) (hydrochloride)
|
Peptides
|
Inflammation/Immunology
|
G6PI 325-339 (human) hydrochloride is an efficient inducer of arthritis in B10.Q mice. G6PI 325-339 (human) hydrochloride primes Th1 and Th17 cells cross-reacted with the murine G6PI protein. G6PI 325-339 (human) hydrochloride induces arthritis model operating through a T and B cell-dependent pathway but without antibody effector mechanisms .
|
- HY-P10109
-
hG6PI (325-339)
|
Peptides
|
Inflammation/Immunology
|
G6PI 325-339 (human) is an efficient inducer of arthritis in B10.Q mice. G6PI 325-339 (human) primes Th1 and Th17 cells cross-reacted with the murine G6PI protein. G6PI 325-339 (human) induces arthritis model operating through a T and B cell-dependent pathway but without antibody effector mechanisms .
|
- HY-P10148
-
Ac-[Leu28,31]-NPY (24-36)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) is a selective agonist of neuropeptide Y Y2 receptor. N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) attenuates cardiac vagal action in anaesthetised rats .
|
- HY-P5419A
-
|
Peptides
|
Others
|
WAAG-3R TFA is a biological active peptide. (Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage. This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.) .
|
- HY-P10224
-
|
Peptides
|
Cancer
|
G7-18NATE is a peptide inhibitor of Grb7. HY-P10224 binds to the Grb7-SH2 domain with micromolar affinity (KD = 18.1 μM). G7-18NATE inhibits cell proliferation, motility, cell invasion and 3D culture formation in several cancer cell lines .
|
- HY-P1026
-
- HY-P1027
-
|
Peptides
|
Others
|
LEP(116-130)(mouse) is a synthetic leptin peptide fragment.
|
- HY-P1544
-
- HY-P1578
-
- HY-P1578A
-
- HY-P1202
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
- HY-P1202A
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806 TFA, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
- HY-P1735
-
|
Peptides
|
Inflammation/Immunology
|
Moth Cytochrome C (MCC) (88-103), derived from the carboxyl terminus of moth cytochrome c, induces positive selection of TCR transgenic thymocytes .
|
- HY-P1818
-
- HY-P1892
-
|
Peptides
|
Infection
|
Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide. Competence-Stimulating Peptide, a quorum-sensing molecule, competence-stimulating peptide (CSP) which inhibits germ tube (GT) formation .
|
- HY-P2295
-
|
SARS-CoV
|
Others
|
Dabcyl-KTSAVLQSGFRKME-Edans TFA is a fluorogenic peptide. Dabcyl-KTSAVLQSGFRKME-Edans TFA is used as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKME-Edans TFA has the potential for study 2019-nCoV (COVID-19) infection .
|
- HY-P1382
-
|
Ras
|
Cancer
|
Rac1 Inhibitor W56 is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
- HY-P1382A
-
|
Ras
|
Cancer
|
Rac1 Inhibitor W56 TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 TFA inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
- HY-P1383
-
|
Peptides
|
Others
|
Rac1 Inhibitor F56, control peptide is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor F56, control peptide contains a Trp 56 to Phe 56 mutation. Rac1 Inhibitor F56, control peptide has no effect on Rac1 interaction with its guanine nucleotide exchange factors (GEFs) .
|
- HY-P1383A
-
|
Peptides
|
Others
|
Rac1 Inhibitor F56, control peptide TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor F56, control peptide TFA contains a Trp 56 to Phe 56 mutation. Rac1 Inhibitor F56, control peptide TFA has no effect on Rac1 interaction with its guanine nucleotide exchange factors (GEFs) .
|
- HY-P2514
-
|
Peptides
|
Inflammation/Immunology
|
TET 830 modified/T-helper epitope from tetanus toxoid is a modified T-helper epitope from tetanus toxoid. TET 830 modified/T-helper epitope from tetanus toxoid induces T-cells responses and is used as a helper peptide in vaccinations .
|
- HY-P4897
-
|
Peptides
|
Others
|
[Gly9-OH]-Atosiban is the analogue of Atosiban (HY-17572).
|
- HY-P5401
-
|
Peptides
|
Others
|
SAP1 is a biological active peptide. (inhibited virus entry into the cells)
|
- HY-P5433F
-
|
Peptides
|
Others
|
IRS-1 Peptide, FAM labeled is a biological active peptide. (Insulin receptor substrate)
|
- HY-P5531
-
|
Peptides
|
Others
|
beta-Casein phosphopeptide is a biological active peptide. (Bovine ?-Casein, monophosphopeptide (phospho-Serine) can be used for characterization of affinity purified phosphorylated peptides in liquid chromatography and for the analysis or detection of phosphorylated peptides in mass spectrometry.)
|
- HY-106258
-
OHM 11638; BAX-ACC 1638; MOT 288
|
Motilin Receptor
|
Metabolic Disease
|
OHM 11638 (Atilmotin), an analogue of the (1-14) fragment of porcine motilin, is a motilin receptor agonist with a pKd of 8.94 for the motilin receptor. OHM 11638 affects esophageal, lower esophageal sphincter (LES), and gastric motility. OHM 11638 increases LES and gastric pressures, OHM 11638 can be used as prokinetic agents .
|
- HY-P0183
-
- HY-P1586
-
HIV-1 rev Protein (34-50)
|
HIV
|
Infection
|
HIV-1 Rev (34-50) is a 17-aa peptide derived from the Rev-responsive element (RRE)-binding domains of Rev in HIV-1, with anti-HIV-1 activity.
|
- HY-P1851A
-
|
Peptides
|
Neurological Disease
|
AGA-(C8R) HNG17, humanin derivative TFA is a potent humanin (HN) derivative. AGA-(C8R) HNG17, humanin derivative completely suppresses neuronal cell death by Alzheimer's disease-relevant insults .
|
- HY-P1110
-
AF12198
1 Publications Verification
|
Interleukin Related
|
Inflammation/Immunology
|
AF12198 is a potent, selective and specific peptide antagonist for human type I interleukin-1 receptor (IL1-R1) (IC50=8 nM) but not the human type II receptor (IC50=6.7 µM) or the murine type I receptor (IC50>200 µM). AF12198 inhibits IL-1-induced IL-8 production (IC50=25 nM) and IL-1-induced intercellular adhesion molecule-1 (ICAM-1) expression (IC50=9 nM) in vitro. AF12198 has anti-inflammatory activities and blocks responses to IL-1 in vivo .
|
- HY-P3689
-
|
CGRP Receptor
Adenylate Cyclase
|
Others
|
[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat is a fragments 22-37 of rat calcitonin gene related peptide (CGRP), targeting CGRP receptor and adenylate cyclase. Calcitonin is mainly produced by thyroid C cells while CGRP is secreted and stored in the nervous system .
|
- HY-P1674
-
POL7080
|
Bacterial
Antibiotic
|
Infection
|
Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
|
- HY-P4735
-
- HY-P5375
-
|
Peptides
|
Others
|
O-Linked GlcNAc transferase substrate is a biological active peptide. (A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.)
|
- HY-P5549
-
|
Bacterial
Fungal
|
Infection
|
Hb 98-114, the amino acids 98-114 of the alpha subunit of bovine hemoglobin, is an antimicrobial peptide. Hb 98-114 is active against several yeast and filamentous fungi (MIC: 2.1 μM-12.5 μM) .
|
- HY-P4980
-
|
Peptides
|
Others
|
Acetyl-Lys5-octreotide is a biologically active peptide .
|
- HY-P5571
-
- HY-P5940
-
|
Peptides
|
Neurological Disease
|
β-Amyloid precursor protein (96-110), cyclized (human) is an amyloid precursor protein. β-Amyloid precursor protein (96-110), cyclized (human) can be used in study Alzheimer’s disease .
|
- HY-156343S1
-
- HY-P0279
-
|
Peptides
|
Others
|
Systemin, an 18-amino acid polypeptide, has been isolated from tomato leaves that is a powerful inducer of over 15 defensive genes.
|
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
- HY-P1212
-
CST-14, human, rat
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, human, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
- HY-P1909
-
|
Peptides
|
Cancer
|
Casein Kinase Substrates 3 is a substrate of casein kinase.
|
- HY-P1341
-
Orexin A (17-33) (human, mouse, rat, bovine)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
OXA(17-33) is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
- HY-P1341A
-
Orexin A (17-33) (human, mouse, rat, bovine) TFA
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
OXA(17-33) TFA is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) TFA shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
- HY-P1118
-
- HY-P1118A
-
- HY-P2492
-
|
Peptides
|
Metabolic Disease
|
Renin FRET Substrate I is a substrate of human renin. Renin FRET Substrate I is designed to incorporate the renin cleavage site that occurs in the N-terminal peptide of human angiotensinogen .
|
- HY-P3437
-
|
Virus Protease
|
Others
|
Dabcyl-KTSAVLQSGFRKM-Glu(Edans)-NH2 is a fluorogenic peptide, as the substrate to measure the enzymatic activities of protease forms. Dabcyl-KTSAVLQSGFRKM-Glu(Edans)-NH2 can be used for researching 2019-nCoV (COVID-19) infection.
|
- HY-P4469
-
- HY-P5095
-
|
Peptides
|
Others
|
FGF basic (93-110) (human, bovine) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4957
-
|
Peptides
|
Others
|
Octreotide dimer parallel is a dimer parallel of Octreotide. Octreotide (HY-P0036) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue .
|
- HY-P5885
-
|
PKC
|
Others
|
PKCη pseudosubstrate inhibitor,myristoylated is cell permeable and can be used to study the mechanism of action of PKCη .
|
- HY-P5652
-
|
Peptides
|
Infection
|
Bombolitin II is an antimicrobial peptide derived from bumblebee venom. Bombolitin II can lysate erythrocyte and liposome .
|
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor comprising 14 amino acid residues. SFTI-1 is a potent Bowman-Birk inhibitor.
|
- HY-P10099
-
|
STAT
|
Cancer
|
STAT3-IN-21, cell-permeable, negative control, a peptide, is a negative control for Stat3 activity detection .
|
- HY-P0324
-
|
Bacterial
|
Infection
|
Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
|
- HY-P1765
-
|
Peptides
|
Neurological Disease
|
Galanin (1-19), human is the 1-19 fragment of the human galanin. Galanin (GAL) is a widely distributed neuropeptide with diverse biological effects including modulation of hormone release, antinociception and modification of feeding behavior .
