cathelicidin

By Targets:	Bacterial (15) Fungal (1)
By Research Areas:	Infection (11) Inflammation/Immunology (3)

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P1884

LL-37, acetylated,amidated	Bacterial	Infection
LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on the N-terminus and amidated on the C-terminus. The single human cathelicidin peptide LL-37 has antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host .

HY-P1513A

LL-37 scrambled peptide acetate	Bacterial	Infection
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.

HY-P10160

Cathelicidin-2 (chicken) chCATH-2	Bacterial	Infection
Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates .

HY-P4071

OH-CATH cathelicidin-OH antimicrobial peptide	Bacterial	Infection
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra) .

HY-P10158

PMAP-36 Porcine cathelicidin PMAP-36	Bacterial	Infection
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .

HY-P1513

LL-37 scrambled peptide	Bacterial	Infection
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

HY-P2457

rCRAMP (rat)	Bacterial	Infection Inflammation/Immunology
rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS .

HY-P2460

SMAP-29	Bacterial Fungal	Infection Inflammation/Immunology
SMAP-29, a promising antiinfective agent, is a broad spectrum antibacterial and antifungal α-helical cathelicidin-derived peptide. SMAP-29 acts by permeabilizing bacterial membranes and inducing remarkable changes in the surface morphology of susceptible microorganism .

HY-P1222

LL-37, human 2 Publications Verification	Bacterial	Infection
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .

HY-P1222B

LL-37, human acetate 2 Publications Verification	Bacterial	Infection Inflammation/Immunology
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing .

HY-P1222A

LL-37, human TFA 2 Publications Verification	Bacterial	Infection
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .

HY-P5486

Tet-20	Bacterial	Others
Tet-20 is a biological active peptide. (Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cells)

HY-P5391

LL-37(17-32)	Bacterial	Others
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)

HY-P5483

Retro-indolicidin	Bacterial	Others
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)

HY-P5446

BMAP-18	Bacterial	Others
BMAP-18 is a biological active peptide. (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the Cathelicidin family of peptides which displays rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at higher than microbicidal concentrations. BMAP-18 displays much higher cell selectivity as compared to parental BMAP-27 because of its decreased hemolytic activity and retained antimicrobial activity.)

Cat. No.	Product Name	Target	Research Area

HY-P1884

LL-37, acetylated,amidated	Bacterial	Infection
LL-37, acetylated, amidated is a cathelicidin peptide LL-37 acetylated on the N-terminus and amidated on the C-terminus. The single human cathelicidin peptide LL-37 has antimicrobial and anti-biofilm activity against multiple Gram-positive and Gram-negative human pathogens, and has wound-healing effects on the host .

HY-P1513A

LL-37 scrambled peptide acetate	Bacterial	Infection
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.

HY-P10160

Cathelicidin-2 (chicken) chCATH-2	Bacterial	Infection
Cathelicidin-2 chicken is antimicrobial peptide. Cathelicidin-2 chicken shows potent bactericidal and fungicidal activity against chicken-specific salmonella isolates .

HY-P4071

OH-CATH cathelicidin-OH antimicrobial peptide	Bacterial	Infection
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra) .

HY-P10158

PMAP-36 Porcine cathelicidin PMAP-36	Bacterial	Infection
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .

HY-P1513

LL-37 scrambled peptide	Bacterial	Infection
LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.

HY-P2457

rCRAMP (rat)	Bacterial	Infection Inflammation/Immunology
rCRAMP (rat) is the rat cathelin-related antimicrobial peptide. rCRAMP (rat) contributes to the antibacterial activity in rat brain peptide/protein extracts. rCRAMP (rat) is a potential key player in the innate immune system of rat CNS .

HY-P2460

SMAP-29	Bacterial Fungal	Infection Inflammation/Immunology
SMAP-29, a promising antiinfective agent, is a broad spectrum antibacterial and antifungal α-helical cathelicidin-derived peptide. SMAP-29 acts by permeabilizing bacterial membranes and inducing remarkable changes in the surface morphology of susceptible microorganism .

HY-P1222

LL-37, human 2 Publications Verification	Bacterial	Infection
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .

HY-P1222B

LL-37, human acetate 2 Publications Verification	Bacterial	Infection Inflammation/Immunology
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing .

HY-P1222A

LL-37, human TFA 2 Publications Verification	Bacterial	Infection
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .

HY-P5486

Tet-20	Bacterial	Others
Tet-20 is a biological active peptide. (Tet-20, is a synthetic cathelicidin-derived peptide. It was tested as infection-resistant coating for medical devices. When tethered on an implant surface Tet-20 exhibited broad antimicrobial activities both in vivo and in vitro. It can stop biofilm formation and appears to be non-toxic to eukaryotic cells)

HY-P5391

LL-37(17-32)	Bacterial	Others
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)

HY-P5483

Retro-indolicidin	Bacterial	Others
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)

HY-P5446

BMAP-18	Bacterial	Others
BMAP-18 is a biological active peptide. (BMAP-18 is a truncated form of the antimicrobial peptide BMAP-27. Bovine myeloid antimicrobial peptide-27 (BMAP-27) belongs to the Cathelicidin family of peptides which displays rapid bactericidal activity against Staphylococcus aureus, Streptococcus uberis, and Escherichia coli. BMAP-27 is cytotoxic to human erythrocytes and neutrophils, although at higher than microbicidal concentrations. BMAP-18 displays much higher cell selectivity as compared to parental BMAP-27 because of its decreased hemolytic activity and retained antimicrobial activity.)

Cat. No.	Compare	Product Name	Species	Source

HY-P71468

	Cathelicidin-4/CATHL4 Protein, Bovine (His-SUMO) CATHL4; cathelicidin-4; Indolicidin	Bovine	E. coli
	Cathelicidin-4/CATHL4 protein has potent bactericidal activity and can effectively target Staphylococcus aureus and Escherichia coli. This antibacterial ability makes cathelicidin-4 an important innate immune effector that contributes to host defense against bacterial pathogens. Cathelicidin-4/CATHL4 Protein, Bovine (His-SUMO) is the recombinant bovine-derived Cathelicidin-4/CATHL4 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of Cathelicidin-4/CATHL4 Protein, Bovine (His-SUMO) is 13 a.a., with molecular weight of ~17.9 kDa.


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Application	Reactivity

HY-P82635

Cathelicidin Antibody (YA2380)

LL37; CAP18; CRAMP; HSD26; CAP-18; FALL39; FALL-39
WB, IHC-P, IP Human

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inhibitors & Agonists

Peptides

Recombinant Proteins

Antibodies