|
- HY-P0324A
-
|
Bacterial
|
Infection
|
Parasin I (TFA) is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity .
|
- HY-P1932A
-
- HY-P4145
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
Quazomotide is a WT1 class II peptide epitope with sequences of RSDELVRHHNMHQRNMTKL. Quazomotide stimulates a peptide-specific CD4(+) response, to recognize WT1(+) tumor cells. Quazomotide is an immunological agent for active immunization, as well as an antineoplastic agent .
|
- HY-P4791
-
|
Peptides
|
Others
|
Orexin A (1-15) (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4792
-
- HY-P4904
-
|
Peptides
|
Neurological Disease
|
RFRP-3 (rat) is a neuropeptide. RFRP-3 (rat) inhibits gonadotropin secretion, causing a marked increase in ghrelin mRNA and plasma growth hormone levels .
|
- HY-P5022
-
|
Peptides
|
Others
|
Cullin-Associated NEDD8-Dissociated Protein 1 (548-566) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5128
-
Satoreotide tetraxetan
|
Somatostatin Receptor
|
Cancer
|
DOTA-JR11 is a somatostatin receptor 2 (SSTR2)antagonist. DOTA-JR11 can be labeled by 68Ga, used for paired imaging in neuroendocrine tumors (NETs) research .
|
- HY-P5351
-
|
Peptides
|
Others
|
Hyaluronan-binding peptide, biotin labeled is a biological active peptide. (This peptide is a hyaluronan-binding peptide biotinylated through a C-terminal GGGSK linker. Hyaluronan (HA) is a nonsulfated glycosaminoglycan expressed in the extracellular matrix and on cell surfaces. HA plays a role in fertilization, embryonic development, wound healing, angiogenesis, leukocyte trafficking to inflamed tissues, and cancer metastasis. This peptide has been shown to block HA binding to CD44 receptors and inhibit T cell proliferation.)
|
- HY-P5381
-
|
NADPH Oxidase
|
Others
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
- HY-P5384
-
|
Peptides
|
Others
|
sgp91 ds-tat is a biological active peptide. (This is a scrambled control peptide for gp91 ds-tat.)
|
- HY-P5444
-
|
Bacterial
|
Others
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
- HY-P5556
-
|
Bacterial
|
Infection
|
KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. aeruginosa. .
|
- HY-P10034
-
Pss-PT
|
Peptides
|
Endocrinology
|
Pheromonotropin (Pseudaletia separata) (Pss-PT) is an armyworm (Pseudaletia separata) pheromone with the C-terminal pentapeptide FXPRL-amide. Pheromonotropin (Pseudaletia separata) belongs to the PK/PBAN family and stimulates sex pheromone biosynthesis in moths, mediating feeding (intestinal muscle contraction), development (embryonic diapause, pupal diapause, and pupation), and defense against natural enemy insects wait .
|
- HY-P10047
-
|
PKA
|
Others
|
PKItide exhibits an IC50 of 0.2 μM for cAMP-PK .
|
- HY-P10166
-
|
Peptides
|
Others
|
MLCK Peptide, control is a myosin light-chain
kinase. Adding MLCK peptide to permeabilized L15 cells dramatically decreased
IICR. MLCK peptide caused a reduction in the extent of IICR with no change in
the affinity of IP3 for the IP3R .
|
- HY-P10165
-
|
Peptides
|
Metabolic Disease
|
MLCK Peptide is a fully reversible, high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase .
|
- HY-P10184
-
|
Peptides
|
Inflammation/Immunology
|
CD36 Peptide P (93-110), Cys conjugated is a Cys labelled CD36 Peptide, and can block binding of CD36 to immobilized thrombospondin and partially inhibited collagen-induced platelet aggregation .
|
- HY-P1587
-
|
Peptides
|
Inflammation/Immunology
|
IRBP (1-20), human contains a major epitope for the H-2 b haplotype. IRBP (1-20), human induces experimental autoimmune uveoretinitis (EAU) in H-2 b mice .
|
- HY-P1861
-
|
Peptides
|
Inflammation/Immunology
|
Interphotoreceptor Retinoid Binding Protein Fragment (IRBP), a 20-residue peptide and a major pathogenic epitope, is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP 161–180), which can induce posterior uveitis (EAU) .
|
- HY-P2299
-
|
Peptides
|
Cancer
|
Protein E7(43-62) is an E7-derived peptide with anti-tumor effects (short peptide spanning the 43th to 62th amino acid residues in the E7 protein) .
|
- HY-P1587A
-
|
Peptides
|
Inflammation/Immunology
|
IRBP (1-20), human TFA contains a major epitope for the H-2 b haplotype. IRBP (1-20), human TFA induces experimental autoimmune uveoretinitis (EAU) in H-2 b mice .
|
- HY-P1269
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
- HY-P1269A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB TFA, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
- HY-P2466
-
|
Apoptosis
|
Cancer
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models .
|
- HY-P2476
-
- HY-P2509
-
|
Peptides
|
Others
|
Histone H2A (1-20), a 35-residue a peptide of histone H2A, is a substrate for methyltransferase/demethylase enzymes .
|
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P4754
-
|
Peptides
|
Others
|
Microtubule-Associated Protein (142-161) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1861A
-
|
Peptides
|
Inflammation/Immunology
|
Interphotoreceptor Retinoid Binding Protein Fragment (IRBP) TFA, a 20-residue peptide and a major pathogenic epitope, is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP 161–180), which can induce posterior uveitis (EAU) .
|
- HY-P5148
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. α-Conotoxin BuIA can be used to distinguish nAChRs containing β2- and β4-subunit, respectively. α-Conotoxin BuIA distinguishes among αxβ2 nAChRs with a rank order potency of α6>α3>α2>α4 .
|
- HY-P5422
-
|
Calcium Channel
|
Others
|
Caloxin 3A1 is a biological active peptide. (This peptide belongs to caloxins, the extracellular plasma membrane (PM) Ca2+ pump inhibitors. Caloxin 3A1 inhibits plasma membrane calcium pumps (PMCAs) but not the sarcoplasmic reticulum Ca2+-pump. This peptide does not inhibit formation of the acylphosphate intermediate from ATP.)
|
- HY-P4799
-
- HY-P5545
-
|
Bacterial
|
Infection
|
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection .
|
- HY-P5949
-
|
Bacterial
|
Infection
|
AMPR-22 is an antimicrobial peptide. AMPR-22 can bind to the bacterial membrane and induces membrane permeabilization. AMPR-22 is effective against murine model of sepsis induced by MDR strains
|
- HY-P5622
-
|
Peptides
|
Infection
|
Hs-1 is an antimicrobial peptide displays 80% protection against the dengue-2 virus .
|
- HY-P5918
-
NAX-5055
|
Peptides
|
Neurological Disease
|
Galanin-B2 (NAX-5055) has activity in the epilepsy model. Galanin-B2 can penetrate the blood-brain-barrier .
|
- HY-P5911
-
|
Peptides
|
Inflammation/Immunology
|
GluN1 (359-378) is an anti-N-methyl-D-aspartate
receptor (NMDAR) antibody. GluN1 (359-378) can cross the blood-brain barrier.
GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting
the immune system .
|
- HY-156341S1
-
- HY-P10114
-
PpYLKTK-mts; STAT3 PI
|
STAT
|
Cancer
|
STAT3-IN-24, cell-permeable (PpYLKTK-mts) is a STAT3 peptide inhibitor. STAT3-IN-24, cell-permeable inhibits recruitment of STAT3 to Jak2 and phosphorylation of Y705, thus preventing the dimerization and the nuclear translocation of STAT3 .
|
- HY-P0262
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Endocrinology
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM) .
|
- HY-P0305
-
Prion protein (106-126)
|
Peptides
|
Infection
|
PrP (106-126) is a peptide corresponding to the prion protein (PrP) amyloidogenic region, and its biochemical properties resemble the infectious form of prion protein.
|
- HY-P1025
-
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P1530
-
|
Peptides
|
Neurological Disease
|
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
|
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P1345
-
|
Complement System
|
Neurological Disease
Endocrinology
|
TLQP-21, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor 1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8 μM). TLQP-21 activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 is used for the research in regulation of nociception and other relevant physiologic functions .
|
- HY-P1345A
-
|
Complement System
|
Neurological Disease
Endocrinology
|
TLQP-21 TFA, a VGF-derived peptide endowed of endocrine and extraendocrine properties, is a potent G-protein-coupled receptor complement-3a receptor1 (C3aR1) agonist (EC50: mouse TLQP-21=10.3 μM; human TLQP-21=68.8μM). TLQP-21 TFA activates C3aR1 to induce an increase of intracellular Ca 2+. TLQP-21 TFA is used for the research in regulation of nociception and other relevant physiologic functions .
|
- HY-P1131A
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
M617 TFA is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617 TFA, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
- HY-P4149
-
- HY-P0262A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
|
Galantide TFA is a reversible and non-specific galanin (GAL) receptor antagonist. Galantide TFA dose-dependently shows antagonism to galanin-induced K + conductance with an IC50 value of 4 nM. Galantide TFA can be used for the research of neurological disease and hormone metabolism research .
|
- HY-P4814
-
Rat PAMP
|
Peptides
|
Others
|
Proadrenomedullin (1-20, rat) (Rat PAMP) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4746
-
|
Peptides
|
Infection
|
LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance .
|
- HY-P5110
-
|
Peptides
|
Others
|
TLQP-21 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4749
-
|
Peptides
|
Neurological Disease
|
Prion Protein (106-126) (human) (scrambled) is a scrambled sequence of Prion Protein (106-126). Prion Protein (106-126) (human) (scrambled) with a random sequence of the amino acids that are the same as the active fragment. Prion Protein (106-126) (human) (scrambled) usually used as a negative control .
|
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
- HY-P5342
-
- HY-P5474
-
|
Bacterial
|
Others
|
PMAP-23 is a biological active peptide. (an antimicrobial peptide (AMP) derived from porcine myeloid.)
|
- HY-P5743
-
|
Peptides
|
Inflammation/Immunology
|
IRGRILHDGAYSLTLQGLGIH is a multi-epitope class II rat HER2/neu peptide. IRGRILHDGAYSLTLQGLGIH can be used for the research class II HER2-DC1 vaccine studies .
|
- HY-P5743A
-
|
Peptides
|
Inflammation/Immunology
|
IRGRILHDGAYSLTLQGLGIH TFA is a multi-epitope class II rat HER2/neu peptide. IRGRILHDGAYSLTLQGLGIH TFA can be used for the research class II HER2-DC1 vaccine studies .
|
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
- HY-P5546
-
|
Bacterial
|
Infection
|
Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-256 μg/mL for methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection
|
- HY-P5011
-
- HY-P5616
-
|
Bacterial
|
Infection
|
Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively .
|
- HY-P5657
-
|
Peptides
|
Infection
|
Maximin H5 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5661
-
|
Peptides
|
Infection
|
Maximin H7 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5704
-
|
Bacterial
|
Infection
|
K11 is an antimicrobial peptide. K11 is active against MDR/XDR K. pneumoniae isolates (MIC: 8-512 μg/mL), and inhibits bacterial biofilm formation. K11 can act synergistically with antibiotics (Chloramphenicol (HY-B0239), Meropenem (HY-13678), Rifampicin (HY-B0272), etc.) against drug-resistant K. pneumoniae. K11 has high thermal and wide pH stability .
|
- HY-P6010
-
|
Integrin
|
Cancer
|
αvβ6-BP is a selective αvβ6 binding peptide, and can be used for molecular imaging .
|
- HY-P1025A
-
- HY-P1037
-
|
Motilin Receptor
|
Others
|
Motilin (26-47), human, porcine is an endogenous motilin receptor ligand with Ki and EC50 of 2.3 nM and 0.3 nM in a Chinese hamster ovary cell line.
|
- HY-P1541
-
Motilin (canine)
|
Motilin Receptor
|
Metabolic Disease
|
Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
|
- HY-P1568
-
Flagellin 22
|
Bacterial
|
Infection
|
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae .
|
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
- HY-P1840
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
Galanin Receptor Ligand M35 is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
- HY-P1840A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
- HY-P1035A
-
NPW-23 TFA
|
Peptides
|
Neurological Disease
|
Neuropeptide W-23 (human) (NPW-23) TFA, the active form of Neuropeptide W, is an endogenous agonist of NPBW1 (GPR7) and NPBW2 (GPR8) .
|
- HY-P4073
-
GRN1005; Paclitaxel trevatide
|
Antibody-Drug Conjugates (ADCs)
|
Cancer
|
ANG1005 (Paclitaxel trevatide) is a brain-penetrating peptide-drug conjugate. ANG1005, a taxane derivative, consists of three paclitaxel (HY-B0015) molecules covalently linked to Angiopep-2, designed to cross the blood-brain and blood-cerebrospinal barriers and to penetrate malignant cells via low density lipoprotein receptor-related protein (LRP1) transport system .
|
- HY-P4148
-
- HY-P4222
-
Caspase-8-IN-1
|
Caspase
|
Others
|
IETD-CHO (Caspase-8-IN-1) is a potent caspase-8 inhibitor .
|
- HY-P4793
-
|
Peptides
|
Metabolic Disease
|
Acetyl-Heme-Binding Protein 1 (1-21) (human) is a short peptide. It consists of the first 21 amino acids of the hemopexin Acetyl-Heme-Binding Protein 1. Acetyl-Heme-Binding Protein 1 can bind to heme and play a role in heme metabolism and hemoglobin release .
|
- HY-P4222A
-
|
Caspase
|
Others
|
IETD-CHO TFA (Caspase-8-IN-1) is a potent caspase-8 inhibitor .
|
- HY-106323
-
KW-5139
|
Motilin Receptor
|
Metabolic Disease
|
[Leu13]-Motilin (KW-5139) is a motilin analogue. [Leu13]-Motilin stimulates gastrointestinal motility in the rabbit. [Leu13]-Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro .
|
- HY-P5844
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor. α-Conotoxin AuIA is a α-conotoxin that can be isolated from Conus aulicus .
|
- HY-P5852
-
Alpha-conotoxin EIIB
|
nAChR
|
Neurological Disease
|
α-Conotoxin EIIB (Alpha-conotoxin EIIB) is a toxin peptide that can be obtained from Conus ermineus. α-Conotoxin EIIB binds to nAChR (Ki=2.2 nM). α-Conotoxin EIIB can be used in the study of neurological diseases such as schizophrenia, drug addiction, Alzheimer's disease, and Parkinson's disease .
|
- HY-P10157
-
|
Peptides
|
Others
|
ARF(1-22) is potentially capable of intracellular penetration to deliver small molecules, proteins, imaging agents, and pharmaceutical nanocarriers .
|
- HY-P1035
-
NPW-23
|
Peptides
|
Neurological Disease
|
Neuropeptide W-23 (human) (NPW-23), the active form of Neuropeptide W, is an endogenous agonist of NPBW1 (GPR7) and NPBW2 (GPR8) .
|
- HY-P1268
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
- HY-P1268A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
- HY-P2633
-
AC-100
|
Peptides
|
Metabolic Disease
|
Dentonin (AC-100) is a synthetic fragment derived from MEPE. Dentonin enhances osteogenesis by promoting osteoprogenitor adhesion and facilitates immature adherent cells survival. Dentonin has no significant effect to mature osteoblasts. Dentonin can be used for the research of phosphate homeostasis and bone metabolism .
|
- HY-P1266
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin EI is a selective nicotinic acetylcholine α1β1γδ receptor (nAChR) antagonist (IC50=187 nM) and an α3β4 receptor inhibitor. α-Conotoxin EI can block muscle and ganglionic receptors .
|
- HY-P5435
-
|
Peptides
|
Others
|
LKBtide is a biological active peptide. (This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.)
|
- HY-P5362
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-P5362A
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-P3117
-
Pituitary adenylate cyclase-activating peptide (6-27)
|
Adenylate Cyclase
|
Neurological Disease
|
PACAP (6-27) (human, ovine, rat) is a PACAP receptor antagonist that blocks the canine adrenal catecholamine response to exogenous vasoactive intestinal peptide (VIP). PACAP (6-27) (human, ovine, rat) has the potential to study cardiovascular and neurological diseases .
|
- HY-P5839
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin MrIC is an α7nAChR biased agonist. α-Conotoxin MrIC exclusively activates α7nAChR regulated by type II positive allosteric modulators, including PNU120596. α-Conotoxin MrIC can be used to study neurological diseases and also to probe the pharmacological properties of α7nAChR .
|
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
- HY-P5827
-
- HY-P6009
-
|
Integrin
|
Cancer
|
Cys-αvβ6-BP is a cysteine-terminated αvβ6 binding peptide .
|
- HY-P6010A
-
|
Integrin
|
Cancer
|
αvβ6-BP TFA is a selective αvβ6 binding peptide, and can be used for research of molecular imaging .
|
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P1184
-
- HY-P1184A
-
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
- HY-P3569
-
|
Peptides
|
Others
|
[D-Val22, Phe33] Big Endothelin-1 (16-38), human is a polypeptide.
|
- HY-P1928
-
|
Bcl-2 Family
|
Neurological Disease
Endocrinology
|
Humanin, an anti-apoptotic peptide of 24 amino acids, is a Bax inhibitor. Humanin prevents the translocation of Bax from cytosol to mitochondria, blocks Bax from the inactive to active conformation. Humanin is a mitochondria-associated peptide with a neuroprotective effect against AD-related neurotoxicity. Humanin also improves overall insulin sensitivity in animal. Humanin are related to aging . Humanin analogue, in which the serine at position 14 is replaced by glycine, names HNG .
|
- HY-P3993A
-
14-Glycine-Humanin (human) (acetate)
|
Apoptosis
|
Neurological Disease
|
(Gly14)-Humanin (human) (14-Glycine-Humanin (human)) acetate is an analog of Humanin in which the 14th amino acid serine was replaced with glycine (Gly). (Gly14)-Humanin (human) acetate has anti-apoptotic and neuroprotective functions .
|
- HY-P5339
-
|
Peptides
|
Others
|
Humanin C8A-HN is a biological active peptide. (Protection activity of humanin (HN) against neuronal cell death is abrogated in this peptide, where Cys8 is substituted by Ala.)
|
- HY-P1130
-
Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide
|
Neuropeptide Y Receptor
|
Neurological Disease
|
M871 (Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide) is a selective galanin receptor type 2 (GalR2) antagonist. M871 exhibits Ki values of 13.1 nM and 420 nM for GalR2 and GalR1, respectively. M871 can be used for research on GalR2-related diseases (such as epilepsy, pain) .
|
- HY-P5849
-
αA-OIVA
|
nAChR
|
Neurological Disease
|
αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR. αA-Conotoxin OIVA is a peptide that can be derived from conotoxin. αA-Conotoxin OIVA paralyzes muscles .
|
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
- HY-P5089
-
|
Peptides
|
Infection
|
Enterotoxin STp (E. coli) is a heat-stable enterotoxin that can be used in vaccine research .
|
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
- HY-P1480
-
- HY-P2171
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P2171A
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide TFA is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide TFA functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
- HY-P1328A
-
|
Keap1-Nrf2
|
Others
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
- HY-P1112
-
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
- HY-P2507
-
|
Peptides
|
Cancer
|
NY-ESO-1 (87-111) is a pan-MHC class II-restricted peptide sequence. NY-ESO-1 (87-111) binds to multiple HLA-DR and HLA-DP4 molecules, and stimulates Th1-type and Th-2/Th0-type CD4 + T cells when presented in the context of HLA-DR and HLA-DP4 molecules .
|
- HY-P4210
-
ALRN-6924; MP-4897
|
MDM-2/p53
|
Cancer
|
Sulanemadlin (ALRN-6924) is a potent and cell-permeating p53-based peptidomimetic macrocycles. Sulanemadlin is a inhibitor of the p53-MDM2, p53-MDMX, or both p53 and MDM2 and MDMX protein-protein interactions. Sulanemadlin can be used for cancers research .
|
- HY-P4352
-
|
HIV
|
Others
|
HIV-2 Peptide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4805
-
- HY-P1190
-
|
JNK
Apoptosis
|
Inflammation/Immunology
|
c-JUN peptide is a cell-permeable c-JUN-JNK interaction inhibitor. c-JUN peptide inhibits serum-induced c-Jun phosphorylation. c-JUN peptide induces apoptosis .
|
- HY-P5577
-
- HY-P5615
-
|
Bacterial
|
Infection
|
XT-2 peptide is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-2 peptide has strong activity against E.coli, the vaule of MIC is 8 μM .
|
- HY-P5641
-
|
Bacterial
|
Infection
|
Pleurocidin is an antibacterial peptide derived from skin secretions of Winter Flounder .
|
- HY-P5696
-
|
Bacterial
Parasite
Fungal
|
Infection
|
Xenopsin precursor fragment is an antimicrobial peptide, and has antibacterial/antifungal (10-500 μg/mL) and anti-protozoal (MIC: 2-20 μg/mL) activity .
|
- HY-P1011
-
- HY-P6009A
-
|
Integrin
|
Cancer
|
Cys-αvβ6-BP TFA is a cysteine-terminated αvβ6 binding peptide .
|
- HY-P1098
-
Ac2-26
3 Publications Verification
|
NF-κB
|
Inflammation/Immunology
|
Ac2-26, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
- HY-P1098A
-
|
NF-κB
|
Inflammation/Immunology
|
Ac2-26 TFA, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
- HY-P2222
-
- HY-P0184A
-
|
NO Synthase
|
Neurological Disease
|
Camstatin TFA, a functionally active 25-residue fragment of PEP-19's IQ motif, binds calmodulin and inhibits neuronal nitric oxide (NO) synthase .
|
- HY-P4121
-
|
Peptides
|
Metabolic Disease
|
L17E, an endosomolytic peptide, is a cationic amphiphilic peptide with specific membrane lytic activity for late endosomes (LEs). L17E diminishes the TS5-p45 induced apoptosis in a dose-dependent manner. L17E is endocytosed into cells and trafficked to LEs. Within the acidic environment of LEs, L17E perturbs and lyses the LE membrane, leading to disruption of LE membrane and release of LE content to the cytosol. L17E is used to investigate the role of the endosomal protein trafficking pathway .
|
- HY-P5589
-
PlnA
|
Bacterial
|
Infection
|
Plantaricin A is an antimicrobial peptide derived from LactobacifZus plantarum against bacteria .
|
- HY-P5682
-
|
Bacterial
|
Infection
|
Maximin 41 is an antimicrobial peptide. Maximin 41 has antibacterial activity against S. aureus (MIC: 75 μg/mL). Maximin 41 has hemolytic activities against human red cells .
|
- HY-P1098B
-
|
IKK
|
Inflammation/Immunology
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
- HY-P10049
-
|
Akt
|
Cancer
|
TAT-TCL1-Akt-in is an Akt inhibitor .
|
- HY-P2222A
-
- HY-P1566
-
|
HIV
|
Infection
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
- HY-P1915
-
|
Peptides
|
Metabolic Disease
|
26Rfa, Hypothalamic Peptide, human is a hypothalamic neuropeptide of the RFamide peptide family with orexigenic activity . 26RFa is an orexigenic neuropeptide identified as the endogenous ligand of the orphan G protein-coupled receptor GPR103 .
|
- HY-P2472
-
26RFa (mouse, rat)
|
Peptides
|
Metabolic Disease
|
Orphan GPCR SP9155 agonist P550 (mouse, rat) (26RFa (mouse, rat)), a member of the RFamide peptide family with orexigenic effect, is the cognate ligand of the mouse orphan receptor GPR103, also designated SP9155 or AQ27 .
|
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P4076
-
|
Peptides
|
Cancer
|
MPG peptides, Pβ is a primary amphiphilic peptide consisting of three domains .
|
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
- HY-P3509A
-
|
Peptides
|
Cancer
|
PNC-28 acetate is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 acetate can be used for pancreatic cancer research .
|
- HY-P2700
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin GIIIB is a 22-residue polypeptide that can be isolated from the venom of piscivorous cone snail Conus geographus. μ-Conotoxin GIIIB is a NaV1.4 channel inhibitor. μ-Conotoxin GIIIB blocks muscle cell's contraction .
|
- HY-P5658
-
|
Peptides
|
Infection
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P5659
-
|
Peptides
|
Infection
|
Brevinin-1 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P10074
-
|
ERK
|
Inflammation/Immunology
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
- HY-P1732
-
|
Peptides
|
Cancer
|
Transportan is a 27 amino acid-long peptide containing 12 functional amino acids from the amino terminus of the neuropeptide galanin and mastoparan in the carboxyl terminus, connected via a lysine. Transportan belongs to cell-penetrating peptides (CPPs) .
|
- HY-P0176A
-
PACAP 1-27 TFA
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
PACAP (1-27), human, ovine, rat TFA (PACAP 1-27 TFA) is the N-terminal fragment of PACAP-38, and is a potent PACAP receptor antagonist with IC50s of 3 nM, 2 nM and 5 nM for rat PAC1, rat VPAC1 and human VPAC2, respectively .
|
- HY-P1135A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
M1145 TFA, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 TFA shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 TFA has an additive effect on the signal transduction of galanin .
|
- HY-P4195
-
|
Peptides
|
Metabolic Disease
|
[K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
- HY-P5133
-
SSTN92-119
|
Integrin
|
Cancer
|
Synstatin (92-119) is an anti-tumor agent that inhibits angiogenesis and cancer cell invasion. Synstatin (92-119) down-regulates integrin α?β3 and reduces the activation of angiogenic growth factors VEGF and FGF-2 .
|
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
- HY-103285
-
Porcine gastrin-releasing peptide 27
|
Peptides
|
Cancer
|
GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors .
|
- HY-P5588
-
|
Fungal
|
Infection
|
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5580
-
|
Bacterial
|
Infection
Cancer
|
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (MIC: 1.3, 2.3, 5.0, 2.6, 2.3 μM for S. aureus, P. aeruginosa, P. aeruginosa, E. (ATCC 25922), E. (54127) respectively). Dermaseptin-B3 also inhibits tumor cell proliferation .
|
- HY-P5621
-
|
Bacterial
|
Infection
|
Maximin 63 is an antimicrobial peptide derived from the brain of a toad. Maximin 63 has strong activity against S.aureus (MIC: 18.8 μg/mL) .
|
- HY-P5685
-
|
Bacterial
|
Infection
|
Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells .
|
- HY-P4195A
-
|
Peptides
|
Metabolic Disease
|
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for? the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
- HY-P1339
-
- HY-P1349
-
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
- HY-P1339A
-
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
- HY-P1340
-
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
[Ala11,D-Leu15]-Orexin B(human) is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
- HY-P1340A
-
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
[Ala11,D-Leu15]-Orexin B(human) TFA is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) TFA shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
- HY-P4129
-
|
nAChR
|
Others
|
Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide. Rabies Virus Matrix Protein Fragment targets the acetylcholine receptor (AChR) that exists on the cell surface .
|
- HY-P4857
-
|
Peptides
|
Endocrinology
|
pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent antagonist of parathyroid hormone (PTH) .
|
- HY-P5894
-
Galanin-like peptide (3-32)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
human GALP (3-32) (Galanin-like peptide (3-32)) is a potent galanin receptor agonist with high affinity for both GalR1 (IC50=33 nM) and GalR2 (IC50=15 nM) in a competitive binding study. human GALP (3-32) exhibits the high potency in altering the extracellular acidification rate of SH-SY5Y cells transfected with GalR2 (EC50=360 nM) .
|
- HY-P5552
-
|
Bacterial
Parasite
Fungal
|
Infection
|
Melimine is a hybrid antimicrobial peptide of Melittin (HY-P0233) and Protamine. Melimine is active against P. aeruginosa and S. aureus. Melimine has broad spectrum activity against bacteria, fungi and protozoa .
|
- HY-P10006
-
|
Opioid Receptor
|
Neurological Disease
|
Leumorphin, human is a potent kappa opioid receptor (κ opioid receptor) agonist. Leumorphin, human inhibits the contraction of the myenteric plexus-longitudinal muscle preparation of the guinea pig ileum .
|
- HY-P10138
-
- HY-P10138A
-
- HY-P1155
-
rGHRH(1-29)NH2
|
Peptides
|
Cancer
|
GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
|
- HY-P4385
-
|
PTHR
|
Metabolic Disease
|
(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent PTH-1R antagonist .
|
- HY-P4776
-
|
Peptides
|
Metabolic Disease
|
Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27), a vasoactive intestinal peptide (VIP), is a VIP1 antagonist .
|
- HY-P5167
-
|
Peptides
|
Inflammation/Immunology
|
GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink tarantula. GsAF-1 can be used for research of moderate-to-severe pain .
|
- HY-P5424
-
|
Peptides
|
Others
|
RyR1(3614-3643) is a biological active peptide. (the absolutely conserved peptide corresponding to the CaM-binding domain of RyR1 in all vertebrates)
|
- HY-P5583
-
|
Peptides
|
Infection
|
Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily .
|
- HY-P5074
-
|
GCGR
|
Metabolic Disease
|
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets .
|
- HY-P5724
-
|
Bacterial
|
Infection
|
Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality .
|
- HY-P5912
-
|
Peptides
|
Neurological Disease
|
GluN1 (356-385) is an antigenic peptide against
N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the
effect of reducing the density of surface NMDAR clusters in hippocampal
neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR
encephalitis .
|
- HY-P2080
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide,human is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P2080B
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P2317
-
|
Bacterial
Endogenous Metabolite
|
Infection
|
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection .
|
- HY-P2541
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
- HY-P2541A
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
- HY-P0062B
-
- HY-P4405
-
|
Peptides
|
Endocrinology
|
(D-Ala2)-GRF (1-29) amide (human) is a superagonist of GRF, exhibiting extremely high GH-releasing activity about 50 times that of GRF (1-29) in both pigs and rats .
|
- HY-P4751
-
- HY-P5336
-
- HY-P2080C
-
|
Insulin Receptor
|
Metabolic Disease
|
GIP (1-30)-Myr is the Myr-modified GIP (1-30), which is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P4966
-
- HY-P4858
-
|
GSK-3
|
Cancer
|
C-Peptide 1 (rat), a peptide, is aβ-catenin/GSK-3β activator. C-Peptide 1 (rat) can regulate the Wnt/β-catenin signaling pathway. C-Peptide 1 (rat) can be used for the research of cancer .
|
- HY-P5585
-
|
Peptides
|
Infection
|
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor .
|
- HY-P10108
-
Hxk2VBD peptide
|
Hexokinase
|
Neurological Disease
|
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth .
|
- HY-P1106
-
|
CRFR
|
Cardiovascular Disease
|
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 can be used for hypotension study .
|
- HY-P1106A
-
|
CFTR
|
Cardiovascular Disease
|
K41498 TFA is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 TFA is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 TFA can be used for hypotension study .
|
- HY-P0211
-
|
Peptides
|
Cardiovascular Disease
|
[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human), a growth hormone releasing factor (GRF) analogue, is a vasoactive intestinal peptide (VIP) antagonist .
|
- HY-P4750
-
|
Peptides
|
Endocrinology
|
Acetyl-(D-Arg2)-GRF (1-29) amide (human) is an antagonist of growth hormone releasing factor (GRF). Acetyl-(D-Arg2)-GRF (1-29) amide (human) inhibits the release of growth hormone (GH) and can be used for endocrine research .
|
- HY-P4372
-
|
Peptides
|
Others
|
Hepcidin-22 (human) is an inactive degradation product of hepcidin-25 that is present in the urine .
|
- HY-P4968
-
|
Peptides
|
Others
|
Tau Peptide (337-368) (Repeat 4 Domain) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5207
-
|
Bacterial
|
Infection
|
Garvicin KS, GakC is a peptide at sizes of 32 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakB. Garvicin KS, GakC inhibits fibroblast viability and proliferation. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
- HY-P5559
-
|
PROTACs
|
Cancer
|
ND1-YL2 is a PROTAC that selectively degrades SRC-1 via the N-degron pathway. ND1-YL2 significantly inhibits cancer invasion and migration in vitro and in vivo. ND1-YL2 can be used in cancer research .
|
- HY-P5828
-
- HY-P5864
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
- HY-P4700
-
- HY-120521
-
|
Peptides
|
Neurological Disease
|
Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc .
|
- HY-P5825
-
- HY-P3304
-
|
Peptides
|
Neurological Disease
Cancer
|
MR 409 is a selected growth hormone-releasing hormone (GHRH) agonist. MR 409 has remarkable neuroprotective effects through enhancing endogenous neurogenesis in cerebral ischemic mice. MR 409 also inhibits the in vivo growth of lung cancer .
|
- HY-P5799
-
SNX-238
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIID (SNX-238) is a Conus peptide that blocks an ω-Conotoxin-GVIA-sensitive, high-threshold Ca 2+ current in fish retinal ganglion cells .
|
- HY-P5803
-
|
Bacterial
|
Infection
|
Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM .
|
- HY-P5014
-
- HY-P5817
-
|
Sodium Channel
|
Neurological Disease
|
ω-Conotoxin CVIB is a non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs) antagonist. ω-Conotoxin CVIB inhibits depolarization-activated whole-cell VGCC currents in dorsal root ganglion (DRG) neurons with a pIC50 of 7.64 .
|
- HY-P10025
-
- HY-P1229
-
- HY-P0220
-
|
PACAP Receptor
|
Neurological Disease
|
PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
- HY-P0220A
-
|
PACAP Receptor
|
Neurological Disease
|
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
- HY-P1021A
-
- HY-P2311
-
- HY-P1294A
-
|
CRFR
|
Neurological Disease
|
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM .
|
- HY-P5119
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
|
- HY-P5119A
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
|
- HY-P5206
-
|
Bacterial
|
Infection
|
Garvicin KS, GakB is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakA, and GakC. Garvicin KS, GakB inhibits fibroblast viability and proliferation. Garvicin KS, GakB with GakA, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
- HY-P5714
-
|
Bacterial
|
Infection
|
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain .
|
- HY-P1021
-
- HY-108742A
-
BA 058 TFA; BIM 44058 TFA
|
Thyroid Hormone Receptor
Arrestin
|
Metabolic Disease
Endocrinology
|
Abaloparatide TFA (BA 058 TFA) is a parathyroid hormone receptor 1 (PTHR1) analogue. Abaloparatide TFA also is a selective PTHR1 activator. Abaloparatide TFA enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide TFA enhances bone formation and cortical structure in mice. Abaloparatide TFA has the potential for the research of osteoporosis .
|
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-P0188A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
- HY-P2543
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor .
|
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P10000
-
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion .
|
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-P2687
-
Urodilatin (human)
|
Peptides
|
Cardiovascular Disease
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
- HY-108742
-
BA 058; BIM 44058
|
Thyroid Hormone Receptor
Arrestin
|
Metabolic Disease
|
Abaloparatide (BA 058) is a parathyroid hormone receptor 1 (PTHR1) analog. Abaloparatide also is a selective PTHR1 activator. Abaloparatide enhances Gs/cAMP signaling and β-arrestin recruitment. Abaloparatide enhances bone formation and cortical structure in mice. Abaloparatide has the potential for the research of osteoporosis .
|
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P5143
-
|
Calcium Channel
|
Inflammation/Immunology
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
- HY-P5878
-
|
Biochemical Assay Reagents
|
Metabolic Disease
|
RG33 Peptide is a diabetes inhibitor that significantly improves glucose clearance in insulin-resistant mice. RG33 Peptide effectively solubilizes lipid vesicles and promotes cholesterol efflux in cultured macrophages. RG33 Peptide is used in research into type 2 diabetes (T2D) .
|
- HY-P4701
-
Human PTHRP-(1-34)NH2
|
Peptides
|
Metabolic Disease
|
pTH-Related Protein (1-34) amide (human, mouse, rat) (Human PTHrP-(1-34)NH2) is a N-terminal fragments of PTHrP. pTH-Related Protein (1-34) amide (human, mouse, rat) induces hypercalcemia, and can be used for research of humoral hypercalcaemia of malignancy .
|
- HY-P5020
-
|
Bacterial
|
Infection
Cancer
|
Crotalicidin is an antimicrobial peptide and anti-tumor peptide that can effectively inhibit the activity of Gram-negative bacteria and tumor cells. Crotalicidin can be obtained from rattlesnake venom. Crotalicidin can be used in the study of microbial infections and cancer .
|
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
- HY-P5822
-
- HY-P1601
-
- HY-P2250
-
ELA-32 negative control
|
Peptides
|
Others
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
- HY-P2196
-
- HY-P4752
-
|
Peptides
|
Others
|
KWKHGAEIVYKSPVV-{S(GlcNAc-β-D)}-GDTSPRHLSNVK-{K(biotinyl)}-NH2 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4606
-
|
Peptides
|
Others
|
(Ile5,Trp23,Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4715
-
|
PTHR
|
Endocrinology
|
(Tyr36)-pTH-Related Protein (1-36) (human, mouse, rat) is a peptide and can be used as a parathyroid hormone (PTH) receptor ligand .
|
- HY-P5149
-
αC-PrXA
|
nAChR
|
Neurological Disease
|
αC-Conotoxin PrXA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 1.8 nM (α1β1εδ, adult) and 3.0 nM (α1β1γδ, fetal), respectively. αC-Conotoxin PrXA competes with α-bungarotoxin at the α/δ and α/γ subunit interfaces of the nAChR, shows high specificity against neuromuscular nAChR .
|
- HY-P5497
-
|
HIV
|
Others
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
- HY-P5942
-
- HY-P5651
-
|
Peptides
|
Infection
|
PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans .
|
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P10158
-
Porcine cathelicidin PMAP-36
|
Bacterial
|
Infection
|
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
|
- HY-P1514
-
- HY-P0198A
-
- HY-P1222
-
|
Bacterial
|
Infection
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
|
- HY-P1222A
-
|
Bacterial
|
Infection
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
|
- HY-P1513A
-
|
Bacterial
|
Infection
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
- HY-P0212A
-
|
GCGR
|
Metabolic Disease
|
Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
- HY-P1323
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) can increase blood pressure in anesthetized rats and increases food intake .
|
- HY-P1323A
-
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) TFA is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA can increase blood pressure in anesthetized rats and increases food intake .
|
- HY-P0208
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
[Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects .
|
- HY-P3877
-
- HY-P4741
-
|
Peptides
|
Others
|
LL-37 (37-1) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4849
-
|
Peptides
|
Others
|
pTH-Related Protein (1-37) (human, mouse, rat), the peptide analogue of pTH-Related Protein (pTHrP). pTHrP refers to parathyroid-hormone-related protein, involved in physiological regulation of bone formation .
|
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively .GrTx1 can be used for neurological disease research .
|
- HY-P5836
-
|
Interleukin Related
Bacterial
Enterovirus
|
Inflammation/Immunology
|
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B .
|
- HY-P5837
-
|
Interleukin Related
Enterovirus
|
Inflammation/Immunology
|
Citrullinated LL-37 2cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 2cit reduces LL-37 activity against HRV at 10 μg/mL and reduces the antibacterial effect of LL-37. Citrullinated LL-37 2cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B. Citrullinated LL-37 2cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
- HY-P5838
-
|
Peptides
|
Inflammation/Immunology
|
Citrullinated LL-37 5cit is a citrullinated LL-37 (HY-P1222) peptide. The antiviral and antibacterial effects of Citrullinated LL-37 5cit are significantly reduced compared to native LL-37. Citrullinated LL-37 5cit is unable to reduce LPS-mediated release of TNF-α due to a lack of LPS-binding capacity .
|
- HY-P5842
-
|
Bacterial
Influenza Virus
|
Infection
|
Citrullinated LL-37 3cit is a host defense peptide (HDP) with broad immunomodulatory and antimicrobial activities. Citrullinated LL-37 3cit exhibits direct antiviral effects against human rhinoviruses (HRV) .
|
- HY-P5843
-
|
Enterovirus
|
Infection
|
Citrullinated LL-37 3cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 3cit lacks all antiviral activity at 10 μg/mL and retains some activity against HRV at 30 μg/mL. Citrullinated LL-37 3cit reduces the immunomodulatory activity of LL-37. Citrullinated LL-37 3cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
- HY-P3877A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM .
|
- HY-P0052
-
T20; DP178
|
HIV
|
Infection
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
- HY-P1539
-
- HY-P0052A
-
T20 acetate; DP178 acetate
|
HIV
|
Infection
|
Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
|
- HY-P0198B
-
- HY-P4744
-
|
Bacterial
|
Infection
Cancer
|
LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research .
|
- HY-P5076
-
|
Peptides
|
Others
|
Biotinyl-LL-37 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0221B
-
|
PACAP Receptor
|
Endocrinology
|
PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
- HY-P0221C
-
|
PACAP Receptor
|
Endocrinology
|
PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P5498
-
|
Peptides
|
Others
|
N36 peptide is a biological active peptide. (HIV-1 gp41 fusion peptide)
|
- HY-P2785
-
- HY-P3037
-
|
Calcium Channel
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs)? enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P5319
-
|
Peptides
|
Others
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
- HY-P2785A
-
- HY-P4744A
-
|
Bacterial
|
Infection
Cancer
|
LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used for cancer research .
|
- HY-P0221
-
Pituitary Adenylate Cyclase Activating Polypeptide 38
|
PACAP Receptor
|
Neurological Disease
|
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
- HY-P0221A
-
Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
|
PACAP Receptor
|
Neurological Disease
|
PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
- HY-P2847
-
|
CRFR
|
Metabolic Disease
Endocrinology
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow .
|
- HY-P4765
-
|
Peptides
|
Others
|
Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4734
-
|
Peptides
|
Others
|
5-FAM-LL-37 (scrambled) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5363
-
Prostatic Acid Phosphatase(248-286)
|
HIV
|
Others
|
PAP 248–286 is a biological active peptide. (Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.)
|
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
- HY-103545
-
Gastric inhibitory peptide (1-39) (porcine)
|
Peptides
|
Metabolic Disease
|
GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca 2+ concentration ([Ca 2+]i), and capable of enhancing exocytosis .
|
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
- HY-P5007
-
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the carboxyl terminus of the arginine vasopressin (AVP) precursor peptide. Copeptin (human) can be used in the study of cardiovascular disease .
|
- HY-P5649
-
|
Peptides
|
Infection
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
- HY-P5177
-
- HY-P5130
-
|
Peptides
|
Cardiovascular Disease
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
- HY-P10141
-
|
JNK
|
Cancer
|
JNK-IN-15, Cell-Permeable, Negative Control is a negative control of JNK-IN-15, Cell-Permeable (HY-P10140). JNK-IN-15, Cell-Permeable is an inhibitor of JNK .
|
- HY-P10140
-
|
JNK
|
Cancer
|
JNK-IN-15, Cell-Permeable (JNK inhibitor III) is an inhibitor of JNK. JNK-IN-15, Cell-Permeable can used in study age-related neurodegenerative diseasev .
|
- HY-P1298
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P2609F
-
|
PACAP Receptor
|
Others
|
PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221)
|
- HY-P1681
-
- HY-P5057
-
|
Peptides
|
Others
|
5-FAM-LL-37 is afluorescent labeled LL-37, human (HY-P1222).
|
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
- HY-P5793
-
- HY-P3397
-
|
Peptides
|
Cancer
|
JV-1-36 is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
- HY-P2786A
-
- HY-P3397A
-
|
Peptides
|
Cancer
|
JV-1-36 acetate is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 acetate inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
- HY-P1542
-
Catostomus urotensin I
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
- HY-P1767
-
|
Peptides
|
Cardiovascular Disease
|
Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus .
|
- HY-P1378
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
- HY-P1378A
-
|
Amyloid-β
|
Neurological Disease
|
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
- HY-P1298A
-
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
- HY-P1542B
-
Catostomus urotensin I TFA
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
- HY-P4074
-
|
Peptides
|
Others
|
Anti-BetaGamma, a peptide, is MPS-Phosducin-like protein C terminus .
|
- HY-P5285
-
|
Parasite
|
Infection
Inflammation/Immunology
Cancer
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells .
|
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5059
-
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
- HY-P5628
-
|
Peptides
|
Infection
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
- HY-P5631
-
|
Peptides
|
Infection
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
- HY-P5056
-
- HY-P10026
-
LY-3457263
|
Peptides
|
Metabolic Disease
|
Nisotirotide (LY-3457263) is a PYY analog agonist studied in type 2 diabetes and obesity .
|
- HY-P3684A
-
|
CRFR
|
Neurological Disease
|
[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat .
|
- HY-P10093
-
|
PI3K
|
Others
|
Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system diseases .
|
- HY-P0089
-
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P2538
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P0089A
-
Growth Hormone Releasing Factor human TFA; Somatorelin (1-44) amide (human) (TFA)
|
GHSR
|
Endocrinology
|
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
- HY-P4912
-
|
Peptides
|
Others
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P1368
-
Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)
|
CRFR
|
Endocrinology
|
Stressin I (Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)) is a potent CRF1 receptor-selective agonist with a Ki of 1.7 nM. Stressin I induces increases in adrenocorticotropic hormone (ACTH) levels in rats .
|
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
- HY-P1368A
-
Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41) TFA
|
CRFR
|
Endocrinology
|
Stressin I (Cyclo(31-34)[DPhe12,Nle21,38,Glu31,Lys34]Ac-hCRF(4-41)) TFA is a potent CRF1 receptor selective agonist, Ki is 1.7 nM. Stressin I induces an increase in adrenocorticotropic hormone (ACTH) levels in rats .
|
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
- HY-P4157
-
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells .
|
- HY-P4157A
-
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells .
|
- HY-P4395
-
|
Peptides
|
Others
|
(Asp76)-pTH (39-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4127
-
|
Peptides
|
Neurological Disease
|
M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches .
|
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
- HY-P4884
-
- HY-P5710
-
|
Bacterial
|
Infection
|
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo .
|
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P10078
-
- HY-P4127A
-
- HY-P3465
-
Myrcludex B
|
HBV
|
Infection
|
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research .
|
- HY-P4975
-
|
Peptides
|
Others
|
CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5806
-
ErgTx1
|
Peptides
|
Neurological Disease
|
Ergtoxin-1 is a potassium channel blocker.
Ergtoxin-1 is isolated from the venom of the Mexican scorpion
Centruroides noxius. Ergtoxin 1 can block
ERG-K + channels in nerve, heart and endocrine cells .
|
- HY-P4728
-
|
Peptides
|
Others
|
Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
- HY-P1304
-
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
- HY-P1022
-
Metastin(human)
|
GnRH Receptor
|
Endocrinology
Cancer
|
Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion .
|
- HY-P1022A
-
Metastin(human) TFA
|
GnRH Receptor
|
Endocrinology
Cancer
|
Kisspeptin-54(human) TFA (Metastin(human) TFA) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) TFA binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) TFA hinders tumor metastasis and stimulates gonadotropin secretion .
|
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
- HY-P1156A
-
- HY-P4933
-
|
Tau Protein
|
Others
|
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P2291
-
|
Bacterial
|
Inflammation/Immunology
|
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
- HY-P2291A
-
|
Bacterial
|
Inflammation/Immunology
|
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
- HY-P4890
-
- HY-P4890A
-
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
- HY-P4845
-
|
Peptides
|
Others
|
pTH (7-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4829
-
|
Peptides
|
Others
|
pTH (1-84) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4827
-
|
Peptides
|
Others
|
pTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-108801
-
VEGF Trap; VEGF-TRAPR1R2; VEGF-trapR1
|
VEGFR
|
Cardiovascular Disease
Metabolic Disease
|
Aflibercept (VEGF Trap) is a soluble decoy VEGFR constructed by fusing the Ig domains of VEGFR1 and VEGFR2 with the Fc region of human IgG1. Aflibercept inhibits VEGF signaling by reducing VEGF-regulated processes. Aflibercept can be used for thr research of age-related macular degeneration (AMD) and cardiovascular disease .
|
-
- HY-108801A
-
|
VEGFR
|
Cardiovascular Disease
Metabolic Disease
|
Aflibercept (VEGF Trap) is a soluble decoy VEGFR constructed by fusing the Ig domains of VEGFR1 and VEGFR2 with the Fc region of human IgG1. Aflibercept inhibits VEGF signaling by reducing VEGF-regulated processes. Aflibercept can be used for thr research of age-related macular degeneration (AMD) and cardiovascular disease .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-160266
-
|
THR-β agonist-1 (Example 2) is a THR-β agonist, with EC50 values of 52 nM and 1017 nM for THR-β and THR-α, respectively .
|
-
-
- HY-W007706S
-
|
Fmoc-Thr(tBu)-OH- 13C4, 15N is a 15N-labeled and 13C-labled 2-Acetamidobenzamide[1].
|
-
-
- HY-W012874S
-
|
D-Threonine-d2 is the deuterium labeled D-Threonine. D-Threonine (H-D-Thr-OH) is an enantiomer of L-threonine. D-Threonine is a metabolite of Saccharomyces cerevisiae.
|
-
-
- HY-P1142S1
-
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
-
- HY-P1142S
-
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
-
- HY-163423S
-
|
TELAEPTSTR-(Arg- 13C6, 15N4) is 13C and 15N labeled TELAEPTSTR-(Arg).
|
-
-
- HY-P2625S1
-
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
-
- HY-P2625S
-
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
-
- HY-156345S1
-
|
LPFTFGQGTK-(Lys- 13C6, 15N2) TFA is the peptide containing 13C- and 15N-labeled Lys.
|
-
-
- HY-163427S
-
|
FNLEALVTHTLPFEK-(Lys- 13C6, 15N2) is 13C and 15N labeled FNLEALVTHTLPFEK-(Lys) .
|
-
-
- HY-P0014S2
-
|
Liraglutide- 13C6, 15N (TFA)is the 13C and 15N labeledLiraglutide(HY-P0014). Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
-
-
- HY-P0014S
-
|
Liraglutide-d8 (triTFA) is the deuterium labeled Liraglutide (HY-P0014)[1].
|
-
-
- HY-P0014S1
-
|
Liraglutide- 13C5, 15N (tetraTFA)is the 13C and 15N labeledLiraglutide(HY-P0014) . Liraglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist used clinically to treat type 2 diabetes mellitus .
|
-
-
- HY-P5190S
-
|
RQIK-(Lys-fructosyl)-QTA-(Leu- 13C6, 15N)-VE is the 13C and 15N labeled compound .
|
-
-
- HY-163422S
-
|
PHSHPALTPEQK-(Lys- 13C6, 15N2) is 13C and 15N labeled PHSHPALTPEQK-(Lys).
|
-
-
- HY-P5201S1
-
|
VTSEGAGLQLQK- 13C6, 15N2 (TFA) is the 13C- and 15N-labeled VTSEGAGLQLQK. VTSEGAGLQLQK is an amino acid sequence in the C-terminal region of recombinant human alpha-acid glucosidase (rhGAA), which can be used to bind anti-drug antibodies in plasma and quantitatively analyze the therapeutic effect .
|
-
-
- HY-156343S1
-
|
SNNYATHYAESVK-(Lys- 13C6, 15N2) (TFA) is the peptide containing 13C- and 15N-labeled Lys.
|
-
-
- HY-156341S1
-
|
LLIYYTSSLHSGVPSR-(Arg- 13C6, 15N4) (TFA) is the peptide containing 13C- and 15N-labeled Arg.
|
-
Cat. No. |
Product Name |
Application |
Reactivity |
-
- HY-P80813
-
MAPK1/MAPK3
|
WB, IP
|
Human, Hamster, Rat |
Phospho-ERK1/2 (Thr202/Thr185) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 44,42 kDa, targeting to Phospho-ERK1/2 (Thr202/Thr185). It can be used for WB,IP assays with tag free, in the background of Human, Hamster, Rat.
|
-
- HY-P80474
-
|
WB, ICC/IF, FC
|
Human |
Phospho-PLK1 (Thr210) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 68 kDa, targeting to Phospho-PLK1(T210). It can be used for WB,ICC/IF,FC assays with tag free, in the background of Human.
|
-
- HY-P80814
-
MAPK1/MAPK3
|
WB
|
Human, Mouse, Rat |
Phospho-ERK1/2 (Thr202/Tyr204)/(Thr185/Tyr187) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 44,42 kDa, targeting to Phospho-ERK1/2 (Thr202/Tyr204)/(Thr185/Tyr187). It can be used for WB assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P81190
-
p-PERK(THR980); PERK(Phospho THR980); PERK(Phospho T980); mo(THR980)/hu (THR982)/rat (THR974); HRI; HsPEK; Pancreatic eIF2-alpha kinase; PEK; PRKR like endoplasmic reticulum kinase; WRS; DKFZp781H1925; EC 2.7.11.1; EIF2AK3; Eukaryotic translation initiation factor 2 alpha kinase 3; Heme regulated EIF2 alpha kinase.
|
WB; ELISA; IHC-P; IHC-F; Flow-Cyt; IF
|
Human, Mouse, Rat(predicted: Dog, Pig, Cow, Rabbit) |
Phospho-PERK (Thr980) Antibody is an unconjugated, approximately 119 kDa, rabbit-derived, anti-PERK (Thr980) polyclonal antibody. Phospho-PERK (Thr980) Antibody can be used for: WB, ELISA, IHC-P, IHC-F, Flow-Cyt, IF expriments in human, mouse, rat, and predicted: dog, pig, cow, rabbit background without labeling.
|
-
- HY-P82886
-
PRKCG; PKCG; Protein kinase C gamma type; PKC-gamma
|
WB, IHC-P
|
Human, Mouse |
-
- HY-P82836
-
EEF2; EF2; Elongation factor 2; EF-2
|
WB
|
Human |
-
- HY-P82877
-
B23; NPM
|
WB, IHC-P, IP
|
Human, Rat |
-
- HY-P81695
-
-
- HY-P81302A
-
-
- HY-P81968
-
Protein regulator of cytokinesis 1
|
WB, IHC-F, IHC-P, ICC/IF
|
Human |
-
- HY-P82827
-
CDKN2; p33(CDK2)
|
WB, IHC-P, IP
|
Human |
-
- HY-P80797
-
CDC2; CDC28A; P34CDC2
|
WB, IP
|
Human, Hamster |
Phospho-CDK1/2/3 (Thr14) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 34 kDa, targeting to Phospho-CDK1/2/3 (Thr14). It can be used for WB,IP assays with tag free, in the background of Human, Hamster.
|
-
- HY-P80807
-
CCNE1; CCNE; G1/S-specific cyclin-E1
|
WB
|
Human |
Phospho-Cyclin E1 (Thr395) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 47 kDa, targeting to Phospho-Cyclin E1 (Thr395). It can be used for WB assays with tag free, in the background of Human.
|
-
- HY-P82934
-
PRKCZ; PKC2; Protein kinase C zeta type; nPKC-zeta
|
WB, IHC-P
|
Human, Mouse, Rat |
-
- HY-P81301
-
RB1; Retinoblastoma-associated protein; p105-Rb; pRb; Rb; pp110
|
WB, IHC-P, IP
|
Human, Rat |
-
- HY-P81301D
-
RB1; Retinoblastoma-associated protein; p105-Rb; pRb; Rb; pp110
|
WB, IHC-P
|
Human, Rat |
-
- HY-P83304
-
Histone H1b; Histone H1s-4
|
WB, IHC-P, ICC/IF
|
Human, Mouse, Rat |
-
- HY-P80840
-
NFKB3; RELA; TF65; Transcription factor p65; p65; NFkB
|
WB, IHC-P, ICC/IF
|
Human, Mouse, Rat |
Phospho-NF-KB p65 (Thr254) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 60 kDa, targeting to Phospho-NF-KB p65 (Thr254). It can be used for WB,IHC-P,ICC/IF assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P81298A
-
PRKCA; PKCA; PRKACA; Protein kinase C alpha type; PKC-A; PKC-alpha
|
WB, IHC-P, IP
|
Human, Mouse, Rat |
-
- HY-P83288
-
GCN2-like protein; GCN2; KIAA1338; EIF2AK4
|
WB
|
Human |
-
- HY-P81210
-
LATS1 +LATS2 (phospho T1079 + T1041); Serine/THReonine protein kinase LATS2; KPM; Large tumor supressor, homolog 1; LATS, large tumor suppressor, homolog 1 (Drosophila); LATS, large tumor suppressor, homolog 2 (Drosophila); LATS1 +LATS2 (phospho T1079 + T1041); p-LATS1 +LATS2(THR1079 +THR1041); RGD1564085; Serine/THReonine protein kinase LATS1; WARTS; WARTS protein kinase; wts; 4932411G09Rik; AV277261; AW208599; AW228608; FLJ13161; LATS1_HUMAN.
|
WB; ELISA; IHC-P; IHC-F; IF
|
Human, Mouse(predicted: Rat, Chicken, Dog, Pig, Cow, Horse, Rabbit) |
phospho-LATS1+LATS2 (Thr1079 +Thr1041) Antibody is an unconjugated, approximately 124 kDa, rabbit-derived, anti-phospho-LATS1+LATS2 (Thr1079 +Thr1041) polyclonal antibody. phospho-LATS1+LATS2 (Thr1079 +Thr1041) Antibody can be used for: WB, ELISA, IHC-P, IHC-F, IF expriments in human, mouse, and predicted: rat, chicken, dog, pig, cow, horse, rabbit background without labeling.
|
-
- HY-P80861
-
MAPT; MAPTL; MTBT1; TAU; Microtubule-associated protein tau; Neurofibrillary tangle protein; Paired helical filament-tau; PHF-tau
|
WB, IP
|
Human |
Phospho-Tau (Thr181) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 79 kDa, targeting to Phospho-Tau (Thr181). It can be used for WB,IP assays with tag free, in the background of Human.
|
-
- HY-P82869
-
MSN; Moesin; Membrane-organizing extension spike protein; RDX; Radixin; EZR; VIL2; Ezrin; Cytovillin; Villin-2; p81
|
WB, IHC-P
|
Human, Rat |
-
- HY-P81296B
-
CAS; p120; BCDS2; CTNND; P120CAS; P120CTN; p120(CAS); p120(CTN)
|
WB, IHC-F, IHC-P, ICC/IF
|
Human, Mouse |
-
- HY-P80794
-
BRAF; BRAF1; RAFB1; Serine/THReonine-protein kinase B-raf; Proto-oncogene B-Raf; p94; v-Raf murine sarcoma viral oncogene homolog B1
|
WB, IP
|
Human, Mouse, Rat |
Phospho-BRAF (Thr401) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 84 kDa, targeting to Phospho-BRAF (Thr401). It can be used for WB,IP assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80830
-
JNK 46; JNK 55; MAPK10; MAPK9; MAPK8; SAPK1b; SAPK1; SAPK; PRKM10; PRKM9; PRKM8
|
WB, IHC-P, ICC/IF, IP, FC
|
Human, Mouse, Rat |
Phospho-JNK (Thr183) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 48 kDa, targeting to Phospho-JNK (Thr183). It can be used for WB,IHC-P,ICC/IF,IP,FC assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80789
-
AKT1; PKB; RAC; RAC-alpha serine/THReonine-protein kinase; Protein kinase B; PKB; Protein kinase B alpha; PKB alpha; Proto-oncogene c-Akt; RAC-PK-alpha
|
ICC/IF, WB, IHC-F, IHC-P, ELISA
|
Human, Mouse, Rat |
Phospho-AKT (Thr308) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 56 kDa, targeting to Phospho-AKT (Thr308). It can be used for ICC/IF,WB,IHC-F,IHC-P,ELISA assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80845
-
EIF2AK3; PEK; PERK; Eukaryotic translation initiation factor 2-alpha kinase 3; PRKR-like endoplasmic reticulum kinase; Pancreatic eIF2-alpha kinase; HsPEK
|
ICC/IF, WB, IHC-F, IHC-P, ELISA
|
Human, Mouse, Rat |
Phospho-PERK (Thr982) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 125 kDa, targeting to Phospho-PERK (Thr982). It can be used for ICC/IF,WB,IHC-F,IHC-P,ELISA assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80799
-
CHEK2; CDS1; CHK2; RAD53; Serine/THReonine-protein kinase Chk2; CHK2 checkpoint homolog; Cds1 homolog; Hucds1; hCds1; Checkpoint kinase 2
|
WB, ICC/IF, IHC-P
|
Human, Mouse, Rat |
Phospho-Chk2 (Thr68) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 61 kDa, targeting to Phospho-Chk2 (Thr68). It can be used for WB,ICC/IF,IHC-P assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P82823
-
APP; A4; AD1; Amyloid beta A4 protein; ABPP; APPI; APP; Alzheimer disease amyloid protein; Cerebral vascular amyloid peptide; CVAP; PreA4; Protease nexin-II; PN-II
|
WB, ICC/IF, IP
|
Human, Rat |
-
- HY-P81303A
-
SIRT1; SIR2L1; NAD-dependent protein deacetylase sirtuin-1; hSIRT1; Regulatory protein SIR2 homolog 1; SIR2-like protein 1; hSIR2
|
WB
|
Human |
-
- HY-P80791
-
PRKAA2; AMPK; AMPK2; 5'-AMP-activated protein kinase catalytic subunit alpha-2; AMPK subunit alpha-2; Acetyl-CoA carboxylase kinase; ACACA kinase; Hydroxymethylglutaryl-CoA reductase kinase; HMGCR kinase
|
WB
|
Human, Mouse, Rat |
Phospho-AMPK alpha 2 (Thr172) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 62 kDa, targeting to Phospho-AMPK alpha 2 (Thr172). It can be used for WB assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80793
-
ATF2; CREB2; CREBP1; Cyclic AMP-dependent transcription factor ATF-2; cAMP-dependent transcription factor ATF-2; Activating transcription factor 2; Cyclic AMP-responsive element-binding protein 2; CREB-2; cAMP-responsive element-binding pro
|
WB, ICC/IF, IP
|
Human, Mouse |
Phospho-ATF2 (Thr71) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 55 kDa, targeting to Phospho-ATF2 (Thr71). It can be used for WB,ICC/IF,IP assays with tag free, in the background of Human, Mouse.
|
-
- HY-P82368
-
AP-2 complex subunit mu; AP-2 mu chain; Adapter-related protein complex 2 subunit mu; Adaptin-mu2; ClaTHRin assembly protein complex 2 mu medium chain; ClaTHRin coat assembly protein AP50
|
WB
|
Human |
-
- HY-P80786
-
EIF4EBP1; Eukaryotic translation initiation factor 4E-binding protein 1; 4E-BP1; eIF4E-binding protein 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I
|
WB, IHC-P, IP
|
Human, Mouse, Rat |
Phospho-4E BP1 (Thr46) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 13 kDa, targeting to Phospho-4E BP1 (Thr46). It can be used for WB,IHC-P,IP assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P80833
-
MAP2K1; MEK1; PRKMK1; Dual specificity mitogen-activated protein kinase kinase 1; MAP kinase kinase 1; MAPKK 1; MKK1; ERK activator kinase 1; MAPK/ERK kinase 1; MEK 1
|
WB
|
Mouse, Rat |
Phospho-MEK1 (Thr292) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 43 kDa, targeting to Phospho-MEK1 (Thr292). It can be used for WB assays with tag free, in the background of Mouse, Rat.
|
-
- HY-P81299
-
EIF2AK2; PKR; PRKR; Interferon-induced; double-stranded RNA-activated protein kinase; Eukaryotic translation initiation factor 2-alpha kinase 2; eIF-2A protein kinase 2; Interferon-inducible RNA-dependent protein kinase; P1/eIF-2A protein k
|
WB
|
Human |
-
- HY-P81299A
-
EIF2AK2; PKR; PRKR; Interferon-induced; double-stranded RNA-activated protein kinase; Eukaryotic translation initiation factor 2-alpha kinase 2; eIF-2A protein kinase 2; Interferon-inducible RNA-dependent protein kinase; P1/eIF-2A protein k
|
WB, IHC-P, IP, ChIP
|
Human |
-
- HY-P80842
-
MAPK14; CSBP; CSBP1; CSBP2; CSPB1; MXI2; SAPK2A; Mitogen-activated protein kinase 14; MAP kinase 14; MAPK 14; Cytokine suppressive anti-inflammatory drug-binding protein; CSAID-binding protein; CSBP; MAP kinase MXI2; MAX-interacting protein
|
WB
|
Human, Mouse, Rat |
Phospho-p38 (Thr180/Tyr182) Antibody is a non-conjugated and Rabbit origined polyclonal antibody about 41 kDa, targeting to Phospho-p38 (Thr180/Tyr182). It can be used for WB assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P82405
-
MARK3; CTAK1; EMK2; MAP/microtubule affinity-regulating kinase 3; C-TAK1; cTAK1; Cdc25C-associated protein kinase 1; ELKL motif kinase 2; EMK-2; Protein kinase STK10; Ser/THR protein kinase PAR-1; Par-1a; Serine/THReonine-protein kinase p78
|
WB, ICC/IF, IP, FC
|
Mouse, Human |
-
- HY-P80849
-
RPS6KA1; MAPKAPK1A; RSK1; Ribosomal protein S6 kinase alpha-1; S6K-alpha-1; 90 kDa ribosomal protein S6 kinase 1; p90-RSK 1; p90RSK1; p90S6K; MAP kinase-activated protein kinase 1a; MAPK-activated protein kinase 1a; MAPKAP kinase 1a; MAPKAP
|
WB, IP
|
Human, Mouse, Rat |
Phospho-RSK1 p90 (Thr359/Ser363) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 83 kDa, targeting to Phospho-RSK1 p90 (Thr359/Ser363). It can be used for WB,IP assays with tag free, in the background of Human, Mouse, Rat.
|
-
- HY-P81156
-
ERK1 + ERK2 (phospho THR183/Tyr185); phospho-ERK1/MAPK-1/2(THR183/Tyr185); ERK 1; ERK 2; ERK-2; ERK1; ERK2; ERT1; ERT2; Extracellular signal regulated kinase 1; Extracellular signal regulated kinase 1; Extracellular signal regulated kinase 2; Extracellular signal regulated kinase 2; Extracellular signal-regulated kinase 2; HS44KDAP; HUMKER1A; Insulin stimulated MAP2 kinase; MAP kinase 1; MAP kinase 2; MAP kinase isoform p42; MAP kinase isoform p44; MAPK 1; MAPK 2; MAPK1; MAPK2; MGC20180; Microtubule associated protein 2 kinase; Mitogen activated protein kinase 1; Mitogen activated protein kinase 1; Mitogen activated protein kinase 2; Mitogen-activated protein kinase 1; Mitogen-activated protein kinase 2; MK01_MOUSE; p38; p40; p41; p41mapk; p42 MAPK; p42-MAPK; p42MAPK; p42MAPK; p44 ERK1; p44 MAPK; p44ERK1; p44ERK1; p44MAPK; p44MAPK; PRKM 1; PRKM 1; PRKM 2; PRKM 2; PRKM1; PRKM2; Protein kinase mitogen activated 1; Protein kinase mitogen activated 1; Protein kinase mitogen activated 2; Protein kinase mitogen activated 2; Protein tyrosine kinas.
|
WB; ELISA; IHC-P; IHC-F; ICC; IF
|
Human, Mouse(predicted: Rat, Chicken, Dog, Cow, Horse, Rabbit, Guinea Pig) |
phospho-ERK1 + 2 (Thr183/Tyr185) Antibody is an unconjugated, approximately 42/44 kDa, rabbit-derived, anti-phospho-ERK1 + 2 (Thr183/Tyr185) polyclonal antibody. phospho-ERK1 + 2 (Thr183/Tyr185) Antibody can be used for: WB, ELISA, IHC-P, IHC-F, ICC, IF expriments in human, mouse, and predicted: rat, chicken, dog, cow, horse, rabbit, guinea pig background without labeling.
|
-
- HY-P80831
-
AI849689; c Jun N terminal kinase 1; C-JUN kinase 1; c-Jun N-terminal kinase 1; EC 2.7.11.24; JAK 1A; JAK1A; JNK 1; JNK 46; JNK; JNK-46; JNK1A2; JNK21B1/2; MAP kinase 8; MAPK 8; MAPK8; Mitogen activated protein kinase 8; Mitogen-activated protein kinase 8
|
WB, IP
|
Human, Rat |
Phospho-JNK1 (Thr183/Tyr185) Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 48 kDa, targeting to Phospho-JNK1 (Thr183/Tyr185). It can be used for WB,IP assays with tag free, in the background of Human, Rat.
|
-
- HY-P82975
-
60S acidic ribosomal protein P1; AA409079; AI325195; AU020965; HSSB; ik:tdsubc_2g1; M(2)21C; MGC137236; OTTHUMP00000004008; p32; p34; RCJMB04_6d17 replication protein A2; 32kDa; REPA 2; REPA1; REPA2; Replication factor A protein 2; Replication protein A 32 kDa subunit; Replication protein A 32kDa subunit; Replication protein A 34 kDa subunit; Replication protein A; replication protein A1 (70kD); Replication Protein A2 (32kDa); Replication protein A2 32kD; Replication protein A2 32kDa; Replication protein A2; Replication protein A2; 32kDa; RF A; RF-A protein 2; Rf-A2; RFA; RFA2_HUMAN; RP A; RP-A p32; RP-A p34; RP21C; RPA 2; RPA 32; RPA; RPA2; RPA32; RPA34; RPA70; RpLP1; RpP2; xx:tdsubc_2g1; zgc:109822.
|
WB, IP
|
Human, Mouse, Rat |
-
- HY-P80776A
-
p38 (phospho T180 + Y182); p-p38 (phospho T180 + Y182); p38 (phospho T180/Y182); CSAID Binding Protein 1; CSAID binding protein; CSAID-binding protein; Csaids binding protein; CSBP 1; CSBP 2; CSBP; CSBP1; CSBP2; CSPB 1; CSPB1; Cytokine suppressive anti inflammatory drug binding protein; Cytokine suppressive anti-inflammatory drug-binding protein; EXIP; MAP kinase 14; MAP kinase MXI2; MAP kinase p38 alpha; MAPK 14; MAPK14; MAX interacting protein 2; MAX-interacting protein 2; Mitogen Activated Protein Kinase 14; Mitogen activated protein kinase p38 alpha; Mitogen-activated protein kinase 14; Mitogen-activated protein kinase p38 alpha; MK14_HUMAN; Mxi 2; Mxi2; p38 ALPHA; p38; p38 MAP kinase; p38 MAPK; p38 mitogen activated protein kinase; p38ALPHA; p38alpha Exip; PRKM14; PRKM15; RK; SAPK 2A; SAPK2A; Stress Activated Protein Kinase 2A.
|
WB, IHC-P, Flow-Cyt, ICC, ELISA
|
Human, Mouse (predicted: Rat, Rabbit, Pig, Chicken, Dog, Horse) |
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: