1. Search Result
Search Result
Results for "

derivative

" in MCE Product Catalog:

862

Inhibitors & Agonists

4

Screening Libraries

14

Dye Reagents

11

Biochemical Assay Reagents

26

Peptides

1

Inhibitory Antibodies

255

Natural
Products

18

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas
  • HY-U00415
    Benzamide Derivative 1

    Dopamine Receptor mAChR Neurological Disease
    Benzamide Derivative 1 is a benzamide derivative from patent EP0213775A1, compound 18. Benzamide Derivative 1 may be useful in treatment of gastrointestinal disorders.
  • HY-18003
    Oleanolic acid derivative 2

    Others Inflammation/Immunology
    Oleanolic acid derivative 2 is an oleanolic acid derivative, which is a novel triterpenoid-steroid hybrid molecule.
  • HY-18002
    Oleanolic acid derivative 1

    Others Inflammation/Immunology
    Oleanolic acid derivative 1 is an oleanolic acid derivative, which is a novel triterpenoid-steroid hybrid molecule.
  • HY-U00378
    Glycerol derivative 1

    Others Cardiovascular Disease
    Glycerol derivative 1 is a Glycerol derivative extracted from patent EP 672415 A1, compound (1).
  • HY-101831
    Heterocyclyl carbamate derivative 1

    Others Inflammation/Immunology Neurological Disease
    Heterocyclyl carbamate derivative 1 is a heterocyclyl carbamate derivative that may be used for the research of inflammatory and neurological diseases.
  • HY-U00384
    Diarylalkane derivative 1

    Others Inflammation/Immunology
    Diarylalkane derivative 1 is used for the research of pancreatitis.
  • HY-12690
    DOTA derivative

    Others Cancer
    DOTA derivative is a benxyl derivative of the cyclic tosamide; can be nitrated directly; is more convenient to incorporate the nitro group after deprotection lithium aluminum hydride.
  • HY-32364
    3-arylisoquinolinamine derivative

    Others Cancer
    3-arylisoquinolinamine derivative is a 3-arylisoquinolinamine derivative with antitumor activity.
  • HY-100177
    L-Threonine derivative-1

    Others Others
    L-Threonine derivative-1 is a acetylsalicylic-L-threonine ester extracted from patent US 20060287244 A1.
  • HY-U00323
    Carbazole derivative 1

    2-Fluoro-7-[(3-pyridinyl)methyl]-9H-carbazole

    Others Endocrinology
    Carbazole derivative 1 is a carbazole derivative which can be used to reduce androgen or oestrogen levels in mammals, including humans.
  • HY-U00059
    Pyrrole-derivative1

    Others Metabolic Disease
    Pyrrole-derivative1 is extracted from patent WO/2002/085851A1, example 2, developed for the treatment of diabetic disease.
  • HY-U00127
    Pyridazinediones-derivative-1

    Others Neurological Disease
    Pyridazinediones-derivative-1 has potential in treating neurodegenerative disorders. It shows an ED50 of 2.1 μM for inhibiting glutamate-induced contractions of isolated guineapig ileum.
  • HY-114334
    Glutaminase-IN-1

    CB839 derivative

    Glutaminase Cancer
    Glutaminase-IN-1 (CB839 derivative), a CB839 derivative, is an allosteric inhibitor of 1,3,4-selenadiazole-containing kidney-type glutaminase (KGA), with an IC50 of 1 nM. Glutaminase-IN-1 (CB839 derivative) shows improved cellular uptake and antitumor activity.
  • HY-18785
    Indirubin Derivative E804

    IGF-1R Cancer Endocrinology
    Indirubin Derivative E804 is a potent inhibitor of Insulin-like Growth Factor 1 Receptor (IGF1R), with an IC50 of 0.65 μM for IGF1R.
  • HY-U00332
    Hydrocarbon chain derivative 1

    6,6'-Oxybis[2,2-dimethyl-1-hexanol]

    Others Metabolic Disease
    Hydrocarbon chain derivative 1 is an active compound, with inhibitory activities against lipid synthesis.
  • HY-103651
    OT antagonist 1 demethyl derivative

    Oxytocin Receptor Endocrinology
    OT antagonist 1 demethyl derivative is the demethyl derivative of OT antagonist 1. OT antagonist 1 (Compound 4) is a potent, selective Oxytocin antagonist with a Ki of 50 nM.
  • HY-133781
    cis-Clopidogrel-MP Derivative

    Clopidogrel-MP-AM

    Others Others
    cis-Clopidogrel-MP Derivative (Clopidogrel-MP-AM) is a 3’-methoxyacetophenone derivative of Clopidogrel active metabolite. Clopidogrel is an orally active platelet inhibitor that targets P2Y12 receptor.
  • HY-13631D
    Dxd

    Exatecan derivative for ADC

    Topoisomerase ADC Cytotoxin Cancer
    Dxd (Exatecan derivative for ADC) is a potent DNA topoisomerase I inhibitor, with an IC50 of 0.31 μM, used as a conjugated drug of HER2-targeting ADC (DS-8201a).
  • HY-12068
    PI3K-IN-1

    XL-147 derivative 1

    PI3K Cancer
    PI3K-IN-1 (XL-147 derivative 1) is a potent inhibitor of PI3K. PI3K-IN-1 (25 μM) blocks PI3K/Akt signaling pathways.
  • HY-16679
    Helioxanthin derivative 5-4-2

    Helioxanthin 5-4-2

    HBV Infection
    Helioxanthin derivative 5-4-2 is an analogue of helioxanthin, exhibites significant in vitro anti-HBV activity with EC50 of 0.08 uM in HepG2.2.15 cells.
  • HY-N0947
    (-)-Anomalin

    (-)-Praeruptorin B

    Others Inflammation/Immunology
    (-)-Anomalin ((-)-Praeruptorin B) is a coumarin derivative isolated from the root of S. resinosum.
  • HY-N7889
    Syringetin-3-O-rutinoside

    Others Others
    Syringetin-3-O-rutinoside is an antioxidant compound. Syringetin-3-O-rutinoside can be used for the synthesis of syringetin-O-glycoside derivatives.
  • HY-126126
    S-Adenosyl-DL-methionine

    Others Others
    S-Adenosyl-DL-methionine is a derivative of Ademetionine (HY-B0617). Ademetionine is an intermediate metabolite of methionine.
  • HY-13631DS
    Dxd-D5

    Exatecan-D5 derivative for ADC

    Topoisomerase ADC Cytotoxin Cancer
    Dxd-D5 (Exatecan-D5 derivative for ADC) is a deuterium labeled Dxd. Dxd is a potent DNA topoisomerase I inhibitor, with an IC50 of 0.31 μM, used as a conjugated drug of HER2-targeting ADC (DS-8201a) .
  • HY-19355
    Rocagloic acid

    Others Cancer
    Rocagloic acid is a racaglamide derivative isolated from the fruits of Amoora cucullata with potent cytotoxicity.
  • HY-121632
    Quinoclamine

    NF-κB Cancer
    Quinoclamine, a naphthoquinone derivative, is a NF-κB inhibitor. Quinoclamine exhibits anti-cancer activity.
  • HY-107470
    Antitumor agent-21

    Others Cancer Inflammation/Immunology
    Antitumor agent-21 is an aryl-quinolin derivative, with potential anticancer, anti-inflammatory, anti-proliferative, anti-hormonal effects and inhibition of vasculogenic mimicry .
  • HY-N7685
    Podophyllol

    Others Cancer
    Podophyllol, a derivative of podophyllotoxin esters, has antitumor activity.
  • HY-U00424
    Chol-5-en-24-al-3β-ol

    Vitamin D3 derivative

    VD/VDR Metabolic Disease
    Chol-5-en-24-al-3β-ol is a steroid compound (Vitamin D3 derivative) extracted from patent US 4354972 A, Compound IX.
  • HY-N1854
    Pinobanksin 3-acetate

    Others Others
    Pinobanksin 3-acetate is a one of Pinobanksin ester derivatives that can be isolated from Sonoran propolis.
  • HY-15648H
    GSK-J5 hydrochloride

    Histone Demethylase Cancer
    GSK-J5 hydrochloride is a cell-permeable ester derivative of GSK J2 (HY-15648A), inactive. GSK-J5 hydrochloride is also an isomer of GSK-J4 (HY-15648B) and often used as a negative group.
  • HY-N7135
    Tropolone

    Tyrosinase Others
    Tropolone, a  tropone derivative with a hydroxyl group in the 2-position, is a precursor of manyazulene derivatives such as methyl 2-methylazulene-1-carboxylate. Tropolone is a potent inhibitor of mushroom tyrosinase with a IC50 of 0.4 μM, and the inhibition can be reversed by dialysis or by excess CU 2+.
  • HY-131277
    Dehydro Olmesartan

    Angiotensin Receptor Cardiovascular Disease
    Dehydro Olmesartan is a derivative of Olmesartan. Olmesartan is an angiotensin II receptor (AT1R) antagonist and has the potential for high blood pressure study.
  • HY-113225
    Guanosine triphosphate

    SARS-CoV Nucleoside Antimetabolite/Analog DNA/RNA Synthesis Cancer Infection
    Guanosine triphosphate is a native nucleotide. The derivatives of GTP may be used as specific inhibitors against COVID-19.
  • HY-N0572
    9-Hydroxycamptothecin

    9-Hydroxycamptothecine

    Others Cancer
    9-Hydroxycamptothecin (9-Hydroxycamptothecine) is a Camptothecin derivative with anticancer activities extracted from patent WO1999001456A1, compound 23c.
  • HY-133860
    Chrysoobtusin

    Others Others
    Chrysoobtusin is an anthraquinone derivative isolated from Semen Cassiae. Semen Cassiae has long been used to protect liver, brighten eyes, and relieve constipation.
  • HY-100636
    Gefitinib N-oxide

    EGFR Cancer
    Gefitinib N-oxide is the N-oxide derivative of Gefitinib. Gefitinib is an EGFR tyrosine kinase inhibitor, with IC50 of 2-37 nM in NR6wtEGFR cells.
  • HY-131326
    DOTA-tris(tBu)ester NHS ester

    Others Cancer
    DOTA-tris(tBu)ester NHS ester is a derivative of DOTA for the labeling of peptides and antibodies.
  • HY-N1800
    3,3'-Di-O-methylellagic acid-4'-O-β-D-glucopyranoside

    Others Others
    3,3'-Di-O-methylellagic acid-4'-O-β-D-glucopyranoside is a ellagic acid derivative that can be isolated from Dipentodon sinicus.
  • HY-100438
    Hydronidone

    F351

    Hydronidone is a pyridine derivative and an antifibrotic agent for hepatic fibrosis.
  • HY-N7655
    7-O-Methylbiochanin A

    4',7-Dimethoxy-5-hydroxyisoflavone

    Others Others
    7-O-Methylbiochanin A (4',7-Dimethoxy-5-hydroxyisoflavone) is an isoflavone derivative isolated from the roots of Lotus polyphyllos.
  • HY-135590
    Raloxifene 4-Monomethyl Ether

    Estrogen Receptor/ERR
    Raloxifene 4-Monomethyl Ether (Compound 37) is a Raloxifene derivative that inhibits estrogen receptor α. Raloxifene 4-Monomethyl Ether inhibits MCF-7 cells with an IC50 of 1 μM and a pIC50 of 6.
  • HY-N2267
    (+)-Schisandrin B

    Reactive Oxygen Species Inflammation/Immunology
    (+)-Schisandrin B is an enantiomer of Schisandrin B. Schisandrin B is an active dibenzocyclooctadiene derivative isolated from the fruit of Schisandra chinensis, has antioxidant effect on rodent liver and heart.
  • HY-W017378
    Trimethylhydroquinone

    Others Others
    Trimethylhydroquinone is a key intermediate for the synthesis of Vitamin E or other trimethylhydroquinone derivatives with antioxidative effects.
  • HY-125648
    Euphorbadienol

    alpha-Euphorbol

    Others Infection
    Euphorbadienol (alpha-Euphorbol), a triterpenic compound, isolated from the latex of Euphorbia resinifera. The derivatives of Euphorbadienol can be used as elicitors of disease resistance, and has antileishmanial and antitrypanosomal activity.
  • HY-B0393
    Fudosteine

    Others Inflammation/Immunology
    Fudosteine is a cysteine derivative and a mucoactive agent. Fudosteine inhibits MUC5AC mucin hypersecretion by reducing MUC5AC gene expression.
  • HY-W014180
    N-Acetyl-L-histidine monohydrate

    Endogenous Metabolite Metabolic Disease
    N-Acetyl-L-histidine monohydrate, a histidine derivative, is a prominent biomolecule in brain, retina and lens of poikilothermic vertebrates. N-Acetyl-L-histidine monohydrate has a role as an animal metabolite.
  • HY-123691
    7-O-Demethyl rapamycin

    Fungal Cancer Infection Inflammation/Immunology
    7-O-Demethyl rapamycin, a derivative of Rapamycin (HY-10219), has antifungal activity and immunosuppressant properties. 7-O-Demethyl rapamycin has useful tumor cell growth-inhibiting activity.
  • HY-135776
    BMVC2

    o-BMVC

    G-quadruplex Cancer
    BMVC2 (o-BMVC) is a bisubstitute carbazole derivative of BMVC. BMVC2 is a G-quadruplex (G4) stabilizer.
  • HY-W039169
    4-Chloroguaiacol

    4-Chloro-2-methoxyphenol

    Bacterial Infection
    4-Chloroguaiaco (4-Chloro-2-methoxyphenol) is a phenol derivative, with antimicrobial activity. 4-Chloroguaiaco shows inhibition against S. aureus and E. coli with MICs of both 110 μg/mL.
  • HY-135584
    Raloxifene 6-Monomethyl Ether

    Estrogen Receptor/ERR
    Raloxifene 6-Monomethyl Ether (Compound 7) is a Raloxifene derivative that inhibits estrogen receptor α. Raloxifene 4-Monomethyl Ether inhibits MCF-7 cells with an IC50 of 250 nM and a pIC50 of 6.6.
  • HY-112191
    PI3K-IN-10

    PI3K Cancer
    PI3K-IN-10 is a potent pan-PI3K inhibitor as a benzimidazole derivative, compound 332, extracted from patent WO2018057808A1.
  • HY-135578
    Artelinic acid

    Parasite Infection
    Artelinic acid, a derivative of Artemisinin, is an antimalarial drug for the treatment of multidrug resistant strains of Plasmodium falciparum. Artelinic acid can be administered by various routes of administration, including intravenous, intramuscular and oral routes.
  • HY-108971
    Demecycline

    Bacterial Infection
    Demecycline, a tetracycline antibiotic, is the C6-demethylated derivative of Tetracycline (HY-A0107) against bacterial infections including pneumonia and other respiratory tract infections.
  • HY-137475
    Chlorin e6 trimethyl ester

    Others Cancer
    Chlorin e6 trimethyl ester, a methyl pheophorbide-a derivative, is a photosensitizer that can be used in photodynamic therapy (PDT).
  • HY-136588
    trans-R-138727MP

    Prasugrel metabolite R-138727MP

    P2Y Receptor Cardiovascular Disease
    trans-R-138727MP (Prasugrel metabolite R-138727MP) is the active metabolite derivative of Prasugrel (HY-15284). Prasugrel, a thienopyridine and prodrug, inhibits platelet function. Prasugrel is an orally active and potent P2Y12 receptor antagonist, and inhibits ADP-induced platelet aggregation.
  • HY-136456
    2-NP-AMOZ

    Others Others
    2-NP-AMOZ is a 2-nitrophenyl derivative of AMOZ (a metabolite of antibiotic Furaltadone), can be used to detect protein bound AMOZ.
  • HY-W042501
    m-PEG5-Tos

    PROTAC Linker Cancer
    m-PEG5-Tos is a derivative of silybin ethers, extracted from patent CN105037337A (compound III-c). m-PEG5-Tos is a PEG-based PROTAC linker can be used in the synthesis of Silymarin (HY-W043277).
  • HY-131066
    EMI48

    EGFR Cancer
    EMI48, the derivative of EMI1, displays greater potency toward mutant EGFR than EMI1. EMI48 inhibits EGFR triple mutants.
  • HY-136457
    2-NP-AHD

    Others Others
    2-NP-AHD is a 2-nitrophenyl derivative of AHD (a metabolite of nitrofurans type of antibiotics), can be used as indicator of the illegal usage of nitrofuran drugs.
  • HY-N9447
    Norbergenin

    Reactive Oxygen Species Neurological Disease
    Norbergenin, the O-demethyl derivative of bergenin, shows moderate antioxidant activity (IC50 13 μM in DPPH radical scavenging; 32 μM in superoxide anion scavenging).
  • HY-136444
    2-NP-AOZ

    Others Others
    2-NP-AOZ is a 2-nitrophenyl derivative of AOZ (HY-W012982, a tissue-bound metabolite of the Furazolidone). 2-NP-AOZ can be used to determination of the AOZ residues.
  • HY-12713
    Lisuride

    Dopamine Receptor Neurological Disease
    Lisuride is an orally active dopamine D2 receptors agonist. Lisuride, as an ergot derivative, can be used for the research of Parkinson's disease, migraine, and high prolactin levels.
  • HY-B0863
    Glyphosate

    Apoptosis Autophagy Cancer
    Glyphosate is an herbicidal derivative of the amino acid glycine. Glyphosate targets and blocks a plant metabolic pathway not found in animals, the shikimate pathway, required for the synthesis of aromatic amino acids in plants.
  • HY-15446
    Basimglurant

    RG7090; CTEP derivative

    mGluR Neurological Disease
    Basimglurant (RG7090) is a potent, selective and orally available mGlu5 negative allosteric modulator with a Kd of 1.1 nM.
  • HY-15517B
    KN-92 hydrochloride

    Others Cancer
    KN-92 hydrochloride is an inactive derivative of KN-93, without CaM kinase inhibitory activity. KN-92 hydrochloride is intended to be used as a control compound in studies designed to elucidate the antagonist activities of KN-93.
  • HY-N7651
    Neoanhydropodophyllol

    Others Cancer
    Neoanhydropodophyllol is a cyclolignan derivative, with antineoplastic activity. Neoanhydropodophyllol displays cytotoxicity against several cancer cells (leukemia, lung carcinoma and colon carcinoma).
  • HY-135327
    Amphotericin B methyl ester

    HIV Fungal Infection
    Amphotericin B methyl ester is the methyl ester derivative of the polyene antibiotic Amphotericin B (A634250). Amphotericin B methyl ester is the cholesterol-binding compound possesses significant antifungal activity. Amphotericin B methyl ester disrupts HIV-1 particle production and potently inhibits HIV-1 replication.
  • HY-100980
    HEAT hydrochloride

    BE2254 hydrochloride

    Adrenergic Receptor Neurological Disease
    HEAT (BE2254) hydrochloride is a selective alpha 1 adrenergic receptor antagonist. HEAT hydrochloride, a phenethylamine derivative, shows pKis of 9, 9.1, and 8.57 for alpha 1a, alpha 1b and alpha 1c, respectively.
  • HY-N6599
    3-Feruloylquinic acid

    Others Others
    3-Feruloylquinic acid, a derivative of quinic acid-bound phenolic acid, shows antioxidant activity. 3-Feruloylquinic acid markedly enhances by high photosynthetically active radiation (PAR) and UV irradiances.
  • HY-W020086
    2,3-Diaminophenazine

    2,3-Phenazinediamine

    Others Others
    2,3-Diaminophenazine (2,3-Phenazinediamine) is an amino derivative of phenazine with promising luminescence, electrochemical and biochemical applications.
  • HY-13624A
    Epirubicin hydrochloride

    4'-Epidoxorubicin hydrochloride

    DNA/RNA Synthesis Topoisomerase Apoptosis Cancer
    Epirubicin hydrochloride (4'-Epidoxorubicin hydrochloride), a semisynthetic L-arabino derivative of doxorubicin, has an antineoplastic agent by inhibiting Topoisomerase. Epirubicin hydrochloride inhibits DNA and RNA synthesis. Epirubicin hydrochloride is a Forkhead box protein p3 (Foxp3) inhibitor and inhibits regulatory T cell activity.
  • HY-13624
    Epirubicin

    4'-Epidoxorubicin

    DNA/RNA Synthesis Topoisomerase Apoptosis Cancer
    Epirubicin (4'-Epidoxorubicin), a semisynthetic L-arabino derivative of doxorubicin, has an antineoplastic agent by inhibiting Topoisomerase. Epirubicin inhibits DNA and RNA synthesis. Epirubicin is a Forkhead box protein p3 (Foxp3) inhibitor and inhibits regulatory T cell activity.
  • HY-W010243
    Methylisothiazolinone hydrochloride

    Bacterial Infection
    Methylisothiazolinone hydrochloride is the constituent of the biocide Kathon CG. Methylisothiazolinone hydrochloride is an isothiazolone derivative widely used as a preservative. Methylisothiazolinone hydrochloride is also a moderate sensitizer and reacts with GSH.
  • HY-121936
    Yohimbic acid

    Others Inflammation/Immunology Cardiovascular Disease
    Yohimbic acid is an amphoteric demethylated derivative of Yohimbine. Yohimbic acid exhibits vasodilatory action. Yohimbic acid also can be used for the research of osteoarthritis (OA).
  • HY-N0282
    Colcemid

    Demecolcine

    Microtubule/Tubulin Cancer Inflammation/Immunology
    Colcemid (Demecolcine), a derivative of colchicine, is a potent mitotic inhibitor. Colcemid binds to the protein tubulin and arrest cells in metaphase for karyotyping assays. Colcemid incuces cell apoptosis and can be used for cancer research.
  • HY-105940
    IQB-782

    Others Cardiovascular Disease
    IQB-782 is a cysteine derivative. IQB-782 has inhibition for thrombin activatable fibrinolysis inhibitor (TAFI), with an Ki(app) of 0.14 μM. IQB-782 shows a potent mucolytic-expectorant activity.
  • HY-15517A
    KN-92 phosphate

    Others Cancer
    KN-92 phosphate is an inactive derivative of KN-93, without CaM kinase inhibitory activity. KN-92 phosphate is intended to be used as a control compound in studies designed to elucidate the antagonist activities of KN-93. KN-93 is a cell-permeable, reversible and competitive CaMKII inhibitor.
  • HY-112023
    Lumisterol 3 (>90%)

    9β,10α-Cholesta-5,7-dien-3β-ol; Cholecalciferol EP Impurity A

    Endogenous Metabolite Others
    Lumisterol 3 (>90%) (9β,10α-Cholesta-5,7-dien-3β-ol) is a normal human secosterooid metabolite from the class of vitamin D3 photoisomer derivatives. Lumisterol 3 (>90%) is used in the preparation of vitamin D.
  • HY-15517
    KN-92

    Others Cancer
    KN-92 is an inactive derivative of KN-93, without CaM kinase inhibitory activity. KN-92 is intended to be used as a control compound in studies designed to elucidate the antagonist activities of KN-93. KN-93 is a cell-permeable, reversible and competitive CaMKII inhibitor.
  • HY-131067
    EMI56

    EGFR Cancer
    EMI56, the derivative of EMI1, displays greater potency toward mutant EGFR than EMI1. EMI56 inhibits EGFR triple mutants.
  • HY-136621
    5-HT1A modulator 2 hydrochloride

    5-HT Receptor Neurological Disease
    5-HT1A modulator 2 hydrochloride, a derivative of 8-OH-DPAT (HY-112061), is a modulator of 5-HT1A with a Ki of 53 nM for 5-HT1A binding.
  • HY-125531
    Dactylorhin A

    Others Others
    Dactylorhin A, a succinate derivative ester, is isolated from rhizomes of Gymnadenia conopsea. Dactylorhin A exhibits moderate inhibitory effects on NO production effects in RAW 264.7 macrophage cells.
  • HY-137658
    Purine riboside triphosphate

    PTP

    Nucleoside Antimetabolite/Analog Others
    Purine riboside triphosphate is a triphosphate derivative of purine riboside. Purine riboside is a naturally occurring base analog which closely resembles adenosine. Purine riboside inhibits carcinogenic growth. Purine riboside strongly inhibits RNA and DNA synthesis in different cancer ascites cells.
  • HY-103061
    Dehydro-ZINC39395747

    Others Cardiovascular Disease
    Dehydro-ZINC39395747 is a derivative of ZINC39395747. ZINC39395747 is a potent cytochrome b5 reductase 3 (CYB5R3) inhibitor with an IC50 of 9.14 μM and a Kd of 1.11 μM. ZINC39395747 can increase NO bioavailability in vascular cells.
  • HY-66010A
    Cinepazide

    Cardiovascular Disease
    Cinepazide is a piperazine derivative and acts as a weak calcium channel blocker. Cinepazide is a potent vasodilator and can be used for the research of cerebrovascular diseases, including ischemic stroke, brain infarct et. al.
  • HY-120832
    Azt-pmap

    HIV Infection
    Azt-pmap, a nucleoside analogue, is an aryl phosphate derivative of AZT. Azt-pmap shows anti-HIV activity. AZT is a nucleoside reverse transcriptase inhibitor (NRTI) for HIV infection.
  • HY-116770
    PFM01

    Others Cancer
    PFM01, N-alkylated Mirin derivative, is a MRE11 endonuclease inhibitor. PFM01 can regulate double-strand break repair (DSBR) by nonhomologous end-joining (NHEJ) versus homologous recombination (HR).
  • HY-141700
    FATP1-IN-2

    Others Metabolic Disease
    FATP1-IN-2, as an arylpiperazine derivative, is an orally active fatty acid transport protein 1 (FATP1) inhibitor (human IC50=0.43 μM, mouse IC50=0.39 μM).
  • HY-N7517
    Adenosine 5′-monophosphoramidate sodium

    Nucleoside Antimetabolite/Analog Others
    Adenosine 5′-monophosphoramidate sodium is an adenosine derivative and can be used as an intermediate for nucleotide synthesis. Adenosine 5′-monophosphoramidate has a significant effect on the accumulation of cyclic AMP.
  • HY-N7624
    Methyl oleanonate

    3-Oxoolean-12-en-28-oic acid methyl ester

    PPAR Cancer
    Methyl oleanonate is a natural triterpene PPARγ agonist isolated from the species of Pistacia. Methyl oleanonate is a modified oleanolic acid derivative with anti-cancer effects.
  • HY-W009245
    Bz-RS-iSer(3-Ph)-OMe

    HIV Infection
    Bz-RS-iSer(3-Ph)-OMe (compound 2), a Taxol derivative, inhibits HSV replication cycle at low cytotoxicity, blocks mitotic divisions of Vero cells, influences M-MSV induced tumor size and affects immune response by inhibiting PHA-induced T lymphocyte proliferation.
  • HY-101854
    N6-(2-Phenylethyl)adenosine

    N6-Phenethyladenosine; N6-Phenylethyladenosine

    Adenosine Receptor Cancer Inflammation/Immunology
    N6-(2-Phenylethyl)adenosine (N6-Phenethyladenosine), an adenosine derivative, is a potent adenosine receptors (AR) agonist with Ki values of 11.8 nM, 30.1 nM, 0.63 nM for rat A1AR, human A1AR and hA3AR, respectively.
  • HY-130703
    5-Dehydroepisterol

    Fungal Infection
    5-Dehydroepisterol is an episterol derivative and an intermediate in steroid biosynthesis. 5-Dehydroepisterol can be formed by C-5 sterol desaturase and converted into 24-methylenecholesterol by 7-dehydrocholesterol reductase. 5-Dehydroepisterol has anti-fungal activities.
  • HY-B0182
    Carmofur

    HCFU

    Nucleoside Antimetabolite/Analog SARS-CoV Virus Protease Cancer
    Carmofur (HCFU), a derivative of 5-Fluorouracil, is an antineoplastic agent. Carmofur is an inhibitor of acid ceramidase with an IC50 of 79 nM for the rat enzyme. Carmofur inhibits the SARS-CoV-2 main protease (Mpro). Carmofur Inhibits SARS-CoV-2 in Vero E6 cell with an EC50 of  24.3  μM.
  • HY-66010
    Cinepazide Maleate

    MD-67350

    Calcium Channel Cardiovascular Disease
    Cinepazide Maleate (MD-67350) is a piperazine derivative and acts as a weak calcium channel blocker. Cinepazide Maleate is a potent vasodilator and can be used for the research of cerebrovascular diseases, including ischemic stroke, brain infarct et. al.
  • HY-122746
    E67-2

    Histone Methyltransferase Cancer
    E67-2, as the E67 derivative, is a low-toxicity, selective KIAA1718 Jumonji domain inhibitor with an IC50 value of 3.4 µM. E67-2 selectively inhibits histone H3 lysine 9 (H3K9) Jumonji demethylase as well as histone H3 lysine 4 (H3K4) demethylase.
  • HY-129478
    TC11

    Caspase Bcl-2 Family CDK Cancer
    TC11 is a MCL1 degradator and Caspase-9 and CDK1 activator. TC11 structurally relates to immunomodulatory drugs as phenylphthalimide derivative. TC11 induces apoptotic death caused by degradation of MCL1 during prolonged mitotic arrest.
  • HY-113151
    18-Oxocortisol

    Mineralocorticoid Receptor Endogenous Metabolite Cardiovascular Disease
    18-Oxocortisol is a derivative of cortisol that is produced by aldosterone synthase (CYP11B2). 18-Oxocortisol is a naturally occurring mineralocorticoid agonist. 18-Oxocortisol is a biomarker in adrenal vein sampling.
  • HY-W078844
    PfDHODH-IN-2

    Dihydroorotate Dehydrogenase Parasite Infection
    PfDHODH-IN-2, a dihydrothiophenone derivative (Compound 11), is a potent Plasmodium falciparum dihydroorotate dehydrogenase (PfDHODH) inhibitor with an IC50 of 1.11 µM. PfDHODH-IN-2 acts as an antimalarial agent and can be used for the research of malaria.
  • HY-135652
    Hexyl gallate

    Hexyl 3,4,5-trihydroxybenzoate

    Bacterial Parasite Infection
    Hexyl gallates (Hexyl 3,4,5-trihydroxybenzoate) shows antibacterial activity and inhibits the production of rhamnolipid and pyocyanin by inhibiting RhlR. Hexyl gallate, a alkyl ester derivative of gallic acid, exhibits potent antimalarial activity against Plasmodium falciparum, with IC50 of 0.11 mM.
  • HY-B2082
    Fursultiamine

    Others Inflammation/Immunology Neurological Disease
    Fursultiamine is a vitamin B1 derivative, has anti-nociceptive and antineoplastic activity. Fursultiamine can be used for vitamin B1 deficiency, osteoarthritis (OA) and cancer research.
  • HY-120145
    MST-312

    Telomerase Inhibitor IX

    Telomerase Cancer
    MST-312 is a telomerase inhibitor. MST-312 is a chemically modified derivative of green tea epigallocatechin gallate (EGCG). MST-312 can be used for the research of cancer, such as multiple myeloma (MM).
  • HY-121149
    Droloxifene

    3-Hydroxytamoxifen

    Estrogen Receptor/ERR Apoptosis Cancer
    Droloxifene, a Tamoxifen derivative, is an orally active and selective estrogen receptor modulator. Droloxifene shows antiestrogenic and anti-implantation effects. Droloxifene induces p53 expression and apoptosis in MCF-7 cells. Droloxifene prevents bone loss in ovariectomized rats .
  • HY-106168
    Thymectacin

    NB1011

    Others Cancer
    Thymectacin (NB1011) is an agent selectively targeting tumor cells that have a high expression of thymidylate synthase (TS). Thymectacin is an aryloxy phosphoramidate derivative of BVdU (brivudin).
  • HY-107623
    TC-MCH 7c

    MCHR1 (GPR24) Metabolic Disease
    TC-MCH 7c, a phenylpyridone derivative, is an orally available, selective and brain-penetrable MCH1R antagonist with an IC50 of 5.6 nM for hMCH1R. TC-MCH 7c has Kis of 3.4 nM and 3.0 nM of human and mouse MCH1R, respectively.
  • HY-U00279
    Nitracrine

    DNA/RNA Synthesis Cancer
    Nitracrine inhibits RNA synthesis and covalently, reversibly binds to DNA but also forms covalent adducts with DNA in vivo. Nitracrine, a 1-nitroacridine derivative, is a potent hypoxia-selective agent in vitro and antitumor drug. Nitracrine has cytotoxicity towards most cells.
  • HY-121765
    Dacisteine

    N,S-Diacetyl-L-cysteine

    Endogenous Metabolite Metabolic Disease
    Dacisteine (N,S-Diacetyl-L-cysteine) is a cysteine derivative and displays a less New Delhi metallo-beta-lactamase-1 (NDM-1) inhibitor with an IC50 value of 1000 μM. Dacisteine can be used for the treatment of cardiovascular and cerebrovascular diseases caused by platelet aggregation.
  • HY-121212
    Icosabutate

    Others Metabolic Disease Inflammation/Immunology
    Icosabutate, an orally active ω-3 polyunsaturated fatty acid, is an aeicosapentaenoic acid (EPA) derivative. Icosabutate overcomes the drawbacks of unmodified EPA for liver targeting and improves insulin sensitivity, hepatic inflammation and fibrosis. Icosabutate is well tolerated, and efficacious in lowering non-high-density lipoprotein cholesterol (non-HDL-C) levels in persistent hypertriglyceridemia .
  • HY-108295
    Pivagabine

    CXB-722

    GABA Receptor Neurological Disease
    Pivagabine (CXB 722) is a hydrophobic 4-aminobutyric acid derivative with neuromodulatory activity. Pivagabine penetrates the blood-brain barrier in rats. Pivagabine antagonizes the effects of foot shock on both GABAA receptor function and corticotropin-releasing factor (CRF) concentrations in rat brain.
  • HY-136063
    Mefentrifluconazole

    Fungal Cytochrome P450 Infection
    Mefentrifluconazole is a novel azole derivative and used as an agrochemical broad-spectrum antifungal agent. Mefentrifluconazole is a potent, selective and orally active fungal CYP51 (Kd= 0.5 nM) inhibitor, but shows less inhibitory activity on human aromatase (IC50=0.92 μM).
  • HY-119698
    BAP9THP

    SD 8339; N-Benzyl-9-(tetrahydro-2h-pyran-2-yl)adenine

    Others Others
    BAP9THP is a synthetic cytokinin derivative and a growth regulator. BAP9THP promotes chlorophyll retention (and senescence delay) in plant tissues exceptionally strongly, and growth of tobacco callus almost as strongly as 6-Benzylaminopurine (BAP). BAP9THP induces adventitious shoot formation ignificantly more strongly than N6-isopentenyladenine or Kinetin.
  • HY-D0214
    Rose Bengal sodium

    Influenza Virus Others
    Rose Bengal sodium, a synthetic fluorescein derivative, and is a crimson-coloured dye with the principal component being 4,5,6,7-tetrachloro-2,4,5,7-tetraiodo fluorescein. Rose Bengal sodium has been widely used as an ophthalmic diagnostic agents, and can detect desiccated or damaged cells on the ocular surface. Rose Bengal sodium exhibits antiviral activities.
  • HY-15720B
    Glycyl H-1152 hydrochloride

    ROCK Aurora Kinase CaMK Neurological Disease
    Glycyl H-1152 hydrochloride (compound 18) is a glycyl derivative of Rho-kinase inhibitors H-1152 dihydrochloride. Glycyl H-1152 hydrochloride inhibits ROCKII, Aurora A, CAMKII and PKG, with IC50s of 0.0118, 2.35, 2.57 and 3.26 μM respectively. Glycyl H-1152 hydrochloride has higher selective than H-1152 hydrochloride.
  • HY-131394
    5-Hydroxymethyl-2’-deoxycytidine

    5hmdC

    Others Cancer
    5-Hydroxymethyl-2’-deoxycytidine (5hmdC) is an oxidation derivative of 5-methyl-2'-deoxycytidine (5-mdC) in DNA. 5-Hydroxymethyl-2’-deoxycytidine may serve as a marker of irreversibly damaged cells.
  • HY-134923
    CA77.1

    Autophagy Neurological Disease
    CA77.1 is a potent, brain-penetrant and orally active chaperone-mediated autophagy (CMA) activator with favorable pharmacokinetics. CA77.1 is a derivative of AR7 (HY-101106) and can increase the expression of the lysosomal receptor LAMP2A in lysosomes. CA77.1 improves behavior and neuropathology in PS19 mice model and can be used for alzheimer's disease research.
  • HY-19356A
    Didesmethylrocaglamide

    Eukaryotic Initiation Factor (eIF) Apoptosis Cancer
    Didesmethylrocaglamide, a derivative of Rocaglamide, is a potent eukaryotic initiation factor 4A (eIF4A) inhibitor. Didesmethylrocaglamide has potent growth-inhibitory activity with an IC50 of 5 nM. Didesmethylrocaglamide suppresses multiple growth-promoting signaling pathways and induces apoptosis in tumor cells. Antitumor activity.
  • HY-B1916
    Acetylspiramycin

    Spiramycin B; Spiramycin II; Foromacidin B

    Antibiotic Bacterial Infection
    Acetylspiramycin (Spiramycin B; Spiramycin II; Foromacidin B) is a potent and orally active macrolide antibiotic produced by various Streptomyces species, an acetylated derivative of Spiramycin (HY-100593). Acetylspiramycin is an antimicrobial agent with activity against gram-positive organisms, including Streptococcus pyogenes, S. viridans, Corynebacterium diphtheriae and methicillin-sensitive Staphylococcus aureus. Acetylspiramycin is also a potent antiprotozoal agent that against parasitic infection caused by Cryptosporidium spp.
  • HY-78263
    MNS

    NSC 170724; 5-(2-Nitrovinyl)benzodioxole

    Src Syk Cancer
    MNS (NSC 170724), the beta-nitrostyrene derivative, is a potent tyrosine kinase inhibitor and a broad-spectrum antiplatelet agent. MNS completely inhibits U46619, ADP-, arachidonic acid-, collagen-, and thrombin-induced platelet aggregation with IC50 values of 2.1, 4.1, 5.8, 7.0, and 12.7 μM, respectively. MNS inhibits Src, Syk, and FAK with IC50 of 27.3, 2.8, and 97.6 μM, respectively.
  • HY-103476
    Ro15-4513

    GABA Receptor Neurological Disease
    Ro15-4513, imidazobenzodiazepinone derivative, is a partial inverse agonist of benzodiazepine receptor (BZR). Ro15-4513 is a potent ethanol antagonist. Ro15-4513 has anti-anxiety effect.
  • HY-N7433
    4,6-O-Ethylidene-α-D-glucose

    Ethylidene-glucose

    GLUT Endogenous Metabolite Metabolic Disease
    4,6-O-ethylidene-α-D-glucose (Ethylidene-glucose), a glucose derivative, is a competitive exofacial binding-site inhibitor on glucose transporter 1 (GLUT1) with a Ki of 12 mM for wild-type 2-deoxy-D-glucose transport.
  • HY-133027
    Myristyl nicotinate

    Tetradecyl nicotinate

    Others Cancer
    Myristyl nicotinate (Tetradecyl nicotinate) is an ester prodrug and a lipophilic derivative of Nicotinic acid. Myristyl nicotinate is being developed for delivery of Nicotinic acid into the skin for prevention of actinic keratosis and its progression to skin cancer. Myristyl nicotinate shows to stimulate epidermal differentiation in photodamaged skin, increasing skin NAD content and strengthening the skin barrier.
  • HY-111614
    Melengestrol acetate

    Progesterone Receptor Cancer Metabolic Disease
    Melengestrol acetate is a progesterone derivative, acts as an orally active corticosteroid hormone to promote endometrial proliferation, pregnancy maintenance, and delay of menstrual activity. Melengestrol Acetate is used as a contraceptive agent for growth promoting effects and suppression of estrus in animals. Melengestrol acetate inhibits both the androgen-dependent and -independent prostatic tumors in vivo and can be used for cancer research.
  • HY-118743
    KMN-80

    Prostaglandin Receptor Metabolic Disease
    KMN-80, a derivative of PGE1 (HY-B0131), is a selective and potent agonist of EP4 receptor with an IC50 and a Ki of 3 nM and 2.35 nM, respectively. KMN-80 is against EP3 receptor with an IC50 of 1.4 μM and >10 μM for all other prostanoid receptors.
  • HY-14520
    Tetrahydrofolic acid

    L-5,6,7,8-Tetrahydrofolic acid; L-Tetrahydrofolic acid

    Endogenous Metabolite Metabolic Disease
    Tetrahydrofolic acid (L-5,6,7,8-Tetrahydrofolic acid) is the biologically active vitamin B9 folate derivative. Tetrahydrofolic acid is a donor of one-carbon groups for amino acids, nucleic acids, and lipids. Tetrahydrofolic acid serves as an acceptor of free formaldehyde, producing 5,10-methylenetetrahydrofolate-Tetrahydrofolic acid.
  • HY-14571
    E7820

    ER68203-00

    Integrin Cancer
    E7820 (ER68203-00), an orally active aromatic sulfonamide derivative, is a unique angiogenesis inhibitor suppressing an expression of integrin alpha2 subunit on endothelium. E7820 inhibits rat aorta angiogenesis with an IC50 of 0.11 μg/ml. E7820 modulates α-1, α-2, α-3, and α-5 integrin mRNA expression. Antiangiogenic and antitumor activity.
  • HY-124179
    IT-901

    NF-κB Cancer
    IT-901 is an orally active and potent NF-κB subunit c-Rel inhibitor with an IC50 of 0.1 µM, 3 μM for NF-κB DNA binding and c-Rel DNA binding, respectively. IT-901, a bioactive naphthalenethiobarbiturate derivative, has the potential for human lymphoid tumors and ameliorate graft-versus-host disease (GVHD).
  • HY-18005
    4-Aza-Oleanolic acid methyl ester

    Others Others
    4-Aza-Oleanolic acid methyl ester is a triterpenic derivative.
  • HY-W007771
    Acridone

    Bacterial Cancer Infection
    Acridone is an organic compound based on the acridine skeleton. Acridone has antibacterial, antimalarial, antiviral and anti neoplastic activities.
  • HY-133681
    (±)-2,3-Dibromosuccinic acid

    Others Others
    (±)-2,3-Dibromosuccinic acid is the key intermediate in the synthesis of dicarboxylic acid derivatives.
  • HY-122882
    HOIPIN-8

    E1/E2/E3 Enzyme Inflammation/Immunology
    HOIPIN-8 is a potent inhibitor of linear ubiquitin chain assembly complex (LUBAC) with an IC50 of 11 nM. HOIPIN-8 is a HOIPIN-1 derivative with enhanced the potency by 255-fold in the petit-LUBAC inhibition, and 10-fold and 4-fold in the LUBAC- and TNF-α-mediated NF-κB activation, respectively than HOIPIN-1. HOIPIN-1 is a promising tool to explore the cellular functions of LUBAC.
  • HY-111531
    DMTr-LNA-5MeU-3-CED-phosphoramidite

    Nucleoside Antimetabolite/Analog Others
    DMTr-LNA-5MeU-3-CED-phosphoramidite is a nucleoside derivative.
  • HY-N6657
    7-Hydroxy-4-methyl-8-nitrocoumarin

    Others Cancer
    7-Hydroxy-4-methyl-8-nitrocoumarin is a coumarin derivative.
  • HY-W010744
    DMT-dI

    5'-O-DMT-dI; 2'-Deoxy-5'-O-DMT-inosine

    Others Others
    DMT-dI (5'-O-DMT-dI) is a deoxyuridine which can be used in the preparation of convertible nucleoside derivatives.
  • HY-W035362
    ω-Pentadecalactone

    Others Others
    ω-Pentadecalactone is a fragrance ingredient. ω-Pentadecalactone is a member of the fragrance structural group macrocyclic lactone and lactide derivative.
  • HY-N0845
    Epoxymicheliolide

    1β,10β-Epoxymicheliolide

    Others Inflammation/Immunology
    Epoxymicheliolide is a micheliolide derivative.
  • HY-N6685
    3-Acetyldeoxynivalenol

    Others Cardiovascular Disease
    3-Acetyldeoxynivalenol, a trichothecene mycotoxin deoxynivalenol (DON) acetylated derivative, is a blood-brain barrier (BBB) permeable mycotoxin.
  • HY-U00311
    Aliconazole

    Fungal Infection
    Aliconazole is an antifungal imidazole derivative.
  • HY-103700A
    Azide-phenylalanine hydrochloride

    Others Others
    Azide-phenylalanine hydrochloride is a phenylalanine derivative.
  • HY-B1136
    Menbutone

    Genabilic acid

    Others Inflammation/Immunology
    Menbutone is an oxobutyric acid derivative, and is a choleretic.
  • HY-113100
    N-Acetylputrescine hydrochloride

    Endogenous Metabolite Others
    N-Acetylputrescine hydrochloride is a putrescine derivative.
  • HY-B0243
    Meprednisone

    Glucocorticoid Receptor Autophagy Metabolic Disease Endocrinology Cancer
    Meprednisone is a glucocorticoid and a methylated derivative of prednisone.
  • HY-105932
    Lexithromycin

    Erythromycin A 9-methoxime; Wy 48314

    Bacterial Antibiotic Infection
    Lexithromycin is an erythromycin A derivative, with antibacterial activity.
  • HY-113411
    3-Hydroxyglutaric acid

    Endogenous Metabolite Others
    3-Hydroxyglutaric acid is a glutaric acid derivative.
  • HY-113524
    N-Acetyl-L-aspartic acid

    Endogenous Metabolite Others
    N-Acetyl-L-aspartic acid is a derivative of aspartic acid.
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Glucagon Receptor Metabolic Disease
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-N0894
    Octahydrocurcumin

    Hexahydrobisdemethoxycurcumin

    Reactive Oxygen Species Others
    Octahydrocurcumin is a hydrogenated derivatives of curcumin; metabolite of curcumin.
  • HY-113426
    Nepsilon-Acetyl-L-lysine

    Endogenous Metabolite Others
    Nepsilon-Acetyl-L-lysine is a derivative of the amino acid lysine.
  • HY-N1468
    Agarotetrol

    Others Metabolic Disease
    Agarotetrol is a chromone derivative isolated from Agarwood.
  • HY-100194
    FKK

    Others Inflammation/Immunology Cardiovascular Disease
    FKK is an indazole derivative and also a novel bronchodilator.
  • HY-P1229
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS

    Glucagon Receptor Metabolic Disease
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
  • HY-76802
    Calcitriol Derivatives

    VD/VDR Metabolic Disease
    Calcitriol Derivatives is a vitamin D3 analog.
  • HY-15267
    MC 976

    VD/VDR Metabolic Disease
    MC 976 is a Vitamin D3 derivative.
  • HY-117279
    (S)-Metolachor

    Others Others
    (S)-Metolachor, a derivative of aniline, is a major pesticide in use.
  • HY-B0446
    Naphazoline hydrochloride

    Adrenergic Receptor Cardiovascular Disease Endocrinology
    Naphazoline hydrochloride is an ocular vasoconstrictor and imidazoline derivative sympathomimetic amine.
  • HY-113404
    DL-Dopa

    Endogenous Metabolite Others
    DL-Dopa is a beta-hydroxylated derivative of phenylalanine.
  • HY-B0931
    Citiolone

    Others Others
    Citiolone is a derivative of the amino acid cysteine, used in liver therapy.
  • HY-N0917
    6''-O-Malonylgenistin

    Malonylgenistin; Genistin malonate

    Others Inflammation/Immunology
    6''-O-Malonylgenistin(Malonylgenistin) is an isoflavone derivative.
  • HY-111807
    Locked nucleic acid 1

    Nucleoside Antimetabolite/Analog Metabolic Disease
    Locked nucleic acid 1 is a derivative of LNA-type nucleoside.
  • HY-U00021
    Clothixamide

    Clotixamide

    Others Neurological Disease
    Clothixamide is a thiazide derivative. It is used to treat psychiatric disorders.
  • HY-101719
    Ketocaine

    Rec 7-0518

    Others Neurological Disease
    Ketocaine is a butyrophenone derivative used topically for pain relief.
  • HY-B1044
    Idramantone

    Kemantane; 5-Hydroxy-2-adamantanone

    Others Neurological Disease
    Idramantone (Kemantane), an Adamantane derivative, is an immunostimulant.
  • HY-121054
    Chalcone

    Bacterial Cancer Inflammation/Immunology
    Chalcone is isolated from Glycyrrhizae inflata and used to synthesize chalcone derivatives. Chalcone derivatives possess varied biological and pharmacological activity, including anti-inflammatory, antioxidative, antibacterial, anticancer, and anti-parasitic activities.
  • HY-128720
    Diethyl oxalpropionate

    Endogenous Metabolite Metabolic Disease
    Diethyl oxalpropionate is an intermediate for poly((R,S)-3,3-dimethylmalic acid) (PDMMLA) derivative synthesis. PDMMLA derivative can be used in synthesis of nanoparticles and study of warfarin encapsulation and controlled release.
  • HY-136647
    8-Bromoadenosine 5'-triphosphate tetrasodium

    8-Br-ATP tetrasodium

    Others Others
    8-Bromoadenosine 5'-triphosphate tetrasodium (8-Br-ATP tetrasodium) is an ATP analogue. ATP is a central component of energy storage and metabolism in vivo.
  • HY-N0094
    Ipriflavone

    Others Metabolic Disease Cancer
    Ipriflavone is a synthetic isoflavone derivative used to suppress bone resorption.
  • HY-N4204
    Daidzein diacetate

    Others Cancer
    Daidzein diacetate is a derivative of Daidzein that is a soy isoflavone.
  • HY-B0525
    Carbenicillin

    Bacterial Antibiotic Infection
    Carbenicillin is broad-spectrum semisynthetic penicillin derivative used parenterally.
  • HY-Y0030
    3-Hydroxypicolinic acid

    Picolinic acid, 3-hydroxy- (6CI,7CI,8CI); 2-Carboxy-3-hydroxypyridine

    Endogenous Metabolite Others
    3-Hydroxypicolinic acid is a picolinic acid derivative, and belongs to the pyridine family.
  • HY-N8162
    Soyasapogenol D

    Others Others
    Soyasapogenol D is a methyl-trimethylsilyl derivative of the sapogenin.
  • HY-B1045A
    Chlorazanil

    Others Metabolic Disease
    Chlorazanil is a triazine derivative and also a new nonmercurial diuretic agent.
  • HY-15642
    TD-198946

    Others Inflammation/Immunology
    TD-198946, a thienoindazole derivative, is a potent chondrogenic agent.
  • HY-13927
    Acetildenafil

    Phosphodiesterase (PDE) Cancer Cardiovascular Disease
    Acetildenafil is a derivative of the phosphodiesterase 5 (PDE5) inhibitor Sildenafil.
  • HY-N6854A
    3α-Hydroxymogroside IA1

    Others Cancer Metabolic Disease
    3α-Hydroxymogroside IA1 is a mogroside derivative.
  • HY-B2117
    Valpromide

    Epoxide Hydrolase HSV Infection Neurological Disease
    Valpromide is an amide derivative of valproic acid and inhibits human epoxide hydrolase.
  • HY-100264
    Uldazepam

    U31920

    GABA Receptor Neurological Disease
    Uldazepam is a benzodiazepine derivative and has the potential for anxiety syndrome treatment.
  • HY-113267
    Dihydrofolic acid

    Endogenous Metabolite Metabolic Disease
    Dihydrofolic acid is a folic acid derivative acted upon by dihydrofolate reductase to produce tetrahydrofolic acid.
  • HY-U00316
    Vinconate

    Chanodesethylapovinc​amine

    mAChR Neurological Disease
    Vinconate is an indolonaphthyridine derivative and can stimulate the muscariic acetylcholine receptor.
  • HY-B1258
    4-(Aminomethyl)benzoic acid

    Aminomethylbenzoic acid; α-Amino-p-toluic acid

    Others Others
    4-(Aminomethyl)benzoic acid is an unnatural amino acid derivative, is an antifibrinolytic.
  • HY-B0717
    Tocofersolan

    TPGS; D-α-Tocopherol polyethylene glycol 1000 succinate; Vitamin E-TPGS

    Others Metabolic Disease
    Tocofersolan is a synthetic polyethylene glycol derivative of α-tocopherol.
  • HY-106406
    Benzylacyclouridine

    BAU; 5-Benzylacyclouridine

    Others Cancer
    Benzylacyclouridine (BAU) is a potent and specific inhibitor of uridine phosphorylase, the first enzyme in the catabolism of uridine. Benzylacyclouridine can modulate the cytotoxic side effects of 5-fluorouracil (5-FU) and its derivatives.
  • HY-W013159
    2'-Deoxyguanosine 5'-monophosphate disodium

    5′-dGMP disodium

    Endogenous Metabolite Metabolic Disease
    2'-Deoxyguanosine 5'-monophosphate disodium (5′-dGMP disodium) is a mononucleotide having guanine as the nucleobase. 2'-Deoxyguanosine 5'-monophosphate disodium is a nucleic acid guanosine triphosphate (GTP) derivative.
  • HY-119824
    Trofosfamide

    Bacterial Cancer
    Trofosfamide is an orally bioavailable oxazaphosphorine derivative with antineoplastic activity.
  • HY-102015
    6-Biopterin

    L-Biopterin

    NO Synthase Endogenous Metabolite Cancer Neurological Disease
    6-Biopterin (L-Biopterin), a pterin derivative, is a NO synthase cofactor.
  • HY-N7705
    Isoescin Ie

    Others Others
    Isoescin Ie is a derivative of Aescine in Aesculi Semen extract.
  • HY-19085
    KW-6055

    Others Neurological Disease
    KW-6055 is a benzylpyridine derivative and has anti-amnesic activity.
  • HY-N7706
    Escin Ie

    Others Others
    Escin Ie is a derivative of Aescine in Aesculi Semen extract.
  • HY-117289
    AKOS B018304

    Others Others
    AKOS B018304 is an arylalkylidene derivative, with polar substitution at para-position.
  • HY-U00162
    SZ1676

    Others Neurological Disease
    SZ1676 is a derivative of SZ1677, which is a neuromuscular blocking agent.
  • HY-13700
    Nedaplatin

    NSC 375101D

    DNA/RNA Synthesis Cancer
    Nedaplatin (NSC 375101D) is a derivative of cisplatin and DNA damage agent.
  • HY-15267B
    (24S)-MC 976

    VD/VDR Metabolic Disease
    (24S)-MC 976 is a Vitamin D3 derivative.
  • HY-N2287
    Cimifugin 4'-O-β-D-glucopyranoside

    Others Inflammation/Immunology
    Cimifugin 4'-O-β-D-glucopyranoside is a derivative of cimifugin.
  • HY-101949
    LTX-401 dihydrochloride

    Others Inflammation/Immunology
    LTX-401, an oncolytic amino acid derivative, targets the Golgi apparatus.
  • HY-15267A
    (24R)-MC 976

    VD/VDR Metabolic Disease
    (24R)-MC 976 is a Vitamin D3 derivative.
  • HY-N6587
    Betulinic acid methyl ester

    Methyl betulinate

    Others Others
    Betulinic acid methyl ester, a betulinic acid derivative, possesses antiprotozoal activity.
  • HY-125829
    Erythropterin

    Others Others
    Erythropterin is a Pterin derivative that belongs in a group of heterocyclic compounds that are frequently found in biological systems. Pterin derivatives are responsible for the characteristic warning coloration of some Heteroptera and other insects, signaling noxiousness or unpalatability and are used to discourage potential predators from attacking.
  • HY-136537A
    N-β-alanyldopamine hydrochloride

    NBAD hydrochloride

    Endogenous Metabolite Neurological Disease
    N-β-alanyldopamine hydrochloride (NBAD hydrochloride) is the major dopamine derivative in haemolymph.
  • HY-13761
    Teniposide

    VM26

    Topoisomerase Cancer
    Teniposide is a podophyllotoxin derivative, acts as a topoisomerase II inhibitor, and used as a chemotherapeutic agent.
  • HY-13566A
    Belotecan hydrochloride

    CKD-602

    Topoisomerase Cancer
    Belotecan hydrochloride (CKD-602 hydrochloride), a Topoisomerase I inhibitor, is a synthetic camptothecin derivative.
  • HY-B1742
    Proxyphylline

    Adenosine Receptor Cardiovascular Disease
    Proxyphylline is a methylxanthine derivative used as a cardiac stimulant, vasodilator and bronchodilator.
  • HY-B2239
    Riboflavin Tetrabutyrate

    Reactive Oxygen Species Metabolic Disease
    Riboflavin Tetrabutyrate is a lipophilic flavin derivative with antioxidative and lipid peroxide-removing activity.
  • HY-B0415
    Fluocinolone (Acetonide)

    Glucocorticoid Receptor Inflammation/Immunology Endocrinology
    Fluocinolone Acetonide is a glucocorticoid derivative used topically in the treatment of various skin disorders.
  • HY-N2254
    (-)-Oxypeucedanin hydrate

    (-)-Prangol

    Others Cancer
    (-)-Oxypeucedanin hydrate ((-)-Prangol) is a derivative of furocoumarin isolated from Ducrosia anethifolia.
  • HY-B2212
    Dibenzoyl Thiamine

    Bentiamine

    Others Others
    Dibenzoyl Thiamine (Bentiamine), a derivative of thiamine, is rapidly absorbed into the body and converted to thiamine.
  • HY-13644A
    Gusperimus trihydrochloride

    Spanidin; NKT-01; BMS181173

    Others Cancer Inflammation/Immunology
    Gusperimus trihydrochloride (Spanidin) is a derivative of the antitumor antibiotic spergualin with immunosuppressant activity.
  • HY-Y1139
    Pimelic acid

    Heptanedioic acid; 1,5-Pentanedicarboxylic acid; 1,7-Heptanedioic acid

    Endogenous Metabolite Metabolic Disease
    Pimelic acid is the organic compound and its derivatives are involved in the biosynthesis of the amino acid called lysine.
  • HY-101756
    SDZ281-977

    SDZ-LAP 977

    Others Cancer
    SDZ 281-977 is a derivative of the EGF receptor tyrosine kinase inhibitor Lavendustin A.
  • HY-128972
    Purpurin 18

    Others Others
    Purpurin 18, a derivative of chlorophyll, is an interesting dihydroporphyrin for generating photosensitizers.
  • HY-100284
    Thiazolidinone-Derivatives-1

    Others Inflammation/Immunology
    Thiazolidinone-Derivatives-1 is an antiulcer agent which inhibits the secretion of gastric acid.
  • HY-137088
    Imiclopazine

    Others Neurological Disease
    Imiclopazine is a phenothiazine derivative with good sedative, analgesic, antiaggressive and antiemetic effects.
  • HY-14672
    Soblidotin

    Auristatin PE; TZT-1027

    Microtubule/Tubulin Cancer
    Soblidotin (Auristatin PE) is a novel synthetic Dolastatin 10 derivative and inhibitor of tubulin polymerization.
  • HY-W017163
    7-Methylxanthine

    Endogenous Metabolite Metabolic Disease
    7-Methylxanthine, a methyl derivative of xanthine, is one of the purine components in urinary calculi.
  • HY-U00414
    Antitumor agent-4

    Others Cancer
    Antitumor agent-4, a butenylphenyl phosphate derivative, is a drug for mammary cancer and anovulatory sterility.
  • HY-106372A
    Carcainium chloride

    QX 572; RSD 931

    Others Inflammation/Immunology Neurological Disease
    Carcainium chloride (QX 572) is a quaternary derivative of Lidocaine. Antitussive effect.
  • HY-113368
    3b,17b-Dihydroxyetiocholane

    Endogenous Metabolite Metabolic Disease
    3b,17b-Dihydroxyetiocholane is known as androgens and derivatives.
  • HY-W001179
    2,5-Dihydroxybenzoic acid

    Endogenous Metabolite FGFR Others
    2,5-Dihydroxybenzoic acid is a derivative of benzoic and a powerful inhibitor of fibroblast growth factors.
  • HY-101404
    DL-Homocysteine thiolactone hydrochloride

    Endogenous Metabolite Others
    DL-Homocysteine thiolactone hydrochloride is a cyclic amino acid derivative that exhibits root-growth inhibitory activity.
  • HY-75839
    Dronedarone Hydrochloride

    Potassium Channel Autophagy Cardiovascular Disease
    Dronedarone Hydrochloride is a non-iodinated amiodarone derivative that inhibits Na +, K + and Ca 2+ currents.
  • HY-A0145
    Phenprocoumon

    Others Others
    Phenprocoumon is a coumarin derivative that acts as a long acting oral anticoagulant and an antagonist of vitamin K.
  • HY-W010510
    DL-Norvaline

    2-Aminopentanoic acid

    Endogenous Metabolite Arginase Metabolic Disease
    DL-Norvaline, a derivative of L-norvaline, L-norvaline is a non-competitive inhibitor of arginase.
  • HY-P1223
    Exendin-3/4 (59-86)

    Glucagon Receptor Metabolic Disease
    Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
  • HY-U00034
    PCA50941

    Others Cardiovascular Disease
    PCA50941 is a 1,4-dihydropyridine derivative, used for treatment for cardiovascular disease.
  • HY-N0091
    Hypoxanthine

    Purin-6-ol; Sarcine

    Endogenous Metabolite Others
    Hypoxanthine, a purine derivative, is a potential free radical generator and could be used as an indicator of hypoxia.
  • HY-I0960
    Uracil

    Endogenous Metabolite Cancer
    Uracil is a common and naturally occurring pyrimidine derivative and one of the four nucleobases in the nucleic acid of RNA.
  • HY-100296
    Gastrofensin AN 5 free base

    Others Inflammation/Immunology
    Gastrofensin AN 5 free base, a 4-phenyl-tetrahydroisoquinoline derivative, is an antiulcer agent.
  • HY-B0901
    Bromperidol

    R-11333

    5-HT Receptor Neurological Disease
    Bromperidol is a butyrophenone derivative, is a potent and long-acting neuroleptic, used as an antipsychotic in the treatment of schizophrenia.
  • HY-U00357
    Urinary Incontinence-Targeting Compound 1

    Others Neurological Disease
    Urinary Incontinence-Targeting Compound 1 is a sulfonanilide derivative, used in the research of urinary incontinence.
  • HY-133619
    8-Abietenic acid

    Fungal Infection
    8-Abietenic acid is the secondary metabolite of mucorinic acid and is isolated from a solid culture of the fungus Mucor spp. isolated on insect Acalymma bivittula. 8-Abietenic acid exhibits antibacterial and insecticidal activities.
  • HY-N7613
    6''-O-Acetylsaikosaponin A

    Others Others
    6''-O-Acetylsaikosaponin A, an acetyl saikosaponin isolated from the roots of Bupleurum chinense, shows some osteoclast-inhibiting activities.
  • HY-139448
    Carboxyebselen

    HOOC-Ebs

    NO Synthase Cardiovascular Disease
    Carboxyebselen (HOOC-Ebs) is a potent and selective inhibitor of endothelial nitric oxide synthase (eNOS).
  • HY-129779
    BTL-104

    Others Cancer
    BTL-104 is a monobiotinylated Phos-tag derivative for the detection of phosphopeptides and phosphoproteins.
  • HY-16366
    Briciclib

    ON 014185

    Eukaryotic Initiation Factor (eIF) Autophagy Cancer
    Briciclib (ON 014185) is a derivative of ON 013100, and has the potential in targeting eIF4E for solid cancers.
  • HY-136554
    WYC-210

    Others Cancer
    WYC-210, a Tazarotene derivative, is a retinoid compound with lower anticancer activity.
  • HY-N0007
    Bisdemethoxycurcumin

    Curcumin III; Didemethoxycurcumin

    Apoptosis Autophagy Cancer
    Bisdemethoxycurcumin(Curcumin III; Didemethoxycurcumin) is a natural derivative of curcumin with anti-inflammatory and anti-cancer activities.
  • HY-W040329
    2'-Deoxyadenosine

    Endogenous Metabolite Others
    2'-Deoxyadenosine is a nucleoside adenosine derivative, pairing with deoxythymidine (T) in double-stranded DNA.
  • HY-N3894
    Ferulamide

    nAChR Neurological Disease
    Ferulamide is a Ferulic acid derivative isolated from Portulaca oleracea L. with anticholinesterase activities.
  • HY-N2188
    Beta-Acetoxyisovalerylshikonin

    Others Inflammation/Immunology
    Beta-Acetoxyisovalerylshikonin is a naphthoquinone derivative isolated from Arnebia euchroma.
  • HY-112077
    13-cis-N-[4-(Ethoxycarbonyl)phenyl]retinamide

    Ethyl 4-((2Z,4E,6E,8E)-3,7-dimethyl-9-(2,6,6-trimethylcyclohex-1-en-1-yl)nona-2,4,6,8-tetraenamido)benzoate

    Others Inflammation/Immunology
    13-cis-N-[4-(Ethoxycarbonyl)phenyl]retinamide is a derivative of Retinoic acid.
  • HY-B0079
    Sugammadex sodium

    Org25969

    Others Neurological Disease
    Sugammadex sodium is a synthetic γ-cyclodextrin derivative, and acts as a new reversal agent for neuromuscular block.
  • HY-76504
    2,6-Dimethoxybenzoic acid

    Endogenous Metabolite Others
    2,6-Dimethoxybenzoic acid is a member of organic compounds known as o-methoxybenzoic acids and derivatives.
  • HY-W013179
    18-Hydroxycorticosterone

    Endogenous Metabolite Metabolic Disease
    18-Hydroxycorticosterone is a corticosteroid and a derivative of corticosterone, which can lead to serious electrolyte imbalances.
  • HY-B1278A
    DL-α-Tocopherol acetate

    Vitamin E acetate

    Endogenous Metabolite Inflammation/Immunology
    DL-α-Tocopherol acetate is a vitamin E derivative which is often included in the formulations of enteral nutrition.
  • HY-B1292
    Iodipamide

    Adipiodone

    Others Others
    Iodipamide is a tri-iodinated benzoate derivative and ionic dimeric contrast agent used in diagnostic imaging.
  • HY-100033
    NSC5844

    RE-640

    Parasite Cancer Infection
    NSC5844 (RE-640) is a 4-aminoquinoline derivative, with antitumor and antimalarial activity.
  • HY-129780
    BTL-105

    Others Cancer
    BTL-105 is a monobiotinylated Phos-tag derivative for the detection of phosphopeptides and phosphoproteins.
  • HY-100189
    LS2265

    Others Metabolic Disease
    LS2265 is a taurine derivative of fenofibrate and can induce proliferation of peroxisomes in liver cells of rats.
  • HY-101581
    Bucloxic acid

    804CB; Bucloxonic acid; Esfar

    Others Inflammation/Immunology
    Bucloxic acid is an anti-inflammatory pyrrazole derivative. Bucloxic acid can be used in the treatment of chronic glomerular nephropathies.
  • HY-16363
    Omtriptolide

    ERK Inflammation/Immunology
    Omtriptolide (PG490-88) is a derivative prodrug of triptolide purified from the Chinese herb.
  • HY-W010388
    Creatine

    Endogenous Metabolite Metabolic Disease
    Creatine, an endogenous amino acid derivative, plays an important role in cellular energy, especially in muscle and brain.
  • HY-U00153
    Dixyrazine

    Others Neurological Disease
    Dixyrazine, a phenothiazine derivative, can prevent brain oedema induced by intracarotid injection of protamine sulphate.
  • HY-N1412
    1,3-Dicaffeoylquinic acid

    1,3-O-Dicaffeoylquinic acid; 1,5-Dicaffeoylquinic acid

    PI3K Akt Reactive Oxygen Species Neurological Disease
    1,3-Dicaffeoylquinic acid is a caffeoylquinic acid derivative that exhibits antioxidant activity and radical scavenging activity.
  • HY-N7121
    Erythromycin estolate

    Bacterial Infection
    Erythromycin estolate, erythromycin derivative, is a macrolide antibiotic used in the treatment of a wide variety of bacterial infections. Erythromycin estolate causes several cases of liver injury which mostly include cholestatic hepatitis. Erythromycin estolate toxicity is related to its inhibitory effect on bile acid transport.
  • HY-15459
    Cabazitaxel

    XRP6258; RPR-116258A; taxoid XRP6258

    Microtubule/Tubulin Autophagy Cancer
    Cabazitaxel is a semi-synthetic derivative of the natural taxoid 10-deacetylbaccatin III with potential antineoplastic activity.
  • HY-131101
    Nor-Acetildenafil

    Others Others
    Nor-Acetildenafil is an Acetildenafil derivative. Acetildenafil is a synthetic agent which acts as a phosphodiesterase inhibitor.
  • HY-B0023
    Azelnidipine

    CS 905

    Calcium Channel Cardiovascular Disease
    Azelnidipine(CS 905; Calblock) is a novel dihydropyridine derivative, a L-type calcium channel blocker, and an antihypertensive.
  • HY-128467
    Dehydroacetic acid sodium

    Sodium dehydroacetate

    Bacterial Fungal Infection
    Dehydroacetic acid sodium, a pyrone derivative acts as an antibacterial and antifungal agent. Dehydroacetic acid possess phytotoxic activity.
  • HY-B0742
    Hydroxyprogesterone caproate

    17α-Hydroxyprogesterone hexanoate; 17α-Hydroxyprogesterone caproate

    Others Others
    Hydroxyprogesterone caproate is a synthetic, steroidal progestin; an ester derivative of 17α-hydroxyprogesterone formed from caproic acid.
  • HY-12752A
    Alimemazine hemitartrate

    Trimeprazine hemitartrate

    Others Inflammation/Immunology Neurological Disease
    Alimemazine hemitartrate is a phenothiazine derivative that is generally used as an antipruritic agent and also a hemagglutinin (HA)-receptor antagonist.
  • HY-107369
    4-Butylresorcinol

    Butylresorcinol

    Tyrosinase Others
    4-Butylresorcinol is a phenol derivative which can inhibit tyrosinase with IC50 of 11.27 μM.
  • HY-N4132
    17-Hydroxyisolathyrol

    Others Infection Inflammation/Immunology
    17-Hydroxyisolathyrol is a macrocychc lathyrol derivative isolated from seeds of Euphorbla luthyrrs.
  • HY-111642
    3'-Azido-3'-deoxy-beta-L-uridine

    Nucleoside Antimetabolite/Analog Others
    3'-Azido-3'-deoxy-beta-L-uridine (Compound 25) is a nucleoside derivative.
  • HY-N6631
    7-Methoxyisoflavone

    AMPK Metabolic Disease Cancer
    7-Methoxyisoflavone is an isoflavone derivative and also an activator of adenosine monophosphate-activated protein kinase (AMPK).
  • HY-101398
    Coproporphyrin III

    Zincphyrin

    Endogenous Metabolite Others
    Coproporphyrin III (Zincphyrin) is a naturally occurring porphyrin derivative that is mainly found in urine.
  • HY-128851
    Coenzyme A

    Endogenous Metabolite Cancer Neurological Disease
    Coenzyme A is is an obligatory cofactor in all living cells synthesised from pantothenate (Vitamin B5), adenosine triphosphate (ATP) and cysteine. Covalent binding of Coenzyme A to Peroxiredoxin 5 (Prdx5) results in complete inhibition of its peroxidase activity, which is reversed by reduction with DTT.Coenzyme A and its thioester derivatives are key players in major catabolic and anabolic pathways and the regulation of gene expression. Many human pathologies, including cancer, diabetes and neurodegeneration, have been associated with abnormal biosynthesis and homeostasis of CoA and its derivatives.
  • HY-B0508
    Ornidazole

    Ro 7-0207

    Bacterial Parasite Antibiotic Infection
    Ornidazole(Ro 7-0207) is a 5-nitroimidazole derivative with antiprotozoal and antibacterial properties against anaerobic bacteria.
  • HY-U00020
    AU-224

    Others Metabolic Disease
    AU-224 is a benzamide derivative used as a promising gastrointestinal prokinetic agent without significant side effects.
  • HY-100167
    TAK-778

    Others Cancer
    TAK-778 is a derivative of ipriflavone and has been shown to induce bone growth in in vitro and in vivo models.
  • HY-23524
    HSL-IN-3

    Others Others
    HSL-IN-3 (example 42), a boronic acid ester derivative, is an inhibitor of hormone-sensitive lipase (HSL).
  • HY-103708
    Nezukone

    C2-deoxyhinokitiol; 4-Isopropyltropone

    Others Others
    Nezukone is a derivative of hinokitiol. Hinokitiol can restore iron transports, however, Nezukone cannot bind or transport iron.
  • HY-130702
    24(28)-Dehydroergosterol

    Others Others
    24(28)-Dehydroergosterol is a derivative of Episterol. Episterol is a sterol involved in the biosynthesis of steroids.
  • HY-N2124
    Parishin B

    Others Cancer
    Parishin B, a parishin derivative isolated from Gastrodia elata, may have antioxidant property.
  • HY-W017462
    Creatine monohydrate

    Endogenous Metabolite Metabolic Disease
    Creatine monohydrate, an endogenous amino acid derivative, plays an important role in cellular energy, especially in muscle and brain.
  • HY-N1465
    Aristolochic acid D

    Others Cancer
    Aristolochic acid D is an aristolochic acid derivative isolated from stems of Aristolochia indica. Aristolochic acid is nephrotoxin and carcinogen.
  • HY-10882
    Clotrimazole

    Fungal Bacterial Autophagy Antibiotic Infection Cancer
    Clotrimazole is an imidazole derivative, an antifungal compound and is a CYP (cytochrome P450) inhibitor. Clotrimazole has antibacterial activity.
  • HY-100584
    Davercin

    Erythromycin Cyclocarbonate

    Bacterial Antibiotic Infection
    Davercin (Erythromycin Cyclocarbonate), derivative of Erythromycin, which is active against Gram-positive and some Gram-negative microorganisms.
  • HY-B0525A
    Carbenicillin disodium

    Sodium carbenicillin

    Bacterial Antibiotic Infection
    Carbenicillin disodium is a beta-lactam penicillin derivative that interference with final stage of bacterial cell wall synthesis.
  • HY-111744
    Deacetylanisomycin

    Others Metabolic Disease
    Deacetylanisomycin is a potent growth regulator in plants and an inactive derivative of Anisomycin. Anisomycin is a potent protein synthesis inhibitor .
  • HY-Y1362
    Ethyl pyruvate

    Others Inflammation/Immunology
    Ethyl pyruvate is a simple derivative of the endogenous metabolite, pyruvic acid. Ethyl pyruvate is an anti-inflammatory agent.
  • HY-Y0470
    Semicarbazide hydrochloride

    Aminourea hydrochloride; Hydrazinecarboxamide hydrochloride

    Others Cancer Inflammation/Immunology
    Semicarbazide hydrochloride, a derivative of urea, possesses antiviral, antiinfective and antineoplastic through binding to copper or iron in cells.
  • HY-N6873
    GL3

    Others Others
    GL3, the major component of O. fragrans seeds, is a derivative based on both phenylethanoid and methyloleoside.
  • HY-N2126
    Parishin E

    Others Others
    Parishin E, a parishin derivative isolated from Gastrodia elata, may have antioxidant property.
  • HY-133598
    3,4,5-Trichlorocatechol

    Others Cancer
    3,4,5-Trichlorocatechol is a catechol derivative of pentachlorophenol and induces oxidative DNA lesions.
  • HY-N2125
    Parishin C

    Others Neurological Disease
    Parishin C, a parishin derivative isolated from Gastrodia elata, may have antioxidant property.
  • HY-112789
    (+)-JQ1 PA

    Epigenetic Reader Domain Cancer
    (+)-JQ1 PA is a derivative of the Bromodomain and extra-terminal (BET) inhibitor JQ1, with an IC50 of 10.4 nM.
  • HY-108922
    Probucol disuccinate

    Others Metabolic Disease
    Probucol Disuccinate is a derivative of Probucol, a lipid-regulating agent and can reduce LDL-cholesterol levels.
  • HY-101596
    Ethyl dirazepate

    GABA Receptor Neurological Disease
    Ethyl dirazepate is a drug which is a benzodiazepine derivative. It has anxiolytic and hypnotic and possibly other characteristic benzodiazepine properties.
  • HY-101822
    Naminterol

    Adrenergic Receptor Inflammation/Immunology Endocrinology
    Naminterol is a phenethanolamine derivative, is a β2 adrenoceptor agonist with bronchodilatory properties. Naminterol is used for treatment of asthma.
  • HY-U00192
    CGP11952

    GABA Receptor Neurological Disease
    CGP11952 is a triazolyl-Benzaphenon resembling the benzodiazepines in its pharmacological action. CGP11952 is an experimental benzodiazepine derivative.
  • HY-B1087
    Prednisolone hemisuccinate

    Prednisolone 21-hemisuccinate

    Others Inflammation/Immunology
    Prednisolone hemisuccinate is a synthetic glucocorticoid, a derivative of cortisol, which is used to treat a variety of inflammatory and auto-immune conditions.
  • HY-101722
    Melinamide

    AC 223; DL-N-(α-Methylbenzyl)linoleamide

    Others Metabolic Disease
    Melinamide, an amide derivative of an unsaturated long-chain fatty acid, is an inhibitor of cholesterol absorption with an IC50 of 20.9 μM.
  • HY-B0735
    Fenoldopam

    SKF 82526

    Dopamine Receptor Cardiovascular Disease
    Fenoldopam(SKF 82526) is a drug and synthetic benzazepine derivative which acts as a selective D1 receptor partial agonist.
  • HY-W054064
    6-Chloro-7-deazapurine-β-D-riboside

    Fungal Infection
    Chloro-7-deazapurine-β-D-riboside is a nucleoside derivative and has antifungal activity.
  • HY-100138
    2-Aminoethyl-mono-amide-DOTA-tris(tBu ester)

    ADC Linker Cancer
    2-Aminoethyl-mono-amide-DOTA-tris(tBu ester) is a macrocycle DOTA derivative for tumor pretargeting.
  • HY-108599
    DCP-LA

    FR236924

    PKC Neurological Disease
    DCP-LA (FR236924), a linoleic acid derivative, selectively and directly activates PKCε.
  • HY-Y0084
    3,4,5-Trimethoxybenzoic acid

    Eudesmic acid; Trimethylgallic Acid

    Others Others
    3,4,5-Trimethoxybenzoic acid (Eudesmic acid;Trimethylgallic Acid) is a benzoic acid derivative. A building block in medicine and organic synthesis.
  • HY-104015
    NecroX-5

    Calcium Channel Cancer Inflammation/Immunology
    NecroX-5 is a derivative of the NecroX, reduces intracellular calcium concentration, and possesses anti-inflammatory and anti-cancer activity.
  • HY-111641
    3'-Azido-3'-deoxy-5-fluorocytidine

    Nucleoside Antimetabolite/Analog Inflammation/Immunology Infection
    3'-Azido-3'-deoxy-5-fluorocytidine (Compound 12) is a cytidine derivative.
  • HY-133571A
    Aminohexylgeldanamycin hydrochloride

    AHGDM hydrochloride

    HSP ADC Cytotoxin Cancer
    Aminohexylgeldanamycin (AHGDM) hydrochloride, a Geldanamycin derivative, is a potent HSP90 inhibitor. Aminohexylgeldanamycin hydrochloride shows antiangiogenic and antitumor activities.
  • HY-B0735A
    Fenoldopam mesylate

    Fenoldopam methanesulfonate; SKF-82526 mesylate

    Dopamine Receptor Cardiovascular Disease
    Fenoldopam(SKF 82526) mesylate is a drug and synthetic benzazepine derivative which acts as a selective D1 receptor partial agonist.
  • HY-B0098
    Doxazosin

    UK 33274

    Adrenergic Receptor Cardiovascular Disease Endocrinology
    Doxazosin (UK 33274) is a quinazoline-derivative that selectively antagonizes postsynaptic α1-adrenergic receptors.
  • HY-13666
    Levamisole hydrochloride

    (-)-Tetramisole hydrochloride

    Parasite HSV Infection Neurological Disease
    Levamisole ((-)-Tetramisole) hydrochloride is an anthelmintic and immunomodulator belonging to a class of synthetic imidazothiazole derivatives. Levamisole hydrochloride has antiviral effects against HSV.
  • HY-B1800
    Tolonidine

    Others Cardiovascular Disease
    Tolonidine is a derivative of imidazoline. Tolonidine is orally active and has been shown to possess hypotensive and antihypertensive properties.
  • HY-133571
    Aminohexylgeldanamycin

    AHGDM

    HSP ADC Cytotoxin Cancer
    Aminohexylgeldanamycin (AHGDM), a Geldanamycin derivative, is a potent HSP90 inhibitor. Aminohexylgeldanamycin shows antiangiogenic and antitumor activities.
  • HY-N9437
    Betulin diacetate

    Betulin 3,28-diacetate

    HIV Cancer Infection Inflammation/Immunology
    Betulin diacetate, a triterpene and derivative of Betulin, is an anti-AID agent and also possesses anti-cancer activity.
  • HY-101629
    (E)-Crotylbarbital

    Others Neurological Disease
    (E)-Crotylbarbital is the isomer of Crotylbarbital. Crotylbarbital is a barbiturate derivative. It has sedative and hypnotic effects, and can be used for the treatment of insomnia.
  • HY-101577
    NCX899

    Angiotensin-converting Enzyme (ACE) Cardiovascular Disease
    NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity.
  • HY-B0098A
    Doxazosin mesylate

    UK 33274 mesylate

    Adrenergic Receptor Autophagy Mitophagy Cardiovascular Disease Endocrinology Cancer
    Doxazosin mesylate (UK 33274) is a quinazoline-derivative that selectively antagonizes postsynaptic α1-adrenergic receptors.
  • HY-B1399
    3-Methylsalicylic acid

    o-Cresotic acid; Hydroxytoluic acid

    Others Cardiovascular Disease
    3-Methylsalicylic acid is a salicylic acid derivative compound with marked fibrinolytic activity in human plasma by activating its fibrinolytic system.
  • HY-133770
    Seco Rapamycin ethyl ester

    Others Others
    Seco Rapamycin ethyl ester is an open-ring metabolite of Rapamycin derivative. Seco-rapamycin is reported not to affect the mTOR function.
  • HY-113331
    Thromboxane B2

    Others Inflammation/Immunology
    Thromboxane B2 is a prostaglandin derivative that is released during anaphylaxis. Thromboxane B2 induces arterial contraction and platelet aggregation.
  • HY-U00187
    NCX1022

    Others Inflammation/Immunology
    NCX1022 is an NO-releasing derivative of Hydrocortisone, which is the most widely used anti-inflammatory drug for the treatment of skin inflammation.
  • HY-141490
    Beta-D-Glucopyranosyl nitromethane

    Others Others
    Beta-D-Glucopyranosyl nitromethane, as a salt of a strongly basic anion exchanger in the OH cycle, is a glycosyl derivative of nitromethane.
  • HY-13690
    Mitotane

    2,4′-DDD; o,p'-DDD

    Apoptosis Cancer
    Mitotane(2,4′-DDD), an isomer of DDD and derivative of DDT, is an antineoplastic medication used in the treatment of adrenocortical carcinoma.
  • HY-A0163
    Zuclopenthixol

    (Z)-Clopenthixol

    Dopamine Receptor Neurological Disease
    Zuclopenthixol is a thioxanthene derivative which acts as a mixed dopamine D1/D2 receptor antagonist.
  • HY-N6619A
    Lycoramine

    AChE Neurological Disease
    Lycoramine, a dihydro-derivative of galanthamine, is isolated from Lycoris radiate. Lycoramine is a potent acetylcholinesterase (AChE) inhibitor.
  • HY-N6926
    1,3,5-Tricaffeoylquinic acid

    HIV Infection
    1,3,5-Tricaffeoylquinic acid is a tricaffeoylquinic acid derivative isolated from H. populifolium with anti-HIV effect.
  • HY-B1211
    Dehydroacetic acid

    Biocide 470F

    Bacterial Fungal Infection
    Dehydroacetic acid (Biocide 470F), a pyrone derivative acts as an antibacterial and antifungal agent. Dehydroacetic acid possess phytotoxic activity.
  • HY-N2392
    Kukoamine A

    Parasite Infection Cardiovascular Disease
    Kukoamine A is a natural occurring spermine derivative, acts as a potent inhibitor of trypanothione reductase (Ki, 1.8 μM), with antihypertensive activity.
  • HY-N0465
    Olaquindox

    Antibiotic Bacterial Infection
    Olaquindox, a quinoxalin derivative, is an orally active antibiotic. Olaquindox stimulates growth and decreases intestinal mucosal immunity of piglets.
  • HY-N8215
    Achyranthoside C

    Others Metabolic Disease
    Achyranthoside C is a saponin from Achyranthes bidentata. The derivative of Achyranthoside C has inhibitory activity on osteoclast formation.
  • HY-U00142
    A-802715

    Others Cancer
    A802715 is a methylxanthine derivative. A802715 has a TD50 (toxic dose of 50%) of 0.9-1.1 mM.
  • HY-122885
    IU1-248

    Deubiquitinase Cancer
    IU1-248, a derivative of IU1, is a potent and selective USP14 inhibitor with an IC50 of 0.83 μM.
  • HY-133113
    7-Desmethyl-agomelatine

    5-HT Receptor Neurological Disease
    7-Desmethyl-agomelatine is a metabolite of Agomelatine. Agomelatineis a potent agonist at melatonin receptors (MT1 and MT2), and also is an antagonist of 5-HT2C.
  • HY-P1209
    PG106

    Melanocortin Receptor Inflammation/Immunology
    PG106 is a potent and selective human melanocortin 3 (hMC3) receptor antagonist (IC50=210 nM) and has noactivity at hMC4 receptors (EC50=9900 nM) and hMC5 receptor.
  • HY-P1209A
    PG106 TFA

    Melanocortin Receptor Metabolic Disease
    PG106 TFA is a potent and selective human melanocortin 3 (hMC3) receptor antagonist (IC50= 210 nM) and has noactivity at hMC4 receptors (EC50=9900 nM) and hMC5 receptor.
  • HY-34544
    2-Hexylthiophene

    Others Others
    2-Hexylthiophene is an extremely weak basic heteroaromatic compound. 2-Hexylthiophene can be used to modify and improve the molar absorption coefficient of ruthenium sensitizer
  • HY-18256
    Ombrabulin hydrochloride

    AVE8062 hydrochloride; AC7700 hydrochloride

    Microtubule/Tubulin Cancer Cardiovascular Disease
    Ombrabulin hydrochloride is a derivative of CA-4 phosphate, which is known to exhibit antivascular effects through selective disruption of the tubulin cytoskeleton of endothelial cells.
  • HY-N7036
    Rhamnetin

    Phospholipase Inflammation/Immunology
    Rhamnetin is a quercetin derivative found in Coriandrum sativum, inhibits secretory phospholipase A2, with antioxidant and anti-inflammatory activity.
  • HY-N0944
    (-)-Heraclenol

    Others Cancer
    (-)-Heraclenol is a derivative of furocoumarin isolated from Ducrosia anethifolia. (-)-Heraclenol shows antiproliferative and cytotoxic activities on cancer cell lines.
  • HY-14941
    Elacytarabine

    CP 4055

    Others Cancer
    Elacytarabine (CP 4055) is a lipid-conjugated derivative of the nucleoside analog cytarabine. Elacytarabine (CP 4055) is an antineoplastic drug with cytotoxicity in solid tumors.
  • HY-135676
    DHODH-IN-12

    Dihydroorotate Dehydrogenase DNA/RNA Synthesis Inflammation/Immunology
    DHODH-IN-12 (Compound 12b) is a Leflunomide derivative and a weak dihydroorotate dehydrogenase (DHODH) inhibitor with a pKa of 5.07.
  • HY-N0311
    Emodin-8-glucoside

    Others Cancer
    Emodin-8-glucoside is an anthraquinone derivative isolated from Aloe vera, binds to minor groove of DNA.
  • HY-B0997
    Hydroquinidine

    Dihydroquinidine; (+)-Hydroquinidine; Hydroconquinine

    Others Cardiovascular Disease
    Hydroquinidine (Dihydroquinidine) is a derivative of Quinidine (an antiarrhythmic agent). Hydroquinidine prolongs the QT interval and has antiarrhythmic efficacy.
  • HY-106873
    Nepinalone

    Others Others
    Nepinalone, an alchilaminate derivative of β-tetralone and an orally active cough suppressant, possesses a non-opioid antitussive activity.
  • HY-B0585
    Piracetam

    UCB-6215

    iGluR Neurological Disease
    Piracetam (UCB-6215) is a cyclic derivative of the neurotransmitter gamma-aminobutyric acid (GABA), used in treatment of a wide range of cognitive disorders.
  • HY-121877
    Valnoctamide

    Valmethamide

    GABA Receptor Neurological Disease
    Valnoctamide (Valmethamide), a derivative of valproate, suppresses benzodiazepine-refractory status epilepticus. Valnoctamide (Valmethamide) acts directly on GABAA receptors.
  • HY-B1715
    Oxiracetam

    ISF2522

    GABA Receptor Neurological Disease
    Oxiracetam is a cyclic derivative of γ-aminobutyric acid (GABA) which has been commonly used as nootropic drug to treat cognitive impairments.
  • HY-41344
    Ganciclovir mono-O-acetate

    Others Infection
    Ganciclovir mono-O-acetate is a derivative of Ganciclovir. Ganciclovir, a nucleoside analogue, is an orally active antiviral agent with activity against CMV.
  • HY-B2208
    Glycol salicylate

    Others Others
    Glycol salicylate is a derivative of salicylic acid and can be used to improve the aesthetic appearance of the skin, extracted from patent US 20150148320 A1.
  • HY-B0738
    Dithranol

    Anthralin

    DNA/RNA Synthesis Inflammation/Immunology
    Dithranol (Anthralin) is an anthraquinone derivative, with potent anti-psoriatic effects. Dithranol can inhibit DNA replication and repair.
  • HY-135675
    DHODH-IN-11

    Dihydroorotate Dehydrogenase DNA/RNA Synthesis Inflammation/Immunology
    DHODH-IN-11 (Compound 14b) is a Leflunomide derivative and a weak dihydroorotate dehydrogenase (DHODH) inhibitor with a pKa of 5.03.
  • HY-15254
    3-O-(2-Aminoethyl)-25-hydroxyvitamin D3

    25-Hydroxy Vitamin D3 3,3’-Aminopropyl Ether

    VD/VDR Metabolic Disease
    3-O-(2-Aminoethyl)-25-hydroxyvitamin D3 is a Vitamin D3 derivative.
  • HY-77574
    7-xylosyltaxol

    7-Xylosylpaclitaxel; Taxol-7-xyloside

    Microtubule/Tubulin Cancer
    7-xylosyltaxol(Taxol-7-xyloside) is a taxol (Paclitaxel) derivative; Paclitaxel binds to tubulin and inhibits the disassembly of microtubules.
  • HY-A0273
    Propyphenazone

    4-Isopropylantipyrine; Isopropylphenazone

    COX Inflammation/Immunology
    Propyphenazone is a pyrazolone derivative with anti-inflammatory, analgesic and antipyretic activity, Propyphenazone-based analogues as prodrugs and selective cyclooxygenase-2 inhibitors.
  • HY-12807
    FIPI

    5-Fluoro-2-indolyl deschlorohalopemide

    Phospholipase Autophagy Inflammation/Immunology
    FIPI is a derivative of halopemide which potently inhibits both PLD1 and PLD2 with IC50s of 25 nM and 20 nM, respectively.
  • HY-101757
    NO-prednisolone

    NCX-1015

    Interleukin Related Inflammation/Immunology
    NO-prednisolone is a nitric oxide (NO)-releasing derivative of Prednisolone. NO-prednisolone potently stimulates IL-10 production in vivo.
  • HY-U00122
    Antiulcer Agent 1

    Others Inflammation/Immunology
    Antiulcer Agent 1 is a 2-(3,4-dimethoxyphenyl)ethylamine derivative for oral administration at an exploratory stage of new drug development.
  • HY-106873A
    Nepinalone hydrochloride

    Others Others
    Nepinalone hydrochloride, an alchilaminate derivative of β-tetralone and an orally active cough suppressant, possesses a non-opioid antitussive activity.
  • HY-N1408
    trans-Trimethoxyresveratrol

    trans-trismethoxy Resveratrol; E-Resveratrol Trimethyl Ether; Tri-O-methylresveratrol

    Reactive Oxygen Species Inflammation/Immunology Cancer
    Trans-Trimethoxyresveratrol is a derivative of Resveratrol (RSV),and it may be a more potent anti-inflammatory, antiangiogenic and vascular-disrupting agent when compared with resveratrol.
  • HY-N7132
    Menthyl acetate

    L-Menthyl acetate; (-)-Menthyl acetate

    Others Others
    ​Menthyl acetate (L-Menthyl acetate) is a derivative of L-menthol. ​Menthyl acetate is effective to enhance 5-aminolevulinic acid (ALA) skin permeation.
  • HY-119824S
    Trofosfamide-d4

    Bacterial Cancer
    Trofosfamide-d4 is the deuterium labeled Trofosfamide. Trofosfamide is an orally bioavailable oxazaphosphorine derivative with antineoplastic activity.
  • HY-W015818
    2-Benzoxazolinone

    2-Benzoxazolone; 1,3-Benzoxazol-2(3H)-one; 2-Hydroxybenzoxazole

    Parasite Infection
    2-Benzoxazolinone is an anti-leishmanial agent with an LC50 of 40 μg/mL against L. donovani. A building block in chemical synthesis. 1,3-Benzoxazol-2(3H)-one derivatives have antimicrobial activity against a selection of Gram-positive, Gram-negative bacteria and yeasts. Derivatives as anti-quorum sensing agent.
  • HY-126222
    MitoTam bromide, hydrobromide

    Apoptosis Mitochondrial Metabolism Cancer
    MitoTam bromide, hydrobromide, a Tamoxifen derivative, is an electron transport chain (ETC) inhibitor. MitoTam bromide, hydrobromide reduces mitochondrial membrane potential in senescent cells and affects mitochondrial morphology. MitoTam bromide, hydrobromide is an effective anticancer agent, suppresses respiratory complexes (CI-respiration) and disrupts respiratory supercomplexes (SCs) formation in breast cancer cells.
  • HY-N6619
    Lycoramine hydrobromide

    AChE Neurological Disease
    Lycoramine hydrobromide, a dihydro-derivative of galanthamine, is isolated from Lycoris radiate. Lycoramine hydrobromide is a potent acetylcholinesterase (AChE) inhibitor.
  • HY-N4311
    2,3,4,5-Tetracaffeoyl-D-Glucaric acid

    Others Inflammation/Immunology
    2,3,4,5-Tetracaffeoyl-D-Glucaric acid is a caffeoyl-D-glucaric acid derivative isolated from the Genus Gnaphalium.
  • HY-15297
    Vesnarinone

    OPC-8212

    Phosphodiesterase (PDE) HIV Infection
    Vesnarinone is a quinolinone derivative, and its pharmacodynamic effects include inhibition of phosphodiesterase III (PDE3) activity, increases in calcium flux and decreases in potassium flux.
  • HY-N7138
    2-(Phosphonooxy)benzoic acid

    Others Inflammation/Immunology Neurological Disease
    2-(Phosphonooxy)benzoic acid is a non-acetylated salicylic acid derivative which has the potential for inflammatory disease as well as in analgesic therapy.
  • HY-Y0264
    4-Hydroxybenzoic acid

    Endogenous Metabolite Bacterial Infection
    4-Hydroxybenzoic acid, a phenolic derivative of benzoic acid, could inhibit most gram-positive and some gram-negative bacteria, with an IC50 of 160 μg/mL.
  • HY-50723
    3-Methylxanthine

    Endogenous Metabolite Others
    3-Methylxanthine, a xanthine derivative, is a cyclic guanosine monophosphate (GMP) inhibitor, with an IC50 of 920 μM on guinea-pig isolated trachealis muscle.
  • HY-130096
    Ald-Ph-amido-C2-nitrate

    ADC Linker Cancer
    Ald-Ph-amido-C2-nitrate (Example XXIVb) is a thiazolidine derivative, used as a noncleavable ADC linker.
  • HY-135378
    Atorvastatin ethyl ester

    Others Cancer Inflammation/Immunology
    Atorvastatin ethyl ester is a derivative of Atorvastatin and displays strong inhibition of the 9-cis-RA-induced Gal4 reporter activity.
  • HY-75625
    2-Hydroxy-4-methoxybenzoic acid

    4-Methoxysalicylic Acid

    Others Others
    2-Hydroxy-4-methoxybenzoic acid is a derivative of methoxybenzoic. 2-Hydroxy-4-methoxybenzoic is a potential biomarker.
  • HY-N6856
    4-Hydroxycoumarin

    Endogenous Metabolite Bacterial Infection
    4-Hydroxycoumarin, a coumarin derivative, is one of the most versatile heterocyclic scaffolds and is frequently applied in the synthesis of various organic compounds. 4-Hydroxycoumarin possesses both electrophilic and nucleophilic properties. 4-Hydroxycoumarin derivatives are employed as the anticoagulant, antibacterial, antifungal, antiviral, antitumor, antiprotozoal, insecticidal, antimycobacterial, antimutagenic, antioxidant, anti-inflammatory agents, HIV protease inhibitors and tyrosine kinase inhibitors.
  • HY-N1914
    Ergothioneine

    L-(+)-Ergothioneine

    Endogenous Metabolite Others
    Ergothioneine, an imidazole-2-thione derivative of histidine betaine, is synthesized by certain bacteria and fungi. Ergothioneine is generally considered an antioxidant.
  • HY-N1370
    Tanshinone IIA sulfonate sodium

    Sodium Tanshinone IIA sulfonate; Tanshinone IIA sodium sulfonate

    CRAC Channel Cardiovascular Disease Cancer
    Tanshinone IIA sulfonate (sodium) is a derivative of tanshinone IIA, which acts as an inhibitor of store-operated Ca 2+ entry (SOCE), and is used to treat cardiovascular disorders.
  • HY-139078
    Furosine dihydrochloride

    Others Metabolic Disease
    Furosine dihydrochloride, an amino acid derivative, is an important chemical marker of early-stage Maillard reactions. Furosine dihydrochloride is closely related to a variety of diseases such as diabetes.
  • HY-21601
    5'-O-DMT-2'-O-TBDMS-N-Bz-Adenosine

    Nucleoside Antimetabolite/Analog Others
    5'-O-DMT-2'-O-TBDMS-N-Bz-Adenosine is an adenosine derivative and can be used as an intermediate for oligonucleotides synthesis.
  • HY-A0132
    N-Acetyl-D-glucosamine

    N-Acetyl-2-amino-2-deoxy-D-glucose

    Endogenous Metabolite Metabolic Disease
    N-Acetyl-D-Glucosamine (N-Acetyl-2-amino-2-deoxy-D-glucose) is a monosaccharide derivative of glucose.
  • HY-111587
    Ifenprodil glucuronide

    Others Cardiovascular Disease
    Ifenprodil glucuronide is a derivative of Ifenprodil. Ifenprodil is a vasodilator and an inhibitor of platelet aggregation, and Ifenprodil glucuronide has no effect on platelet aggregation and arterial contraction.
  • HY-B2191
    Sodium gualenate

    Guaiazulenesulfonate sodium

    Others Inflammation/Immunology
    Sodium gualenate (Guaiazulenesulfonate sodium) is a hydrophilic derivative of guaiazulene with excellent anti-inflammatory and wound-healing effects mainly used for the treatment of duodenal ulcer, gastric ulcer and gastritis.
  • HY-N2300
    Kuwanon A

    NO Synthase Metabolic Disease Inflammation/Immunology
    Kuwanon A is a flavone derivative isolated from the root barks of the mulberry tree (Morus alba L.); inhibits nitric oxide production with an IC50 of 10.5 μM.
  • HY-15359
    Episilvestrol

    Eukaryotic Initiation Factor (eIF) Autophagy Cancer
    Episilvestrol is a derivative of silvestrol, isolated from the fruits and twigs of Aglaia silvestris, and is a specific eIF4A-targeting translation inhibitor, with antitumor activity.
  • HY-136171
    Antidepressant agent 1

    Others Neurological Disease
    Antidepressant agent 1 is a pyrazidole-halogeno-derivative with antidepressant effects. Antidepressant agent 1 also can be used to increase body temperature.
  • HY-B1336
    Furazolidone

    Bacterial Apoptosis Antibiotic Infection
    Furazolidone is a nitrofuran derivative with antiprotozoal and antibacterial activity, inhibits AML1-ETO transformed cells with IC50 value of 12.7 μM.
  • HY-111928
    5,7-Dimethoxyluteolin

    Dopamine Transporter Neurological Disease
    5,7-Dimethoxyluteolin, a 5,7-dimethylluteolin derivative, is a dopamine transporter (DAT) activator with an EC50 of 3.417 μM.
  • HY-114161
    H-Val-Pro-Pro-OH

    Angiotensin Receptor Metabolic Disease Inflammation/Immunology Endocrinology
    H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM.
  • HY-106541
    Neticonazole

    Fungal Cancer Infection
    Neticonazole is an imidazole derivative and a potent and long-acting antifungal agent. Neticonazole has anti-infection and anti-cancer effects.
  • HY-14797
    Ombrabulin

    AVE8062; AC7700

    Microtubule/Tubulin Cancer Cardiovascular Disease
    Ombrabulin (AVE8062) is a derivative of CA-4 phosphate, which is known to exhibit antivascular effects through selective disruption of the tubulin cytoskeleton of endothelial cells.
  • HY-U00215
    Ro 41-3290

    GABA Receptor Neurological Disease
    Ro 41-3290 is the desethylated derivative of Ro 41-3696, which is a nonbenzodiazepine partial agonist at the benzodiazepine receptor. Ro 41-3290 is an investigational hypnotic.
  • HY-A0176
    Glisoxepide

    Potassium Channel Metabolic Disease Cardiovascular Disease
    Glisoxepide, a sulphonamide derivative, is an orally available nonselective K(ATP) channel blocker, with antihyperglycemic activity and cardiovascular regulation effect.
  • HY-20584
    10-Deacetyl-7-xylosyl paclitaxel

    10-Deacetyl-7-xylosyltaxol; 10-Deacetylpaclitaxel 7-Xyloside; 10-Deacetyltaxol 7-Xyloside

    Microtubule/Tubulin ADC Cytotoxin Cancer
    10-Deacetyl-7-xylosyl paclitaxel is a Paclitaxel (a microtubule stabilizing agent; enhances tubulin polymerization) derivative with improved pharmacological features.
  • HY-128699
    D-Desthiobiotin

    Endogenous Metabolite Others
    D-Desthiobiotin is a biotin derivative used in affinity chromatography and protein chromatography, also can be used for protein and cell labeling, detection and isolation.
  • HY-N6655
    DL-Methionine methylsulfonium chloride

    Others Inflammation/Immunology
    DL-methionine methylsulfonium chloride is a naturally occurring methionine derivative. DL-methionine methylsulfonium chloride protects gastric mucosal from ethanol-induced damage.
  • HY-N6605
    Kaempferol 3-O-β-D-galactopyranoside

    Trifolin

    Others Cancer Cardiovascular Disease
    Kaempferol 3-O-β-D-galactopyranoside (Trifolin) is a derivative of flavonoid, which is isolated from the aerial part of Consolida oliveriana.
  • HY-128365
    Neticonazole hydrochloride

    Fungal Cancer Infection
    Neticonazole hydrochloride is an imidazole derivative and a potent and long-acting antifungal agent. Neticonazole hydrochloride has anti-infection and anti-cancer effects.
  • HY-126222A
    MitoTam iodide, hydriodide

    Apoptosis Mitochondrial Metabolism Cancer
    MitoTam iodide, hydriodide is a Tamoxifen derivative, an electron transport chain (ETC) inhibitor, spreduces mitochondrial membrane potential in senescent cells and affects mitochondrial morphology. MitoTam iodide, hydriodide is an effective anticancer agent, suppresses respiratory complexes (CI-respiration) and disrupts respiratory supercomplexes (SCs) formation in breast cancer cells. MitoTam iodide, hydriodide causes apoptosis.
  • HY-U00124
    Tromantadine

    HSV Infection
    Tromantadine hydrochloride, an Amantadine derivative with antiherpetic activity, inhibits herpes simplex virus type 1 (HSV-1) and HSV-2 replication.
  • HY-119172
    NSC-60339

    Bacterial Cancer Infection Inflammation/Immunology
    NSC-60339, an efflux pump inhibitor and a substrate of AcrAB-TolC, is a polybasic terephthalic acid derivative studied as a potential cancer chemotherapeutic agent.
  • HY-12692
    DO3A tert-Butyl ester

    DO3A tert-butyl; DO3A-t-Bu-ester

    Others Others
    DOTA tert-Butyl ester is a benxyl derivative of the cyclic tosamide; can be nitrated directly; is more convenient to incorporate the nitro group after deprotection lithium aluminum hydride.
  • HY-13538
    Gemcitabine (elaidate)

    CP-4126; CO-101; Gemcitabine 5'-elaidate

    Nucleoside Antimetabolite/Analog Autophagy Apoptosis Cancer
    Gemcitabine elaidate (CP-4126; CO-101) is a lipophilic, unsaturated fatty acid ester derivative of gemcitabine (dFdC), an antimetabolite deoxynucleoside analogue, with potential antineoplastic activity.
  • HY-N7640
    Deoxylimonin

    Others Cancer Inflammation/Immunology
    Desoxylimonin is a triterpenoid compound isolated from grapefruit seed. Desoxylimonin derivatives has better anticancer, analgesic and anti-inflammatory activitythan the lead compound.
  • HY-N2628
    Erigeroside

    Others Metabolic Disease
    Erigeroside is as a derivatives of -glucose extracted from Satureja khuzistanica Jamzad. Erigeroside has good ability of anti-oxidation and scavenging oxidation free radical.
  • HY-Y1055
    Guanine

    DNA/RNA Synthesis Endogenous Metabolite Cancer
    Guanine is one of the fundamental components of nucleic acids (DNA and RNA). Guanine is a purine derivative, consisting of a fused pyrimidine-imidazole ring system with conjugated double bonds.
  • HY-N2055
    Kaempferol 3-O-sophoroside

    Others Inflammation/Immunology
    Kaempferol 3-O-sophoroside, a derivative of Kaempferol, is isolated from the leaves of cultivated mountain ginseng (Panax ginseng) with anti-inflammatory effects.
  • HY-18900
    Nec-4

    RIP kinase Inflammation/Immunology
    Nec-4, a tricyclic derivative, is a potent receptor interacting protein 1 (RIP1) inhibitor, with an IC50 of 2.6 μM, Ki of 0.46 μM.
  • HY-N0089
    Schisandrin B

    γ-Schisandrin; Wuweizisu B

    Autophagy Reactive Oxygen Species Neurological Disease Cancer
    Schisandrin B (γ-Schisandrin) is a dibenzocyclooctadiene derivative isolated from Fructus Schisandrae, has been shown to produce antioxidant effect on rodent liver and heart.
  • HY-B0025
    Voglibose

    Glucosidase Metabolic Disease
    Voglibose is an N-substituted derivative of valiolamine, excellent inhibitory activity against α-glucosidases and its action against hyperglycemia and various disorders caused by hyperglycemia.
  • HY-15417
    ML-7 hydrochloride

    Myosin YAP Cancer
    ML-7 hydrochloride is a naphthalene sulphonamide derivative, potently inhibits MLCK (IC50=300 nM). ML-7 hydrochloride also inhibits YAP/TAZ.
  • HY-B0732
    Itopride hydrochloride

    HSR803

    AChE Dopamine Receptor Neurological Disease
    Itopride hydrochloride (HSR803), a gastroprokinetic Benzamide (HY-Z0283) derivative, is an inhibitor of acetylcholinesterase (AChE) and dopamine D2 receptor.
  • HY-66012
    Proparacaine Hydrochloride

    Proxymetacaine Hydrochloride

    Apoptosis Inflammation/Immunology
    Proparacaine Hydrochloride (Proxymetacaine Hydrochloride) is a derivative of lidocaine (HY-B0185), with immunomodulatory effect and glucocorticomimetic activity. Proparacaine Hydrochloride is developed for the eyes topical anesthesia.
  • HY-W026772
    Fluorene

    Others Others
    Fluorene, a polycyclic aromatic hydrocarbon (PAH), is a precursor to other fluorene compounds. Fluorene and its derivative can be used as a precursor to fluorene-based dyes.
  • HY-18257
    Rolitetracycline

    Bacterial Antibiotic Infection
    Rolitetracycline, a derivative of tetracycline, is a broad-spectrum antibiotic. Rolitetracyclin has a role as a protein synthesis inhibitor, an antiprotozoal drug and a prodrug.
  • HY-101595
    RPH-2823

    Others Others
    RPH-2823, a basic triamterene derivative, induces a dose-dependent decrease in short-circuit current (SCC) and increase in transepithelial electrical resistance.
  • HY-114161A
    H-Val-Pro-Pro-OH TFA

    Angiotensin Receptor Metabolic Disease Inflammation/Immunology Endocrinology
    H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC50 of 9 μM.
  • HY-119850
    Aladorian

    ARM036

    Others Cardiovascular Disease
    Aladorian (ARM036) is a benzothiazepine derivative, with anti-arrhythmia effect. Aladorian is used for the research of heart failure and catecholaminergic polymorphic ventricular tachycardia.
  • HY-U00124B
    Tromantadine hydrochloride

    HSV Infection
    Tromantadine hydrochloride, an Amantadine derivative with antiherpetic activity, inhibits herpes simplex virus type 1 (HSV-1) and HSV-2 replication.
  • HY-U00133
    HSR6071

    Others Inflammation/Immunology
    HSR6071, a pyrazinecarboxamide derivative, is an orally active and potent antiallergic agent. HSR6071 potently inhibits the experimental asthma in rat models.
  • HY-12596
    JNJ-26489112

    Calcium Channel Sodium Channel Potassium Channel Neurological Disease
    JNJ-26489112, a CNS-active agent, exhibits broad-spectrum anticonvulsant activity in rodents against audiogenic, electrically-induced, and chemically-induced seizures. JNJ-26489112 inhibits voltage-gated Na + channels and N-type Ca 2+ channels, and is effective as a K + channel opener. JNJ-26489112 has very weak inhibition of CA-II (IC50=35 μM) and CA-I (18 μM).
  • HY-111075
    MRS2698

    P2Y Receptor Inflammation/Immunology Neurological Disease
    MRS2698 is a potent and highly selective P2Y2 receptor agonist with an EC50 of 8 nM. MRS2698 is >300-fold P2Y2-selective versus the P2Y4 and P2Y6 receptors.
  • HY-130996
    Diacetyl Agrochelin

    ADC Cytotoxin Cancer
    Diacetyl Agrochelin is an acetyl derivative of Agrochelin, which is produced by the fermentation of a marine Agrobacterium sp. Diacetyl Agrochelin has cytotoxic activity in tumor cell lines.
  • HY-112675
    4-Octyl Itaconate

    Keap1-Nrf2 Inflammation/Immunology
    4-Octyl Itaconate is a cell-permeable Itaconate derivative. Itaconate is an anti-inflammatory metabolite that activates Nrf2 via alkylation of KEAP1.
  • HY-100503
    Maytansinoid DM4

    ADC Cytotoxin Cancer
    Maytansinoid DM4 is a thiol-containing maytansine derivative with highly potent cytotoxicity. Maytansinoid DM4 can be used as a cytotoxic moiety of ADC.
  • HY-115460
    AER-271

    Others Neurological Disease Cardiovascular Disease
    AER-271, a phosphonate prodrug derivative of AER-270, is an aquaporin-4 (AQP4) inhibitor for the research of acute ischemic stroke.
  • HY-106817
    Amitivir

    LY 217896

    Influenza Virus Infection
    Amitivir (LY 217896), a thiadiazole derivative, possesses broad antiviral activity against orthomyxo- and paramyxoviruses. Amitivir is effective against influenza A and B viruses.
  • HY-B0163
    Detomidine

    Adrenergic Receptor Neurological Disease Endocrinology
    Detomidine, an imidazole derivative, is a potent α2-adrenergic agonist. Detomidine produces dose-dependent sedative and analgesic effects.
  • HY-N1450
    Aristolochic acid C

    Phospholipase Cancer
    Aristolochic acid C is a derivative of Aristolochic acid. Aristolochic acid is a phospholipase A2 (PLA2) inhibitor, which disrupts cortical microtubule arrays and root growth in Arabidopsis.
  • HY-18715
    Ornidazole (Levo-)

    (S)-Ornidazole; Levornidazole

    Bacterial Parasite Infection
    Ornidazole Levo- is the levo-isomer of Ornidazole. Ornidazole is a 5-nitroimidazole derivative with antiprotozoal and antibacterial properties against anaerobic bacteria. Ornidazole Levo- is the less active isomer.
  • HY-N2487
    5-Hydroxy-7-acetoxyflavone

    Others Cancer
    5-Hydroxy-7-acetoxyflavone, an active natural flavone derivative found in various plant sources, modulates several biological activities.
  • HY-B0556
    Tetrahydrozoline

    Tetryzoline

    Adrenergic Receptor Cardiovascular Disease
    Tetrahydrozoline (Tetryzoline), a derivative of imidazoline, is an α-adrenergic agonist that causes vasoconstriction. Tetrahydrozoline is widely used for the research of nasal congestion and conjunctival congestion.
  • HY-103656
    Tetraphenylporphyrin

    TPP; Tetraphenylporphine; meso-Tetraphenylporphyrin

    Others Cancer
    Tetraphenylporphyrin (TPP) is a symmetrically substituted porphyrin-based heterocyclic compound and used as a structural block for supramolecular synthesis. Tetraphenylporphyrin derivatives can be used for cancer research.
  • HY-17469
    Gimeracil

    Gimestat

    Others Cancer
    Gimeracil, a component of an oral fluoropyrimidine derivative S-1, inhibits DNA DSB repair and is a potent inhibitor of DPYD (dihydropyrimidine dehydrogenase, DPD).
  • HY-14347
    EBE-A22

    Others Cancer
    EBE-A22 is a derivative of PD 153035 which can inhibit ErbB-1-phosphorylation, whereas EBE-A22 is inactive.
  • HY-Y0061
    Oxindole

    Indolin-2-one

    HIV Cancer Infection Endocrinology Metabolic Disease Inflammation/Immunology Neurological Disease
    Oxindole (Indolin-2-one) is an aromatic heterocyclic building block. 2-indolinone derivatives have become lead compounds in the research of kinase inhibitors.
  • HY-N7321A
    (R)-Eucomol

    Bacterial Cancer Infection
    (R)-Eucomol, a flavonoid derivative, displays marginal antibacterial activity. (R)-Eucomol shows cytotoxic activity against KB and P-388 cells.
  • HY-N6821
    2-O-α-D-Glucopyranosyl-L-ascorbic Acid

    Others Cancer
    2-O-α-D-Glucopyranosyl-L-ascorbic Acid is a glucoside derivative of ascorbic acid, shows anti-cancer activity after enzymatic hydrolysis to ascorbic acid.
  • HY-B0556A
    Tetrahydrozoline hydrochloride

    Tetryzoline hydrochloride

    Adrenergic Receptor Cardiovascular Disease Endocrinology
    Tetrahydrozoline hydrochloride (Tetryzoline hydrochloride), a derivative of imidazoline, is an α-adrenergic agonist that causes vasoconstriction. Tetrahydrozoline hydrochloride is widely used for the research of nasal congestion and conjunctival congestion.
  • HY-B1355A
    Oxyphenbutazone

    COX Bacterial Cancer Infection Inflammation/Immunology
    Oxyphenbutazone is a phenylbutazone derivative, with anti-inflammatory effect. Oxyphenbutazone is a non-selective COX inhibitor. Oxyphenbutazone selectively kills non-replicating Mycobaterium tuberculosis.
  • HY-113494
    Stigmastanol

    Others Others
    Stigmastanol is the 6-amino derivative isolated from Hypericum riparium. Hypericum riparium A. Chev. is a Cameroonian medicinal plant belonging to the family Guttiferae.
  • HY-B1137
    Ramifenazone

    Isopropylaminoantipyrine

    Others Inflammation/Immunology
    Ramifenazone (Isopropylaminoantipyrine) is a pyrazole derivative and acts as a non-steroidal anti-inflammatory agent (NSAID). Ramifenazone has analgesic, antipyretic, anti-inflammatory and antimicrobial activities.
  • HY-N4164
    Schinifoline

    Others Cancer
    Schinifoline, a 4-quinolinone derivative isolated from Zanthoxylum schinifolium Sieb, improves radiosensitizing effect, and effects cell cycle and apoptotic-inducing effects in cancer .
  • HY-129467
    Minerval

    2-Hydroxyoleic acid; 2-OHOA

    Apoptosis Cancer
    Minerval (2-Hydroxyoleic acid) is a synthetic oleic acid (OA) derivative that binds to the plasma membrane and alters lipid organization. Minerval has anti-tumor effect.
  • HY-B1328
    Pyridoxine

    Pyridoxol

    Endogenous Metabolite Keap1-Nrf2 Neurological Disease
    Pyridoxine (Pyridoxol) is a pyridine derivative. Pyridoxine exerts antioxidant effects in cell model of Alzheimer's disease via the Nrf-2/HO-1 pathway.
  • HY-B0163A
    Detomidine hydrochloride

    Adrenergic Receptor Neurological Disease Endocrinology
    Detomidine hydrochloride, an imidazole derivative, is a potent α2-adrenergic agonist. Detomidine hydrochloride produces dose-dependent sedative and analgesic effects.
  • HY-122464
    (±)-Jasmonic acid

    Others Others
    (±)-Jasmonic acid is a plant growth regulator and a derivative of α-linolenic acid. (±)-Jasmonic acid decreases chlorophyll levels in green and etiolated barley leaf segments and inhibits elongation of rice seedlings.
  • HY-128808
    cIAP1 ligand 1

    E3 ligase Ligand 12

    Ligand for E3 Ligase Cancer
    cIAP1 ligand 1 is the LCL161 derivative based IAP ligand. cIAP1 ligand 1 can be connected to the ABL ligand for protein by a linker to form SNIPER.
  • HY-19285A
    Sulfaclozine sodium

    Sulfachloropyrazine sodium

    Bacterial Parasite Antibiotic Infection
    Sulfaclozine sodium (Sulfachloropyrazine sodium) is an efficacious sulphonamide derivative with antibacterial and anticoccidial effects. Sulfaclozine sodium is commonly used for the treatment of various poultry diseases (particularly, collibacteriosis, fowl cholera and coccidiosis).
  • HY-B0615
    Moricizine

    Moracizine

    Sodium Channel Cardiovascular Disease
    Moricizine (Moracizine), a phenothiazine derivative, inhibits the rapid inward sodium current (INa) across myocardial cell membranes. Moricizine is an antiarrhythmia agent and has the potential for ventricular tachycardia.
  • HY-N0474
    Tyrosol

    NF-κB Endogenous Metabolite Inflammation/Immunology
    Tyrosol is a derivative of phenethyl alcohol. Tyrosol attenuates pro-inflammatory cytokines from cultured astrocytes and NF-κB activation. Anti-oxidative and anti-inflammatory effects.
  • HY-78884
    Anticancer agent 9

    Others Cancer
    Anticancer agent 9, a glycine derivative, is an anticancer agent. Anticancer agent 9 can inhibit tumor cells viability of myelogenous leukemia and human prostate cancer.
  • HY-N7421
    Smilagenin acetate

    Others Neurological Disease
    Smilagenin acetate is a sapogenin derivative extracted from patent US20030004147A1. Smilagenin acetate increases the expression of acetylcholine m2 receptors and can be used for the research of dementia.
  • HY-129605
    Ferulenol

    Mitochondrial Metabolism Infection
    Ferulenol, a sesquiterpene prenylated coumarin derivative, specifically inhibits succinate ubiquinone reductase at the level of the ubiquinonecycle. Ferulenol shows good antimycobacterial activity and haemorrhagic action.
  • HY-125658
    Biotinyl tyramide

    Others Others
    Biotinyl tyramide is a biotin derivative used for tyramide signal amplification (TSA), as a reagent to amplify both immunohistochemical signals and in situ hybridization protocols.
  • HY-135843
    TH-263

    Others Cancer
    TH-263, a diaryl sulfonamide derivative, is inactive toward both LIMK1 and LIMK2 and thus can be used as negative control for TH-257.
  • HY-B1460
    Sulconazole mononitrate

    (±)-Sulconazole mononitrate

    Fungal Bacterial Infection
    Sulconazole mononitrate ((±)-Sulconazole mononitrate), an imidazole derivative, is a broad-spectrum fungicide. Sulconazole mononitrate can be used for the research of dermatomycoses, pityriasis versicolor, and cutaneous candidiasis.
  • HY-19285
    Sulfaclozine

    Sulfachloropyrazine

    Bacterial Parasite Antibiotic Infection
    Sulfaclozine (Sulfachloropyrazine) is an efficacious sulphonamide derivative with antibacterial and anticoccidial effects. Sulfaclozine is commonly used for the treatment of various poultry diseases (particularly, collibacteriosis, fowl cholera and coccidiosis).
  • HY-131143
    Cadein1

    Apoptosis Cancer
    Cadein1, an isoquinolinium derivative, leads to a G2/M delay and caspase-dependent apoptosis in cancer cells with non- functional p53.
  • HY-138538
    2-Nitrobenzaldehyde Semicarbazone

    Others Others
    2-Nitrobenzaldehyde Semicarbazone is a derivative of Semicarbazide. 2-Nitrobenzaldehyde Semicarbazone can be measured as a metabolite marker to detect the widely banned antibiotic Nitrofurazone.
  • HY-111469
    CPT-157633

    Phosphatase Metabolic Disease
    CPT-157633, a difluoro-phosphonomethyl phenylalanine derivative, and is a PTP1B inhibitor. CPT-157633 prevents binge drinking-induced glucose intolerance.
  • HY-131449
    Terazosin dimer impurity dihydrochloride

    Adrenergic Receptor Others
    Terazosin dimer impurity dihydrochloride, a dimer of Terazosin, is an impurity of Terazosin. Terazosin is a quinazoline derivative and a competitive and orally active α1-adrenoceptor antagonist.
  • HY-19890
    Aminaftone

    Aminaftone; Aminaphthone

    Endothelin Receptor Cardiovascular Disease Endocrinology
    Aminaftone, a derivative of 4-aminobenzoic acid, downregulates endothelin-1 (ET-1) production in vitro by interfering with the transcription of the pre-pro-ET-1 gene.
  • HY-N2233
    Rhapontigenin 3'-O-glucoside

    Others Cancer
    Rhapontigenin 3'-O-glucoside is a derivative of Rhapontigenin. Rhapontigenin is a potent inactivator of human P450 1A1 and is a good candidate for a cancer chemopreventive agent.
  • HY-43521
    Ibrutinib-MPEA

    Others Cancer
    Ibrutinib-MPEA (Compound 20) is ibrutinib derivative. Ibrutinib is a covalent and irreversible inhibitor of Bruton's tyrosine kinase (BTK) that has been used to treat haematological malignancies.
  • HY-13743
    Roquinimex

    Linomide; FCF89; ABR212616

    TNF Receptor Inflammation/Immunology
    Roquinimex (Linomide; PNU212616; ABR212616) is a quinoline derivative immunostimulant which increases NK cell activity and macrophage cytotoxicity; inhibits angiogenesis and reduces the secretion of TNF alpha.
  • HY-13647
    HMN-176

    Polo-like Kinase (PLK) Cancer
    HMN-176 is a stilbene derivative which inhibits mitosis, interfering with polo-like kinase-1 (plk1), without significant effect on tubulin polymerization. 
  • HY-128809
    cIAP1 ligand 2

    E3 ligase Ligand 11

    Ligand for E3 Ligase Cancer
    cIAP1 ligand 2 is the LCL161 derivative based IAP ligand. cIAP1 ligand 2 can be connected to the ABL ligand for protein by a linker to form SNIPER.
  • HY-N0401
    Ligustilide

    Autophagy Apoptosis Cancer Inflammation/Immunology Neurological Disease Cardiovascular Disease
    Ligustilide is is a bioactive phthalide derivative isolated from Angelica sinensis and Chuanxiong. Ligustilide exhibits neuroprotective, anti-cancer, anti-inflammatory, and vasodilator effects.
  • HY-118824A
    N-Feruloylserotonin

    (E/Z)-Moschamine

    Others Cardiovascular Disease
    N-Feruloylserotonin, an antioxidative component and bioactive serotonin derivative, from the Seed of Carthamus tinctorius L., ameliorates atherosclerosis and distensibility of the aortic wall in Kurosawa and Kusanagi-hypercholesterolemic (KHC) rabbits.
  • HY-136189
    UK-59811 hydrochloride

    Calcium Channel Neurological Disease
    UK-59811 hydrochloride, a Br-dihydropyridine derivative, is a potent bacterial homotetrameric model voltage-gated Ca 2+ (CaV) channel CaVAb inhibitor with an IC50 of 194 nM.
  • HY-122705
    RAD51-IN-1

    RAD51 Cancer
    RAD51-IN-1, a derivative of  B02, is a potent inhibitor of RAD51. RAD51-IN-1 can be used for cancer research.
  • HY-20140
    5'-O-DMT-dT

    5'-O-(4,4'-Dimethoxytrityl)thymidine

    DNA/RNA Synthesis Others
    5'-O-DMT-dT (5'-O-(4,4'-Dimethoxytrityl)thymidine) is a nucleoside derivative which can be used in the preparation of oligonucleotides.
  • HY-137474
    Purpurin 18 methyl ester

    Others Cancer
    Purpurin 18 methyl ester, a chlorophyll-a derivative, is a photosensitizer that can be used in photodynamic therapy (PDT). Purpurin 18 methyl ester has photodynamic activity to induce cancer cell death.
  • HY-125999
    EPI-589

    Others Neurological Disease
    EPI-589, a quinone derivative, is a safe and well tolerated oxidoreductase enzyme inhibitor. EPI-589 has the potential for the treatment of amyotrophic lateral sclerosis (ALS).
  • HY-106947
    SY-640

    Endogenous Metabolite Metabolic Disease
    SY-640 is an Acetamide derivative and has potent hepatoprotective effect. SY-640 reduces Propionibacterium acnes and Lipopolysaccharide-induced liver injury in mice.
  • HY-103464
    5'-Fluoroindirubinoxime

    5'-FIO

    FLT3 Cancer
    5'-Fluoroindirubinoxime (5’-FIO, compound 13), an Indirubin (HY-N0117) derivative, is a potent FLT3 inhibitor, with an IC50 of 15 nM.
  • HY-N0598
    Ginsenoside F1

    20(S)-Ginsenoside F1

    Cytochrome P450 Endogenous Metabolite Cancer
    Ginsenoside F1, an enzymatically modified derivative of Ginsenoside Rg1, demonstrates competitive inhibition of CYP3A4 activity and weaker inhibition of CYP2D6 activity.
  • HY-112901
    DC41

    ADC Cytotoxin Cancer
    DC41 is a DC1 derivative. DC1, a simplified analogue of CC-1065, is an antibody conjugate of cytotoxic DNA alkylators for the targeted treatment of cancer.
  • HY-D1024
    Coelenterazine h

    2-Deoxycoelenterazine; CLZN-h

    Others Neurological Disease
    Coelenterazine h is a derivative of Coelenterazine. Coelenterazine h is more sensitive to Ca 2+ than is the native complex, thus providing a valuable tool for measuring small changes in Ca 2+ concentrations.
  • HY-15969
    Sal003

    Phosphatase Apoptosis Cancer
    Sal003 is a potent, specific and cell-permeable inhibitor of the eukaryotic translation initiation factor 2α (eIF2α) phosphatase. Sal003 is a derivative of salubrinal.
  • HY-N1181
    Tamarixetin

    4'-O-Methyl Quercetin

    Endogenous Metabolite Inflammation/Immunology
    Tamarixetin (4'-O-Methyl Quercetin) is a natural flavonoid derivative of quercetin, with anti-oxidative and anti-inflammatory effects. Tamarixetin protects against cardiac hypertrophy.
  • HY-D0885B
    Phosphocreatine disodium

    Disodium creatine phosphate

    Endogenous Metabolite Metabolic Disease
    Phosphocreatine disodium, one of organic compounds known as alpha amino acids and derivatives, is a substrate for the determination of creatine kinase and used to regenerate ATP during skeletal muscle contraction.
  • HY-106369
    HMR 1556

    Potassium Channel Cardiovascular Disease
    HMR 1556, a chromanol derivative, is a potent IKs blocker with IC50s of 10.5 nM and 34 nM in canine and guinea pig left ventricular myocytes, respectively.
  • HY-101605
    Prodipine hydrochloride

    Dipeptidyl Peptidase Cardiovascular Disease
    Prodipine, a diphenyl-phosphonate derivative. The IC50s of Prodipine for purified and plasma Dipeptidyl peptidase IV (DPP IV) from the rabbit are 4.5 μM and 30 μM, respectively.
  • HY-135670A
    β-glycosidase-IN-1

    Others Metabolic Disease
    β-glycosidase-IN-1 (Compound 33) is a piperidine derivative and a β-glycosidase inhibitor. β-glycosidase-IN-1 has hypoglycemic activity.
  • HY-N0425
    Epoxylathyrol

    P-glycoprotein Cancer
    Epoxylathyrol, an epoxylathyrane derivative isolated from the Euphorbia boetica, is a P-glycoprotein (P-gp) inhibitor. Epoxylathyrol is a P-gp-mediated multidrug resistance (MDR) reverser.
  • HY-124498
    Oxantel

    CP-14445

    nAChR Parasite Infection
    Oxantel (CP-14445), a m-oxyphenol derivative of Pyrantel (HY-12641), is a N-subtype AChR agonist. Oxantel is an anthelmintic, with excellent trichuricidal properties.
  • HY-17617
    Nastorazepide

    Z-360

    Cholecystokinin Receptor Cancer Endocrinology
    Nastorazepide (Z-360) is a selective, orally available, 1,5-benzodiazepine-derivative gastrin/cholecystokinin 2 (CCK-2) receptor antagonist with potential antineoplastic activity.
  • HY-N2618
    3-​O-​Acetyloleanolic acid

    Apoptosis Cancer
    3-O-Acetyloleanolic acid (3AOA), an oleanolic acid derivative isolated from the seeds of Vigna sinensis K., induces in cancer and also exhibits anti-angiogenesis activity.
  • HY-W000427
    Ethyl Orsellinate

    Bacterial Cancer Infection
    Ethyl orsellinate is a lichen metabolite and a derivative of lecanoric acid with antiproliferative and antitumour activities. Ethyl Orsellinate is against A. salina for the cytotoxic activity with an LC50 of 495 μM.
  • HY-17393
    Carboplatin

    NSC 241240

    DNA Alkylator/Crosslinker Autophagy DNA/RNA Synthesis Cancer
    Carboplatin (NSC 241240) is a DNA synthesis inhibitor which binds to DNA, inhibits replication and transcription and induces cell death. Carboplatin (NSC 241240) is a derivative of CDDP and a potent anti-cancer agent.
  • HY-19886
    F 16915

    Others Cardiovascular Disease
    F 16915, a Docosahexaenoic Acid (DHA, HY-B2167) derivative, is a potent pro-drug of DHA. F 16915 can prevent heart failure-induced atrial fibrillation.
  • HY-17490
    Oxaceprol

    N-Acetyl-L-hydroxyproline

    Others Inflammation/Immunology
    Oxaceprol (N-Acetyl-L-hydroxyproline), an orally active derivative of L-proline, possesses distinct anti-inflammatory activity. Oxaceprol is usually used for the research of osteoarthritis and rheumatoid arthritis.
  • HY-15435
    CHAPS

    Others Others
    CHAPS, a derivative of Cholic acid, is a zwitterionic detergent for solubilizing membrane proteins. CHAPS is used for stabilization of various protein-DNA complexes and can retain biochemical activity of proteins in solution.
  • HY-103700B
    (Rac)-Azide-phenylalanine

    Others Others
    (Rac)-Azide-phenylalanine is a racemate of Azide-phenylalanine. Azide-phenylalanine is a phenylalanine derivative and a non-natural amino acid. Azide-phenylalanine can be site-specifically incorporated into proteins and used to label proteins.
  • HY-17035
    Doramectin

    Parasite Antibiotic Infection
    Doramectin is a derivative of Ivermectin (HY-15310). Doramectin is a potent antiparasitic antibiotic. Doramectin is an active compound against S.mansoni in an NMRI mouse infection model.
  • HY-13631E
    Deruxtecan

    Drug-Linker Conjugates for ADC Cancer
    Deruxtecan is an ADC drug-linker conjugate composed of a derivative of DX-8951 (DXd) and a maleimide-GGFG peptide linker, used for synthesizing DS-8201 and U3-1402.
  • HY-115524
    DBCO-NHS ester 2

    ADC Linker Cancer
    DBCO-NHS ester 2 is a cleavable linker that is used for making antibody-drug conjugate (ADC). DBCO-NHS ester 2 is a derivative of Dibenzylcyclooctyne (DBCO) used in copper-free click chemistry.
  • HY-122402
    Umirolimus

    Others Inflammation/Immunology
    Umirolimus, a macrocyclic triene lactone Rapamycin derivative, is powerful immunosuppressant and anti-inflammatory agent. Umirolimus has highly lipophilicity and can be used drug-eluting stent (DES) applications.
  • HY-18342
    Diflunisal

    MK-647

    COX Inflammation/Immunology Cancer
    Diflunisal (MK-647) is a salicylate derivative with nonsteroidal anti-inflammatory and uricosuric properties, which is used alone as an analgesic and in rheumatoid arthritis patients. The mechanism of action of diflunisal is as a Cyclooxygenase (COX) Inhibitor.
  • HY-B1198
    Piperonyl butoxide

    ENT-14250

    Parasite Infection
    Piperonyl butoxide is a semisynthetic derivative of safrole,used as a component of pesticide formulations. It is a synergist, despite having no pesticidal activity of its own, it enhances the potency of certain pesticides such as Carbamates, Pyrethrins, Pyrethroids, and Rotenone.
  • HY-N8531
    4α-Methylcholesterol

    Others Others
    4α-Methylcholesterol is a Cholesterol derivative. 4α-Methylcholesterol can oxidize 3-hydroxy steroid, with the apparent Km of 12.6 μM.
  • HY-137553
    β-Aminoarteether

    SM934 free base

    Others Inflammation/Immunology
    β-Aminoarteether (SM934 free base) is an Artemisinin derivative with orally active. β-Aminoarteether can be used for inflammation and autoimmune disease research, such as lupus diseases.
  • HY-B1505
    Acefylline

    Theophyllineacetic acid; Theophylline-7-acetic acid

    Adenosine Receptor Protein Arginine Deiminase Phosphodiesterase (PDE) Cancer
    Acefylline (Theophyllineacetic acid), a xanthine derivative, is an adenosine receptor antagonist. Acefylline is a peptidylarginine deiminase (PAD) activator. Acefylline is also a bronchodilator, which inhibits rat lung cAMP phosphodiesterase isoenzymes.
  • HY-111809
    N6-Ethyladenosine

    Adenosine Receptor Others
    N6-Ethyladenosine is an adenosine derivative, acts as a Adenosine receptor agonist, with Kis of 4.9 and 4.7 nM for hA1AR and hA3AR, respectively.
  • HY-13769A
    TPT-260 Dihydrochloride

    NSC55712; TPU-260 Dihydrochloride

    Others Others
    TPT-260 Dihydrochloride (NSC55712) is a thiophene thiourea derivative with molecule weight 260.00 in free base form; There is no formal name yet, we temporally call this molecule as TPT-260.
  • HY-W067479
    (E)-Cinnamamide

    Others Others
    (E)-Cinnamamide, the less active isomer of Cinnamamide. Cinnamamide, a derivative of the plant secondary compound Cinnamic acid. Cinnamamide is effective as a non-lethal chemical repellent suitable for reducing avian pest damage.
  • HY-N9459
    2-Amino-2-deoxyglucose hydrochloride

    Others Others
    2-Amino-2-deoxyglucose hydrochloride is a hexosamine hydrochloride can be used in the synthesis of cyclopropene-modified hexosamine derivative Ac4GlcNCyoc and Ac4GalNCyoc.
  • HY-N6710
    α-Zearalenol

    Estrogen Receptor/ERR Inflammation/Immunology
    α-Zearalenol is a Mycotoxin with high affinity for the estrogen receptors (ER), α-Zearalenol is the derivative of zearalenone (ZEN), causes reproductive disorders in animals, due to its xenoestrogenic effects.
  • HY-13720A
    Pergolide mesylate

    Pergolide methanesulfonate; LY127809

    Dopamine Receptor Neurological Disease
    Pergolide mesylate (Pergolide methanesulfonate), an Ergoline derivative, is a potent and orally active dopamine D1 and D2 receptors agonist. Pergolide mesylate can be used for Parkinson's disease and hyperprolactinaemia research.
  • HY-N3550
    Catalponol

    Others Cancer
    Catalponol is a naphthoquinone derivative. Catalponol enhances dopamine biosynthesis by inducing tyrosine hydroxylase activity. Catalponol also increases the levels of cAMP and tyrosine hydroxylase phosphorylation in PC12 cells.
  • HY-138594
    5'-O-TBDMS-N2-ibu-dG

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Cancer Infection
    5'-O-TBDMS-N2-ibu-dG is a nucleoside derivative and can be used for lead compounds synthesis with anti-bovine viral diarrhea virus activity.
  • HY-N7113
    Squalane

    Others Cancer
    Squalane, found in certain fish oils (especially shark liver oil), and some vegetable oils, is a saturated derivative of Squalene. Squalane shows anticancer, antioxidant, skin hydrating, and emollient activities.
  • HY-78695
    JQ-1 (carboxylic acid)

    Epigenetic Reader Domain Cancer
    JQ-1 carboxylic acid is a (+)-JQ1 derivative (a BET bromodomain inhibitor). JQ-1 carboxylic acid can be used as a precursor to synthesize PROTACs, which targets BET bromodomains.
  • HY-N4127
    3'-Demethylnobiletin

    Others Cancer
    3'-Demethylnobiletin, a derivative of Nobiletin, is a polymethoxyflavonoid in citrus fruits. Nobiletin exhibits anticancer activity and inhibits tumor angiogenesis by regulating Src, FAK, and STAT3 signaling.
  • HY-B0068
    Azasetron hydrochloride

    Y-25130 hydrochloride

    5-HT Receptor Neurological Disease
    Azasetron (Y-25130) hydrochloride, a benzamide derivative, is a potent and selective 5-HT3 receptor antagonist. Azasetron is used in the study for Chemotherapy-induced nausea and vomiting (CINV).
  • HY-111945
    Cys modifier 1

    Others Others
    Cys modifier 1 (compound 7) is a cysteine-selective protein modifier for protein bioconjugation. A fluorescent carbonylacrylic derivative bearing nitrobenzofurazan (λex=465nm and λem539 nm)[1].
  • HY-W015820
    Phthalide

    Others Inflammation/Immunology
    Phthalide is a promising chemical scaffold with a potent anti-inflammatory efficacy. Phthalide can be used to synthesize a variety of phthalide derivatives including anti-inflammatory agent, antimicrobial, antioxidant.
  • HY-131039
    MDNI-caged-L-glutamate

    MDNI-glu

    Others Others
    MDNI-caged-L-glutamate (MDNI-glu) is a biologically inert, photosensitive derivative of the major excitatory amino acid, L-glutamate. MDNI-caged-L-glutamate makes more efficient use of incident light.
  • HY-N7650
    Dihydroseselin

    Others Others
    Dihydroseselin is a derivative of 7-hydroxycoumarin (HY-N0573). 7-hydroxycoumarin, a natural product of the coumarin family, is a fluorescing compound which can be used as a sunscreen agent
  • HY-N0336
    3-Butylidenephthalide

    Butylidenephthalide

    Parasite Infection
    3-Butylidenephthalide (Butylidenephthalide) is a phthalic anhydride derivative identified in Ligusticum chuanxiong Hort, and has larvicidal activity (LC50 of 1.56 mg/g for Spodoptera litura larvae).
  • HY-N0872
    Isosteviol

    (-)-Isosteviol; iso-Steviol

    Reactive Oxygen Species Topoisomerase Cardiovascular Disease Cancer
    Isosteviol ((-)-Isosteviol) is a derivative of Stevioside through acid catalyzed hydrolysis of Stevioside. Isosteviol inhibits DNA polymerase and DNA topoisomerase and has antibacterial, anticancer and anti-tuberculosis effects.
  • HY-111859
    SNIPER(ABL)-058

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-058, conjugating Imatinib (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 10 μM.
  • HY-108637
    PhiKan 083

    MDM-2/p53 Cancer
    PhiKan 083 is a carbazole derivative, which binds to the surface cavity and stabilizes Y220C (a p53 mutant), with a Kd of 167 μM. PhiKan 083 can be used for cancer research.
  • HY-13071
    Nestoron

    ST-1435; Elcometrine

    Progesterone Receptor Endocrinology
    Nestoron (ST-1435) is a 19-norprogesterone derivative with high affinity and selectivity for progesterone receptors. Nestoron is a highly selective and potent progestogen that can be used as a hormonal contraceptive.
  • HY-17587
    4-Methylbenzylidene camphor

    4-MBC; Enzacamene

    AChE Others
    4-Methylbenzylidene camphor(4-MBC; Enzacamene)is an organic camphor derivative that is used in the cosmetic industry for its ability to protect the skin against UV, specifically UV B radiation.
  • HY-B0098S
    Doxazosin D8

    UK 33274 D8

    Adrenergic Receptor Endocrinology Cardiovascular Disease
    Doxazosin D8 (UK 33274 D8) is a deuterium labeled Doxazosin (UK 33274). Doxazosin is a quinazoline-derivative that selectively antagonizes postsynaptic α1 adrenergic receptors.
  • HY-120508
    Pivanex

    AN-9; Pivalyloxymethyl butyrate

    HDAC Bcr-Abl Apoptosis Cancer Inflammation/Immunology
    Pivanex (AN-9), a derivative of Butyric acid, is an orally active HDAC inhibitor. Pivanex down-regulates bcr-abl protein and enhances apoptosis. Pivanex has antimetastic and antiangiogenic properties.
  • HY-N7347
    (-)-Hydroxycitric acid lactone

    Garcinia lactone

    ATP Citrate Lyase Metabolic Disease
    (-)-Hydroxycitric acid lactone (Garcinia lactone) is an anti-obesity agent and a popular weight loss food supplement. (-)-Hydroxycitric acid lactone is a potent inhibitor of ATP-citrate lyase. (-)-Hydroxycitric acid lactone catalyzes the extramitochondrial cleavage of citrate to oxaloacetate and acetyl-CoA, limits the availability of acetyl-CoA units required for fatty acid synthesis.
  • HY-A0176S
    Glisoxepid-d4

    Potassium Channel Metabolic Disease Cardiovascular Disease
    Glisoxepid-d4 is the deuterium labeled Glisoxepide. Glisoxepide, a sulphonamide derivative, is an orally available nonselective K(ATP) channel blocker, with antihyperglycemic activity and cardiovascular regulation effect.
  • HY-N0139
    Troxerutin

    Trihydroxyethylrutin

    NOD-like Receptor (NLR) Cancer Metabolic Disease Inflammation/Immunology Neurological Disease
    Troxerutin, also known as vitamin P4, is a tri-hydroxyethylated derivative of natural bioflavonoid rutins which can inhibit the production of reactive oxygen species (ROS) and depress ER stress-mediated NOD activation.
  • HY-Y1129
    3-Hydroxypyridine

    Others Others
    3-Hydroxypyridine is isolated from Bamboo grass. 3-Hydroxypyridine derivatives are structural analogues of vitamin B6 and have a wide range of pharmacological properties, such as antioxidant properties.
  • HY-135376
    Atorvastatin methyl ester

    Others Metabolic Disease
    Atorvastatin methyl ester (Compound 2a) is a methyl esterified derivative of Atorvastatin. Atorvastatin methyl ester inhibits the 9-cis-RA-induced Gal4 reporter activity more strongly than Atorvastatin.
  • HY-42034
    Hydroquinine

    Others Inflammation/Immunology
    Hydroquinine is a cinchona alkaloid, can be used in the preparation of its derivatives such as C9 epihydroquinine, 9-acetoxy-10,11-dihydroquinine and 10,11-dihydroquinine monohydrochloride.
  • HY-B1036
    Decoquinate

    Parasite Infection
    Decoquinate is a quinolone derivative that can be used for research of coccidiosis in domestic ruminants. Decoquinate also has potent activity against both Plasmodium hepatic development and red cell replication.
  • HY-W003607
    3-O-Ethyl-L-ascorbic acid

    Tyrosinase Others
    3-O-Ethyl-L-ascorbic acid, a stable vitamin C derivative, is a cosmetic tyrosinase tnhibitor with a whitening capacity. 3-O-Ethyl-L-ascorbic acid also has antioxidant abilities.
  • HY-N8115
    S-(4-Hydroxybenzyl)glutathione

    Others Neurological Disease
    S-(4-Hydroxybenzyl)glutathione is a glutathione derivative. S-(4-Hydroxybenzyl)glutathione inhibits the in vitro binding of kainic acid to brain glutamate receptors, with an IC50 of 2 μM.
  • HY-111861
    SNIPER(ABL)-024

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-024, conjugating GNF5 (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 5μM.
  • HY-N1933
    Allocryptopine

    Potassium Channel Cardiovascular Disease
    Allocryptopine, a derivative of tetrahydropalmatine, is extracted from Corydalis decumbens (Thunb.) Pers. Papaveraceae. Allocryptopine has antiarrhythmic effects and potently blocks human ether-a-go-go related gene (hERG) current.
  • HY-B1386
    Halazone

    Bacterial Carbonic Anhydrase Sodium Channel Infection
    Halazone is an atypical antimicrobial sulfonamide derivative and a carbonic anhydrase II inhibitor with a Kd value of 1.45 µM. Halazone protects sodium channels from inactivation. Halazone is widely used for disinfection of drinking water.
  • HY-W008449
    1-Methylxanthine

    Endogenous Metabolite Cancer
    1-Methylxanthine, a caffeine derivative, is an essential human urinary metabolite of caffeine and theophylline (1,3-dimethylxanthine, TP). 1-Methylxanthine enhances the radiosensitivity of tumor cells.
  • HY-B0643
    Dirithromycin

    LY237216

    Bacterial Antibiotic Infection
    Dirithromycin (LY237216), a derivative of Erythromycin, is a potent and orally active semi-synthetic macrolide antibiotic. Dirithromycin is active against gram-positive bacteria, Legionella spp., Helicobacter pylori, and Chlamydia trachomatis.
  • HY-10957
    L-692429

    MK-0751

    GHSR Metabolic Disease
    L-692429 (MK-0751) is a benzolactam derivative and a nonpeptidyl growth hormone secretagogue (GHS) agonist. L-692429 binds to G protein-coupled receptor with a Ki of 63 nM.
  • HY-W015514
    N-(3-Aminopropyl)cyclohexylamine

    Others Neurological Disease
    N-(3-Aminopropyl)cyclohexylamine, a cyclohexylamine derivative, acts as a selective and competitive inhibitor of spermidine synthase. N-(3-Aminopropyl)cyclohexylamine can be used for the research of neurological diseases.
  • HY-13244
    Disufenton sodium

    NXY-059

    Reactive Oxygen Species Neurological Disease
    Disufenton sodium (NXY-059) is the disulfonyl derivative of the neuroprotective spin trap phenylbutynitrone(PBN), both NXY-059, its parent PBN and their hydrolysis/oxidation product MNT are very powerful scavengers of free radicals.
  • HY-D0885
    Phosphocreatine

    Creatine phosphate; Creatinephosphoric acid

    Endogenous Metabolite Metabolic Disease
    Phosphocreatine, primarily found in the skeletal muscles of vertebrates and one of organic compounds known as alpha amino acids and derivatives, is a substrate for the determination of creatine kinase and used to regenerate ATP during skeletal muscle contraction..
  • HY-77572
    7-Epi 10-desacetyl paclitaxel

    7-epi-10-deacetyltaxol; 10-Deacetyl-7-epipaclitaxel

    Others Cancer
    7-Epi 10-desacetyl paclitaxel (7-epi-10-deacetyltaxol), a taxol derivative, exhibits cytotoxicity against HeLa cells with an IC50 of 85 μM.
  • HY-W014081
    Ethyl 3-coumarincarboxylate

    Ethyl 2-oxo-2H-chromene-3-carboxylate

    Others Others
    Ethyl 3-coumarincarboxylate is a coumarin derivative. Ethyl 3-coumarincarboxylate can be used as a pseudo-template to give a molecularly imprinted polymer (MIP) that has a fairly specific recognition capability for aflatoxins.
  • HY-13769
    TPT-260

    TPU260

    Others Neurological Disease
    TPT-260(TPU260) is a thiophene thiourea derivative with molecule weight 260.00 in free base form; There is no formal name yet, we temporally call this molecule as TPT-260.
  • HY-N6612
    D-Glucuronic acid

    Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    D-Glucuronic acid is an important intermediate isolated from many gums. D-Glucuronic acid and its derivative glucuronolactone are as a liver antidote in the prophylaxis of human health. D-Glucuronic acid has an anti-inflammatory effect for the skin.
  • HY-W015343
    3-Methoxyphenylacetic acid

    m-Methoxyphenylacetic acid

    Others Others
    3-Methoxyphenylacetic acid (m-Methoxyphenylacetic acid), a m-hydroxyphenylacetic acid (m-OHPAA) derivative, is a phytotoxin in Rhizoctonia solani. 3-Methoxyphenylacetic acid is used to develop a toxin-mediated bioassay for resistance to rhizoctonia root rot.
  • HY-12516
    Desogestrel

    Org-2969

    Progesterone Receptor Others
    Desogestrel(Org-2969) is a third-generation 19-nortestosterone derivative progestogen; is contained in many oral contraceptive preparations, both combined (COCs) to ethinyl-estradiol (EE) or alone in a progestin-only pill (POP).
  • HY-B1124A
    Fipexide hydrochloride

    Adenylate Cyclase Dopamine Transporter Neurological Disease
    Fipexide hydrochloride, a parachloro-phenossiacetic acid derivative, is a nootropic drug. Fipexide hydrochloride reduces striatal adenylate cyclase activity. Fipexide hydrochloride has positive effect on cognitive performance by dopaminergic neurotransmission. Fipexide hydrochloride is used for senile dementia research.
  • HY-N4102
    5,7-Dihydroxy-4-methylcoumarin

    Fungal Bacterial Infection
    5,7-Dihydroxy-4-methylcoumarin is a coumarin derivative from Mexican tarragon. 5,7-Dihydroxy-4-methylcoumarin possesses antifungal and antibacterial activities.
  • HY-B1124
    Fipexide

    Adenylate Cyclase Dopamine Transporter Neurological Disease
    Fipexide, a parachloro-phenossiacetic acid derivative, is a nootropic drug. Fipexide reduces striatal adenylate cyclase activity. Fipexide has positive effect on cognitive performance by dopaminergic neurotransmission. Fipexide is used for senile dementia research.
  • HY-N4288
    4-Methylesculetin

    Glutathione Peroxidase Inflammation/Immunology Cancer
    4-Methylesculetin is an orally active natural coumarin derivative, with potent anti-oxidant and anti-inflammatory activities. 4-Methylesculetin inhibits myeloperoxidase activity and reduces IL-6 level.
  • HY-123937
    THAL-SNS-032

    PROTAC and Building Blocks CDK Cancer
    THAL-SNS-032 is a selective CDK9 degrader PROTAC consisting of a CDK-binding SNS-032 ligand linked to a thalidomide derivative that binds the E3 ubiquitin ligase Cereblon (CRBN).
  • HY-137473
    Methyl pyropheophorbide-a

    Pyropheophorbide-a methyl ester

    Apoptosis Cancer
    Methyl pyropheophorbide-a (Pyropheophorbide-a methyl ester), a chlorophyll-a derivative, is a potent photosensitizer that can be used in photodynamic therapy (PDT) of cancer. Methyl pyropheophorbide-a has photodynamic activity and can induce apoptosis and inhibit tumor growth.
  • HY-15067
    DNQX

    FG 9041

    iGluR Cancer
    DNQX (FG 9041), a quinoxaline derivative, is a selective, potent competitive non-NMDA glutamate receptor antagonist (IC50s = 0.5, 2 and 40 μM for AMPA, kainate and NMDA receptors, respectively).
  • HY-N0682
    Pyridoxine hydrochloride

    Pyridoxol hydrochloride; Vitamin B6 hydrochloride

    Endogenous Metabolite Keap1-Nrf2 Neurological Disease
    Pyridoxine hydrochloride (Pyridoxol; Vitamin B6) is a pyridine derivative. Pyridoxine (Pyridoxol; Vitamin B6) exerts antioxidant effects in cell model of Alzheimer's disease via the Nrf-2/HO-1 pathway.
  • HY-125759
    3-Phenyltoxoflavin

    HSP Cancer
    3-Phenyltoxoflavin, a derivative of Toxoflavin, is an Hsp90 inhibitor, with a Kd of 585 nM for the interaction of Hsp90-TPR2A. 3-Phenyltoxoflavin has anti-cancer activity.
  • HY-18006
    NKP608

    Neurokinin Receptor Neurological Disease Endocrinology
    NKP608 is a non-peptidic derivative of 4-aminopiperidine which acts as a selective, specific and potent antagonist at the neurokinin-1 (NK-1) receptor both in vitro(IC50=2.6 nM) and in vivo.
  • HY-136660
    PQR626

    mTOR Neurological Disease
    PQR626, a rapamycin derivative, is a potent, selective, orally active, and brain-penetrant mTOR inhibitor, with an IC50 and Ki of 5 nM and 3.6 nM, respectively. PQR626 can be can be used for the research of neurological disorders.
  • HY-135335
    3'-Hydroxy Repaglinide

    Drug Metabolite Metabolic Disease
    3'-Hydroxy Repaglinide is a main CYP2C8 metabolite of Repaglinide. Repaglinide is a carbamoylmethyl benzoic acid (CMBA) derivative, which recently has become available for the treatment of type II diabetes.
  • HY-12424
    Zotarolimus

    ABT-578; A 179578

    Others Cancer Cardiovascular Disease
    Zotarolimus (ABT-578) is a derivative of rapamycin (HY-10219), with anti-proliferative activity. Zotarolimus is an immunosuppressant. Zotarolimus is developed specifically for local delivery from stents for the prevention of coronary artery restenosis.
  • HY-P2292
    Omiganan-FITC

    Bacterial Fungal Infection
    Omiganan-FITC is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines.
  • HY-D0885C
    Phosphocreatine dipotassium

    Creatine phosphate (dipotassium); Creatinephosphoric acid (dipotassium)

    Endogenous Metabolite Metabolic Disease
    Phosphocreatine dipotassium, primarily found in the skeletal muscles of vertebrates and one of organic compounds known as alpha amino acids and derivatives, is a substrate for the determination of creatine kinase and used to regenerate ATP during skeletal muscle contraction.
  • HY-B0293A
    Butoconazole

    Fungal Infection
    Butoconazole, an imidazole antifungal agent, is active against Candida spp. and effective against vaginal infections due to Candida albicans. Butoconazole is presumed to function as other imidazole derivatives via inhibition of steroid synthesis.
  • HY-N3845
    Ergosterol peroxide

    Bacterial Cancer Inflammation/Immunology
    Ergosterol peroxide is a steroid derivative and can be isolated from a variety of fungi, yeast, lichens or sponges. Ergosterol peroxide has anti-tumour, proapoptotic, anti-inflammatory, anti-mycobacterial, and anti-proliferative activities.
  • HY-P3204
    POT-4

    AL-78898A

    Complement System Metabolic Disease
    POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
  • HY-14276A
    Gallopamil hydrochloride

    Methoxyverapamil hydrochloride

    Calcium Channel Cardiovascular Disease
    Gallopamil hydrochloride (Methoxyverapamil hydrochloride), a methoxy derivative of Verapamil, is a phenylalkylamine calcium antagonist. Gallopamil hydrochloride inhibits acid secretion in a concentration-dependent manner with an IC50 of 10.9 μM. Gallopamil hydrochloride is a potent antiarrhythmic and vasodilator agent.
  • HY-W011053
    Neotame

    Others Others
    Neotame is a derivative of Aspartame and is a low-caloric and high-intensity artificial sweetener that is 7000-13,000 times sweeter than sugar. Neotame is a non-nutritive sweetener and flavor enhancer that can be used in a variety of foods.
  • HY-14276
    Gallopamil

    Methoxyverapamil

    Calcium Channel Cardiovascular Disease
    Gallopamil (Methoxyverapamil), a methoxy derivative of Verapamil, is a phenylalkylamine calcium antagonist. Gallopamil inhibits acid secretion in a concentration-dependent manner with an IC50 of 10.9 μM. Gallopamil is a potent antiarrhythmic and vasodilator agent.
  • HY-121877S
    Valnoctamide-d5

    GABA Receptor Neurological Disease
    Valnoctamide-d5 (Valmethamide-d5) is the deuterium labeled Valnoctamide. Valnoctamide (Valmethamide), a derivative of valproate, suppresses benzodiazepine-refractory status epilepticus. Valnoctamide (Valmethamide) acts directly on GABAA receptors.
  • HY-B2224
    Thiamine disulfide

    HIV Endogenous Metabolite Infection Metabolic Disease
    Thiamine disulfide, a vitamin B1 derivative, is an oxidized dimer of Thiamine. Thiamine disulfide is a potent HIV-1 inhibitor. Thiamine disulfide significantly depresses HIV-1 transactivator (Tat) activity.
  • HY-108637A
    PhiKan 083 hydrochloride

    MDM-2/p53 Cancer
    PhiKan 083 hydrochloride is a carbazole derivative, which binds to the surface cavity and stabilizes Y220C (a p53 mutant), with a Kd of 167 μM, and a relative binding affinity (Kd) of 150 μM in Ln229 cells.
  • HY-105240
    Delparantag

    PMX-60056

    Factor Xa Cardiovascular Disease
    Delparantag (PMX-60056) is a salicylamide derivative and an effective unfractionated heparin (UFH) and low molecular weight heparin (LMWH) reversing agent. Delparantag shows ability to neutralize the anticoagulation and bleeding effects of UFH and LMWH.
  • HY-103233
    DNQX disodium salt

    FG 9041 disodium salt

    iGluR Cancer
    DNQX (FG 9041) disodium salt, a quinoxaline derivative, is a selective, potent competitive non-NMDA glutamate receptor antagonist (IC50s = 0.5, 2 and 40 μM for AMPA, kainate and NMDA receptors, respectively).
  • HY-131343
    HBV-IN-4

    HBV DNA/RNA Synthesis Infection
    HBV-IN-4, a phthalazinone derivative, is a potent and orally active HBV DNA replication inhibitor with an IC50 of 14 nM. HBV-IN-4 induces the formation of genome-free capsids and has potent anti-HBV potencies.
  • HY-D0885A
    Sodium creatine phosphate dibasic tetrahydrate

    Creatine phosphate disodium tetrahydrate; Creatinephosphoric acid disodium tetrahydrate

    Endogenous Metabolite Metabolic Disease
    Phosphocreatine disodium tetrahydrate, primarily found in the skeletal muscles of vertebrates and one of organic compounds known as alpha amino acids and derivatives, is a substrate for the determination of creatine kinase and used to regenerate ATP during skeletal muscle contraction.
  • HY-N1965
    Gaultherin

    Others Inflammation/Immunology
    Gaultherin, a natural salicylate derivative, is isolated from Gaultheria yunnanensis. Gaultherin is a non-steroidal anti-inflammatory drug (NSAID). Gaultherin has analgesic and anti-inflammatory effects and lack gastric ulcerogenic effect compared to Aspirin.
  • HY-B0283
    Acipimox

    K-9321

    Others Metabolic Disease
    Acipimox (K-9321), a nicotinic acid analogue, is an antilipolytic compound. Acipimox acutely inhibits lipolysis and suppresses systemic levels of free fatty acids (FFAs) and improves insulin sensitivity.
  • HY-B1210
    Pipemidic acid

    Bacterial Antibiotic Infection
    Pipemidic acid, a derivative of Piromidic acid, is an antibacterial agent. Pipemidic acid is active against gram-negative bacteria including Pseudomonas aeruginosa as well as some gram-positive bacteria. Pipemidic acid can be used for the research of intestinal, urinary, and biliary tract infections.
  • HY-17450A
    Aplaviroc hydrochloride

    AK602 hydrochloride; GSK-873140 hydrochloride; GW-873140 hydrochloride

    CCR HIV Infection
    Aplaviroc (AK 602) hydrochloride, a SDP derivative, is a CCR5 antagonist, with IC50s of 0.1-0.4 nM for HIV-1Ba-L, HIV-1JRFL and HIV-1MOKW.
  • HY-125466
    cRIPGBM

    RIP kinase Apoptosis Cancer
    cRIPGBM, a proapoptotic derivative of RIPGBM, a cell type-selective inducer of apoptosis in GBM cancer stem cells (CSCs) by binding to receptor-interacting protein kinase 2 (RIPK2), with an EC50 of 68 nM in GBM-1 cells.
  • HY-B0128
    Diphylline

    Diprophylline

    Adenosine Receptor Phosphodiesterase (PDE) Inflammation/Immunology Cardiovascular Disease
    Diphylline (Diprophylline) is a potent A1/A2 adenosine receptor antagonist and cyclic nucleotide phosphodiesterase inhibitor. Diphylline, a xanthine derivative, is a bronchodilator and vasodilator drug and has the potential for chronic bronchitis and emphysema.
  • HY-113949A
    Methyl 2,3-O-Isopropylidene-β-L-ribofuranoside

    Others Others
    Methyl 2,3-O-Isopropylidene-β-L-ribofuranoside is an enantiomer of Methyl 2,3-O-Isopropylidene-β-D-ribofuranoside. Methyl 2,3-O-Isopropylidene-β-L-ribofuranoside is a derivative of L-ribose.
  • HY-N1082
    Visnagin

    Others Inflammation/Immunology Neurological Disease Cardiovascular Disease
    Visnagin, an antioxidant furanocoumarin derivative, possess anti-inflammatory and analgesic properties. Visnagin has substantial potential to prevent Cerulein induced acute pancreatitis (AP). Visnagin possess promising vasodilator effects in vascular smooth muscles.
  • HY-17450
    Aplaviroc

    AK 602; GSK 873140; GW 873140

    CCR HIV Infection Endocrinology
    Aplaviroc (AK 602), a SDP derivative, is a CCR5 antagonist, with IC50s of 0.1-0.4 nM for HIV-1Ba-L, HIV-1JRFL and HIV-1MOKW.
  • HY-B0319
    Tioconazole

    UK-20349

    Fungal Antibiotic Infection
    Tioconazole (UK-20349) is an antifungal imidazole derivative with broad spectrum activity. Tioconazole has inhibitory active aginst several dermatophytes and several yeasts with MIC50s <3.12 mg/L and <9 mg/L, respectively.
  • HY-B0358A
    Flunarizine dihydrochloride

    Calcium Channel Sodium Channel Dopamine Receptor Neurological Disease
    Flunarizine dihydrochloride is a potent dual Na +/Ca 2+ channel (T-type) blocker. Flunarizine dihydrochloride is a D2 dopamine receptor antagonist. Flunarizine dihydrochloride, a diphenylpiperazine derivative, has the potential for peripheral vessels dilator and migraine prophylaxis.
  • HY-B1796
    Thymol iodide

    Fungal Infection
    Thymol iodide is a compound of Iodide and Thymol. Thymol iodide acts as a substitute for iodoform. Thymol iodide is an iodine derivative of Thymol (a phenol derived from thyme oil), which is mostly used as mild antiseptic and fungicide.
  • HY-N6740
    Beta-Zearalanol

    Apoptosis Metabolic Disease
    Beta-Zearalenol is an mycotoxin produced by Fusarium spp, which causes apoptosis and oxidative stress in mammalian reproductive cells. Beta-Zearalenol is the derivative of zearalenone (ZEA) which can conjugate with glucuronic acid.
  • HY-N0301
    Thiocolchicoside

    GABA Receptor Inflammation/Immunology Neurological Disease
    Thiocolchicoside is a competitive γ-aminobutyric acid type A (GABAA) receptor antagonist and glycine receptor agonist in the central nervous system. Thiocolchicoside is a semisynthetic sulfur derivative of colchicoside. Thiocolchicoside is a muscle relaxant and has anti-inflammatory, and analgesic properties.
  • HY-14737
    Ceftaroline fosamil

    TAK-599; PPI0903

    Bacterial Antibiotic Infection
    Ceftaroline fosamil (TAK-599), a cephalosporin derivative, is an N-phosphono prodrug of anti-methicillin-resistant Staphylococcus aureus (MRSA) T-91825. Ceftaroline fosamil can be used for the research of MRSA infection.
  • HY-111871
    SNIPER(ABL)-033

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-033, conjugating HG-7-85-01 (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 0.3 μM.
  • HY-130841
    Apcin-A

    APC Ligand for Target Protein for PROTAC Cancer
    Apcin-A, an Apcin derivative, is an anaphase-promoting complex (APC) inhibitor. Apcin-A interacts strongly with Cdc20, and inhibits the ubiquitination of Cdc20 substrates. Apcin-A can be used to synthesize the PROTAC CP5V (HY-130257).
  • HY-135808
    BIZ 114

    NF-κB Inflammation/Immunology
    BIZ 114 (Example 11) is a fatty acid derivative and potent inhibits the TNF-α activated NF-κΒ pathway. BIZ 114 has the potential to prevent and / or treat ophthalmic disorders such as retinal degenerative disorders and ocular inflammatory diseases.
  • HY-100937
    DPCPX

    PD 116948

    Adenosine Receptor Cardiovascular Disease
    DPCPX (PD 116948), a xanthine derivative, is a highly potent and selective Adenosine A1 receptor antagonist, with a Ki of 0.46 nM in 3H-CHA binding to A1 receptors in rat whole brain membranes.
  • HY-13249
    1alpha-Hydroxy VD4

    1α-Hydroxy vitamin D4

    VD/VDR Cancer
    1alpha-Hydroxy VD4 , a 1alpha(OH)D derivative, can effectively induce the differentiation of monoblastic leukaemia U937, P39/TSU and P31/FUJ cells.
  • HY-13744
    Rubitecan

    RFS 2000; 9-Nitrocamptothecin

    Topoisomerase Cancer
    Rubitecan (RFS 2000), a Camptothecin derivative, is an orally active topoisomerase I inhibitor with broad antitumor activity, and induces protein-linked DNA single-strand breaks, thereby blocking DNA and RNA synthesis in dividing cells.
  • HY-B0964A
    Riboflavine phosphate

    Riboflavine 5'-phosphate

    Endogenous Metabolite Metabolic Disease
    Riboflavine phosphate is a derivative of Riboflavin (vitamin B2) which is an essential nutrient for animals. Riboflavin phosphate can be used for the research of progressive keratoconus, corneal ectasia and irregular astigmatism. Riboflavine phosphate is a very effective NAD +-recycling agent.
  • HY-B1700A
    Mivacurium dichloride

    nAChR Neurological Disease
    Mivacurium dichloride is a benzylisoquinoline derivative and is a short-acting non-depolarizing neuromuscular blocking agent and skeletal muscle relaxant. Mivacurium dichloride couples with the nAChR to reduce or inhibit the depolarizing effect of acetylcholine on the terminal disc of the muscle cell.
  • HY-100227
    E 64c

    Cathepsin SARS-CoV Metabolic Disease
    E 64c is a derivative of naturally occurring epoxide inhibitor of cysteine proteases, a Calcium-activated neutral protease (CANP) inhibitor and a very weak irreversible cathepsin C inhibitor. E 64c exhibits entry-blocking effect for MERS-CoV.
  • HY-B0553
    Methazolamide

    L584601

    Carbonic Anhydrase Inflammation/Immunology
    Methazolamide (L584601) is a sulfonamide derivative used as a carbonic anhydrase inhibitor with a Ki of 14 nM for human carbonic anhydrase II. Methazolamide, an intraocular pressure-lowering agent, reduces intraocular pressure elevations associated with glaucoma and other ocular disorders.
  • HY-N9391
    7,3′,5′-Trihydroxyflavanone

    Apoptosis Cancer
    7,3′,5′-Trihydroxyflavanone, a flavanoid derivative, induces the apoptotic cell death of MCF-7 cells by increasing Bax expression level. 7,3′,5′-Trihydroxyflavanone also exhibits antioxidant activity.
  • HY-B0295
    Chloroxine

    Bacterial Antibiotic Infection
    Chloroxine is one of the important 8-hydroxyquinoline derivative. Chloroxine has effective antibacterial, antifungal, antiprotozoal and antiamoebic activities, especially used in treating the intestinal amebiasis. Chloroxine is also used in the treatment of dandruff and seborrheic dermatitis of the scalp.
  • HY-W016009
    2'-Deoxyadenosine-5'-monophosphate

    Endogenous Metabolite Metabolic Disease
    2′-Deoxyadenosine 5′-monophosphate, a nucleic acid AMP derivative, is a deoxyribonucleotide found in DNA. 2′-Deoxyadenosine 5′-monophosphate can be used to study adenosine-based interactions during DNA synthesis and DNA damage.
  • HY-131010
    Flutax-2

    Microtubule/Tubulin Cancer
    FLUTAX-2 is an active fluorescent derivative of Taxol. FLUTAX-2 binds to polymerized α,β-tubulin dimers. FLUTAX-2 is able to stabilize microtubules of intact T. gallinae and T. foetus trophozoites[1].
  • HY-B0007
    Baclofen

    GABA Receptor Neurological Disease
    Baclofen, a lipophilic derivative of γ-aminobutyric acid (GABA), is an orally active, selective metabotropic GABA-B receptor (GABABR) agonist. Baclofen has high blood brain barrier penetrance. Baclofen has the potential for muscle spasticity research.
  • HY-129055
    Isoeleutherin

    Fungal Inflammation/Immunology
    Isoeleutherin is a naphthopyran derivative isolated from E. americana Merr. Et Heyne with anti-fungal, anti-viral, and anti-tumor activities. Isoeleutherin plays an important role in selective modulation of T helper cell-mediated immune responses.
  • HY-B0359
    Fenticonazole Nitrate

    REC 15-1476

    Fungal Antibiotic Infection
    Fenticonazole Nitrate is an antifungal imidazole ring derivative. Fenticonazole Nitrate operates via hindering ergosterol integration, and sequentially destructing the cytoplasmatic outer membrane. Fenticonazole Nitrate is effective against Gram-positive bacteria, mycoses, and vaginal candidiasis.
  • HY-107116
    MAP4343

    Microtubule/Tubulin Neurological Disease
    MAP4343 is the 3-methylether derivative of Pregnenolone. MAP4343 binds in vitro to microtubule-associated protein 2 (MAP2), stimulates the polymerization of tubulin, enhances the extension of neurites and protects neurons against neurotoxic agents.
  • HY-W008662
    2'-Deoxy-5'-O-DMT-2'-fluorouridine

    Filovirus Infection
    2'-Deoxy-5'-O-DMT-2'-fluorouridine, a nucleoside analogue, is a 5’-O-DMTr-5-FUDR derivative with potent anti-yellow fever (YFV) activity.
  • HY-B1209
    Etofylline

    7-(β-Hydroxyethyl)theophylline

    Others Cardiovascular Disease
    Etofylline (7-(β-Hydroxyethyl)theophylline) is a N-7-substituted derivative of Theophylline. Etofylline is a bronchodilator which can be used for the research of asthma. Etofylline is also an anticholesteremic and reduces total cholesterol level in the blood.
  • HY-112554
    PDM11

    Others Others
    PDM11 is a derivative of antioxidant resveratrol. PDM11 do not exhibit any significant protective effect against oxidation of linoleate micelles initiated by radiolysis-generated hydroxyl radicals. PDM11 is inactive in resveratrol activity assays.
  • HY-112126
    KRN5

    Others Inflammation/Immunology
    KRN5, a derivative of KRN2, is an oral active Nuclear factor of activated T cells 5 (NFAT5) suppressor, with an IC50 of 750 nM. KRN5 has potential to treat NFAT5-mediated Chronic Arthritis.
  • HY-14738
    Ceftaroline fosamil inner salt

    TAK-599 free acid; PPI0903 free acid

    Bacterial Antibiotic Infection
    Ceftaroline fosamil (TAK-599) inner salt, a cephalosporin derivative, is an N-phosphono prodrug of anti-methicillin-resistant Staphylococcus aureus (MRSA) T-91825. Ceftaroline fosamil inner salt can be used for the research of MRSA infection.
  • HY-15162
    Monomethyl auristatin E

    MMAE; SGD-1010

    Microtubule/Tubulin ADC Cytotoxin Apoptosis Cancer
    Monomethyl auristatin E (MMAE; SGD-1010) is a synthetic derivative of dolastatin 10 and functions as a potent mitotic inhibitor by inhibiting tubulin polymerization. MMAE is widely used as a cytotoxic component of antibody-drug conjugates (ADCs) to treat several different cancer types.
  • HY-B0293
    Butoconazole nitrate

    RS 35887

    Fungal Infection
    Butoconazole nitrate (RS 35887), an imidazole antifungal agent, is active against Candida spp. and effective against vaginal infections due to Candida albicans. Butoconazole nitrate is presumed to function as other imidazole derivatives via inhibition of steroid synthesis.
  • HY-101291
    Iberdomide

    CC-220

    Ligand for E3 Ligase Apoptosis Inflammation/Immunology Cancer
    Iberdomide (CC-220) is an orally active and potent cereblon (CRBN) E3 ligase modulator (CELMoD) with an IC50 of ~150 nM for cereblon-binding affinity. Iberdomide, a derivative of Thalidomide (HY-14658), has antitumor and immunostimulatory activities.
  • HY-P3204A
    POT-4 TFA

    AL-78898A TFA

    Complement System Metabolic Disease
    POT-4 TFA (AL-78898A TFA), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 TFA can be used for age-related macular degeneration research.
  • HY-108411
    Emedastine

    Histamine Receptor Inflammation/Immunology
    Emedastine is an orally active, selective and high affinity histamine H1 receptor antagonist with a Ki value of 1.3 nM. Emedastine is a benzimidazole derivative with potent antiallergic properties and used for allergic rhinitis, allergic skin diseases and allergic conjunctivitis.
  • HY-B0357
    Diclazuril

    R-64433

    Parasite Antibiotic Infection
    Diclazuril (R-64433), a benzeneacetonitrile derivative, is a potent and orally active anticoccidial agent. Diclazuril can be used for the research of certain infectious and parasitic diseases, including coccidiosis, acute toxoplasmosis, equine protozoal pyoencephalitis (EPM) et.al.
  • HY-126114
    Lupeol acetate

    Others Inflammation/Immunology
    Lupeol acetate, a derivative of Lupeol, suppresses the progression of rheumatoid arthritis (RA) by inhibiting the activation of macrophages and osteoclastogenesis through downregulations of TNF-α, IL-1β, MCP-1, COX-2, VEGF and granzyme B.
  • HY-138587
    7-TFA-ap-7-Deaza-ddG

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    7-TFA-ap-7-Deaza-ddG (compound 19d, US20060281100A1), a nucleotide derivative, can be used in the synthesis of thiotriphosphate nucleotide dye terminators which can be used in DNA sequencing reactions.
  • HY-N7557
    (E)-2'-Hydroxy-3,4-dimethoxychalcone

    Others Cancer
    (E)-2'-Hydroxy-3,4-dimethoxychalcone (compound 7) is a Chalcone derivative with orally active. (E)-2'-Hydroxy-3,4-dimethoxychalcone has anti-tumour activities.
  • HY-B0735AS
    Fenoldopam-d4 mesylate

    Dopamine Receptor Cardiovascular Disease
    Fenoldopam-d4 (SKF-82526-d4) mesylate is the deuterium labeled Fenoldopam mesylate. Fenoldopam (SKF 82526) mesylate is a drug and synthetic benzazepine derivative which acts as a selective D1 receptor partial agonist.
  • HY-111208
    CCT129957

    Phospholipase Cancer
    CCT129957 is an indole derivative and a potent phospholipase C-γ (PLC-γ) inhibitor with an IC50 of ~3 μM and a GC50 of 15 μM. CCT129957 inhibits Ca 2+ release in squamous carcinoma cells at ~15 μM.
  • HY-103244
    CITCO

    Apoptosis Cancer
    CITCO, an imidazothiazole derivative, is a selective Constitutive androstane receptor (CAR) agonist. CITCO inhibits growth and expansion of brain tumour stem cells (BTSCs) and has an EC50 of 49 nM over pregnane X receptor (PXR), and no activity on other nuclear receptors.
  • HY-113374A
    N1,N12-Diacetylspermine dihydrochloride

    Others Cancer
    N1,N12-Diacetylspermine dihydrochloride is a diacetylated derivative of Spermine. Upregulation of N1,N12-Diacetylspermine dihydrochloride has been linked to the incidence of cancer, making it to be a potential biomarker for cancer detection.
  • HY-138588
    7-TFA-ap-7-Deaza-ddA

    DNA/RNA Synthesis Nucleoside Antimetabolite/Analog Others
    7-TFA-ap-7-Deaza-ddA (compound 19c, US20060281100A1), a nucleotide derivative, can be used in the synthesis of thiotriphosphate nucleotide dye terminators which can be used in DNA sequencing reactions.
  • HY-102052
    DCEBIO

    Potassium Channel Inflammation/Immunology
    DCEBIO, a derivative of 1-EBIO, is an extremely potent activator of Cl - secretion in T84 colonic cells. DCEBIO stimulates Cl - secretion via the activation of hIK1 K + channels and the activation of an apical membrane Cl - conductance.
  • HY-16994
    OICR-0547

    Others Cancer
    OICR-0547 is a closely related derivative of OICR-9429. OICR-9429 is a novel small-molecule antagonist of the Wdr5-MLL interaction, while OICR-0547 is an inactive control compound that no longer binds to WDR5.
  • HY-100540B
    Golgicide A-2

    GCA-2

    Enterovirus Infection
    Golgicide A-2 (GCA-2), a Golgicide A (GCA) derivative, is the most active enantiomer of GCA. Golgicide A-2 displays high selectivity and efficiency in killing An. stephensi larvae and can be used for the research of dengue virus related diseases.
  • HY-W105272
    2′-Deoxyadenosine 5′-monophosphate disodium

    Endogenous Metabolite Metabolic Disease
    2′-Deoxyadenosine 5′-monophosphate disodium, a nucleic acid AMP derivative, is a deoxyribonucleotide found in DNA. 2′-Deoxyadenosine 5′-monophosphate disodium can be used to study adenosine-based interactions during DNA synthesis and DNA damage.
  • HY-B0964
    Riboflavin phosphate sodium

    FMN-Na; Riboflavin 5'-phosphate sodium; Vitamin B2 Phosphate Sodium Salt

    Endogenous Metabolite Others
    Riboflavin phosphate sodium (FMN-Na) is a derivative of Riboflavin (vitamin B2) which is an essential nutrient for animals. Riboflavin phosphate sodium can be used for the research of progressive keratoconus, corneal ectasia and irregular astigmatism. Riboflavine phosphate sodium is a very effective NAD +-recycling agent.
  • HY-N8110
    8-Chloro-2-(2-phenylethyl)-5,6,7-trihydroxy-5,6,7,8-tetrahydrochromone

    Others Others
    8-Chloro-2-(2-phenylethyl)-5,6,7-trihydroxy-5,6,7,8-tetrahydrochromone, a chromone derivative, can be found in MeOH extract of withered wood of Aquilaria sinensis.
  • HY-115545
    DBCO-NHS ester 3

    ADC Linker Cancer
    DBCO-NHS ester 3 (Compound 12) is a cleavable linker that is used for making antibody-drug conjugate (ADC). DBCO-NHS ester 3 is a derivative of Dibenzylcyclooctyne (DBCO) obtained by activation of N-hydroxysuccinimide by the carboxylic acid moiety of both methyl-oxanorbornadiene (MeOND) and dibenzoazacyclooctyne (DIBAC).
  • HY-118581
    Coralyne chloride

    Topoisomerase Cancer
    Coralyne chloride is a protoberberine alkaloid with potent anti-cancer activities. Coralyne chloride acts as a potent topoisomerase I poison and induces Top I mediated DNA cleavage. Coralyne chloride can be used for preparing coralyne derivatives as DNA binding fluorescent probes.
  • HY-N4233
    Bisabolangelone

    p38 MAPK Inflammation/Immunology
    Bisabolangelone, a sesquiterpene derivative, is isolated from the roots of Osterici Radix. Bisabolangelone possesses anti-inflammatory properties, which inhibits LPS-stimulated inflammation through the blocking of NF-kappaB and MAPK pathways in macrophages. Bisabolangelone has anti-ulcer activities.
  • HY-129441
    Metoprine

    BW 197U

    Histone Methyltransferase Antifolate Cancer Neurological Disease
    Metoprine (BW 197U) is a potent histamine N-methyltransferase (HMT) inhibitor. Metoprine, a diaminopyrimidine derivative, can cross the blood-brain barrier and increase brain histamine levels by inhibiting HMT. Metoprine is an antifolate and antitumor agent.
  • HY-15128
    9-cis-Retinoic acid

    ALRT1057

    RAR/RXR Apoptosis Cancer Inflammation/Immunology Neurological Disease
    9-cis-Retinoic acid (ALRT1057), a vitamin A derivative, is a potent RAR/RXR agonist. 9-cis-Retinoic acid induces apoptosis, regulates cell cycle and has anticancer, anti-inflammatory and neuroprotection activities.
  • HY-A0126A
    Epoprostenol sodium

    Prostaglandin I2 sodium salt; Prostacyclin sodium salt; Flolan

    Others Cardiovascular Disease
    Epoprostenol sodium (Prostaglandin I2 (sodium salt)), the synthetic form of the natural prostaglandin derivative prostacyclin (prostaglandin I2), is registered worldwide for the treatment of Pulmonary arterial hypertension (PAH). Epoprostenol sodium is used in pulmonary hypertension and transplantation as a potent inhibitor of platelet aggregation.
  • HY-A0163S
    Zuclopenthixol-d4 succinate salt

    Dopamine Receptor Neurological Disease
    Zuclopenthixol-d4((Z)-Clopenthixol-d4) succinate salt is the deuterium labeled Zuclopenthixol. Zuclopenthixol is a thioxanthene derivative which acts as a mixed dopamine D1/D2 receptor antagonist.
  • HY-B0702
    Nicergoline

    Adrenergic Receptor Neurological Disease Cardiovascular Disease
    Nicergoline, an ergoline derivative ester of bromonicotinic acid, is a potent, selective and orally active antagonist of α1A-adrenoceptor. Nicergoline has vasodilator effects. Nicergoline also has ameliorative effects on cognitive function in mouse models of Alzheimer's disease.
  • HY-W030319
    Methyl 2-(7-hydroxy-2-oxo-2H-chromen-4-yl)acetate

    Others Others
    Methyl 2-(7-hydroxy-2-oxo-2H-chromen-4-yl)acetate, a natural coumarins derivative, is exploited for the synthesis of the switchable fluorescent substrates to be used in bacterial enzyme detection.
  • HY-B0033
    Vigabatrin hydrochloride

    γ-Vinyl-GABA hydrochloride

    GABA Receptor Neurological Disease
    Vigabatrin hydrochloride (γ-Vinyl-GABA hydrochloride), a inhibitory neurotransmitter GABA vinyl-derivative, is an orally active and irreversible GABA transaminase inhibitor. Vigabatrin hydrochloride is an antiepileptic agent, which acts by increasing GABA levels in the brain by inhibiting the catabolism of GABA by GABA transaminase.
  • HY-P0252
    α-MSH

    α-Melanocyte-Stimulating Hormone

    Melanocortin Receptor Metabolic Disease Inflammation/Immunology Neurological Disease
    α-MSH (α-Melanocyte-Stimulating Hormone), as an endogenous neuropeptide, is an endogenous melanocortin receptor 4 (MC4R) agonist with anti-inflammatory and antipyretic activities. α-MSH is a post-translational derivative of pro-opiomelanocortin (POMC).
  • HY-B0479
    Thiamphenicol

    Thiophenicol; Dextrosulphenidol

    Bacterial Antibiotic Infection
    Thiamphenicol (Thiophenicol), a methyl-sulfonyl derivative of Chloramphenicol, is a broad-spectrum antimicrobial antibiotic. Thiamphenicol acts by binding to the 50S ribosomal subunit, leading to inhibition of protein synthesis and bacteriostatic effect (against Gram-negative, Gram-positive aerobic and anaerobic bacteria).
  • HY-108638
    NSC 146109 hydrochloride

    MDM-2/p53 Apoptosis Cancer
    NSC 146109 hydrochloride is a small-molecule p53 activator that target MDMX and can be used for breast cancer research. NSC 146109 hydrochloride is a pseudourea derivative, promotes breast cancer cells to undergo apoptosis through activating p53 and inducing expression of proapoptotic genes.
  • HY-15399
    Vigabatrin

    γ-Vinyl-GABA

    GABA Receptor Neurological Disease
    Vigabatrin (γ-Vinyl-GABA), an inhibitory neurotransmitter GABA vinyl-derivative, is an orally active and irreversible GABA transaminase inhibitor. Vigabatrin is an antiepileptic agent, which acts by increasing GABA levels in the brain by inhibiting the catabolism of GABA by GABA transaminase.
  • HY-B0585S
    Piracetam-d8

    iGluR Neurological Disease
    Piracetam-d8 (UCB-6215-d8) is the deuterium labeled Piracetam. Piracetam (UCB-6215) is a cyclic derivative of the neurotransmitter gamma-aminobutyric acid (GABA), used in treatment of a wide range of cognitive disorders.
  • HY-N0160
    Kinetin

    6-Furfuryladenine; N6-Furfuryladenine

    Others Neurological Disease
    Kinetin (N6-furfuryladenine) belongs to the family of N6-substituted adenine derivatives known as cytokinins, which are plant hormones involved in cell division, differentiation and other physiological processes. Kinetin has anti-aging effects.
  • HY-50722
    NNC 55-0396

    NNC 55-0396 dihydrochloride

    Calcium Channel Cardiovascular Disease
    NNC 55-0396, Mibefradil derivative, is a highly selective T-type calcium channel blocker; displays IC50 values of 6.8 and > 100 μM for inhibition of Cav3.1 T-type channels and HVA currents respectively in INS-1 cells.
  • HY-U00287
    BACE-IN-1

    Beta-secretase Neurological Disease
    BACE-IN-1 (Compound 13) is a substituted lmidazo[1 ,2-a]pyridine derivative which can inhibit β-site amyloid precursor protein-cleaving enzyme (BACE) and that may be useful in the treatment of diseases in which BACE is involved, such as Alzheimer's disease.
  • HY-N7623
    Ursonic acid methyl ester

    Others Cancer
    Ursonic acid methyl ester is an esterified derivative of Ursolic acid (HY-N0140). Ursonic acid methyl ester shows growth inhibitory activity against four tumor cell lines, HL-60, BGC, Bel-7402 and Hela with ED50 values of >100 µg/ml.
  • HY-100504
    S-methyl DM1

    Microtubule/Tubulin ADC Cytotoxin Cancer
    S-methyl DM1 is a thiomethyl derivative of Maytansine. S-methyl DM1 binds to tubulin with a Kd of 0.93 μM and inhibts microtubule polymerization. S-methyl DM1 potently suppresses microtubule dynamic instability and has anticancer effects.
  • HY-B2178
    Emedastine difumarate

    Histamine Receptor Inflammation/Immunology
    Emedastine difumarate is an orally active, selective and high affinity histamine H1 receptor antagonist with a Ki value of 1.3 nM. Emedastine difumarate is a benzimidazole derivative with potent antiallergic properties and used for allergic rhinitis, allergic skin diseases and allergic conjunctivitis.
  • HY-70057
    Safinamide

    FCE 26743; EMD 1195686

    Monoamine Oxidase Neurological Disease
    Safinamide is a potent, selective, and reversible monoamine oxidase B (MAO-B) inhibitor (IC50=0.098 µM) over MAO-A (IC50=580 µM). Safinamide also blocks sodium channels and modulates glutamate (Glu) release, showing a greater affinity at depolarized (IC50=8 µM) than at resting (IC50=262 µM) potentials. Safinamide has neuroprotective and neurorescuing effects and can be used for the study of parkinson disease, ischemia stroke etc.al.
  • HY-103645
    GW779439X

    Bacterial Aurora Kinase Apoptosis Cancer Infection
    GW779439X is a pyrazolopyridazine identified in an inhibitor of the S. aureus PASTA kinase Stk1. GW779439X potentiates the activity of β-lactam antibiotics against various MRSA and MSSA isolates, some even crossing the breakpoint from resistant to sensitive. GW779439X is an AURKA inhibitor and induces apoptosis by the caspases 3/7 pathway. MRSA:methicillin-resistant S. aureus; MSSA: methicillin-sensitive S. aureus
  • HY-70057A
    Safinamide mesylate

    FCE 26743 mesylate; EMD 1195686 mesylate

    Monoamine Oxidase Neurological Disease Cardiovascular Disease
    Safinamide (FCE 26743; EMD 1195686) mesylate is a potent, selective, and reversible monoamine oxidase B (MAO-B) inhibitor (IC50=0.098 µM) over MAO-A (IC50=580 nM). Safinamide mesylate also blocks sodium channels and modulates glutamate (Glu) release, showing a greater affinity at depolarized (IC50=8 µM) than at resting (IC50=262 µM) potentials. Safinamide mesylate has neuroprotective and neurorescuing effects and can be used for the study of parkinson disease, ischemia stroke et.al.
  • HY-139048A
    Fluoroethylnormemantine hydrochloride

    iGluR Neurological Disease
    Fluoroethylnormemantine hydrochloride, a derivative of Memantine, is an antagonist of the N-methyl-D-aspartate (NMDA) receptor. [ 18F]-Fluoroethylnormemantine hydrochloride can be used as a positron emission tomography (PET) tracer. Fluoroethylnormemantine hydrochloride exhibits anti-amnesic, neuroprotective, antidepressant-like and fear-attenuating effects.
  • HY-139048
    Fluoroethylnormemantine

    iGluR Neurological Disease
    Fluoroethylnormemantine, a derivative of Memantine, is an antagonist of the N-methyl-D-aspartate (NMDA) receptor. [ 18F]-Fluoroethylnormemantine can be used as a positron emission tomography (PET) tracer. Fluoroethylnormemantine exhibits anti-amnesic, neuroprotective, antidepressant-like and fear-attenuating effects.
  • HY-B0371
    Terazosin

    Adrenergic Receptor Metabolic Disease Endocrinology
    Terazosin is a quinazoline derivative and a competitive and orally active α1-adrenoceptor antagonist. Terazosin works by relaxing blood vessels and the opening of the bladder. Terazosin has the potential for benign prostatic hyperplasia (BPH) and high blood pressure treatment.
  • HY-16398
    Pipobroman

    DNA Alkylator/Crosslinker Cancer
    Pipobroman is a bromide derivative of piperazine and acts as an alkylating agent. Pipobroman plays its role by inhibiting DNA and RNA polymerase or by reducing pyrimidine nucleotide incorporation into DNA. Pipobroman can be used for the cancer research, including polycythemia vera, myeloproliferative neoplasm, and AML et.al.
  • HY-15794
    Nemorubicin

    Methoxymorpholinyl doxorubicin; FCE 23762; PNU 152243

    Others Cancer
    Nemorubicin (Methoxymorpholinyl doxorubicin) is a Doxorubicin derivative with potent antitumor activity. Nemorubicin is highly cytotoxic to a variety of tumor cell lines presenting a multidrug-resistant phenotype. Nemorubicin requirs an intact nucleotide excision repair (NER) system to exert its activity.
  • HY-101483
    Dihydromunduletone

    DHM

    Others Cancer Neurological Disease
    Dihydromunduletone (DHM) is a rotenoid derivative and a selective, potent adhesion G protein-coupled receptor (aGPCR) (GPR56 and GPR114/ADGRG5) antagonist with an IC 50 of 20.9 μM for GPR56, but not inhibit GPR110 or class A GPCRs.
  • HY-136657
    SC-43

    Phosphatase STAT Apoptosis Cancer
    SC-43, a Sorafenib derivative, is a potent and orally active SHP-1 (PTPN6) agonist. SC-43 inhibits the phosphorylation of STAT3 and induces cell apoptosis. SC-43 has anti-fibrotic and anticancer effects.
  • HY-B0371F
    Terazosin hydrochloride

    Adrenergic Receptor Endocrinology Metabolic Disease
    Terazosin hydrochloride is a quinazoline derivative and a competitive and orally active α1-adrenoceptor antagonist. Terazosin hydrochloride works by relaxing blood vessels and the opening of the bladder. Terazosin hydrochloride has the potential for benign prostatic hyperplasia (BPH) and high blood pressure treatment.
  • HY-141513
    NH-3

    Thyroid Hormone Receptor Neurological Disease
    NH-3 is an orally active, reversible thyroid hormone receptor (THR) antagonist with an IC50 of 55 nM. NH-3, a derivative of the selective thyromi-metic GC-1, inhibits binding of thyroid hormones to their receptor and that inhibits cofactor recruitment.
  • HY-N6773
    Cytochalasin A

    HIV Protease Fungal Infection
    Cytochalasin A is a cell-permeable fungal toxin that is an oxidized derivative of cytochalasin B. Cytochalasin A is an inhibitor of HIV-1 protease (IC50=3 μM) and inhibits actin polymerization and interferes with microtubule assembly by reacting with sulfhydryl groups. Antibiotic and fungicidal activitives.
  • HY-114661
    m-PEG4-Tos

    PROTAC Linker Cancer
    m-PEG4-Tos is a derivative of silybin ethers, extracted from patent CN105037337A (compound III-b). m-PEG4-Tos is a PEG-based PROTAC linker can be used in the synthesis of Silymarin (HY-W043277).
  • HY-13680
    Meisoindigo

    Dian III; N-Methylisoindigotin; Natura-α

    Apoptosis Cancer
    Meisoindigo (Dian III), a derivative of Indirubin (HY-N0117), halts the cell cycle at the G0/G1 phase and induces apoptosis in primary acute myeloid leukemia (AML) cells. Meisoindigo exhibits high antitumor activity.
  • HY-139464
    Q134R

    Others Neurological Disease
    Q134R, a neuroprotective hydroxyquinoline derivative that suppresses nuclear factor of activated T cell (NFAT) signaling. Q134R can across blood-brain barrier. Q134R has the potential for Alzheimer's disease (AD) and aging-related disorders research.
  • HY-P0252A
    α-MSH TFA

    α-Melanocyte-Stimulating Hormone TFA

    Melanocortin Receptor Metabolic Disease Inflammation/Immunology Neurological Disease
    α-MSH (α-Melanocyte-Stimulating Hormone) TFA, as an endogenous neuropeptide, is an endogenous melanocortin receptor 4 (MC4R) agonist with anti-inflammatory and antipyretic activities. α-MSH TFA is a post-translational derivative of pro-opiomelanocortin (POMC).
  • HY-113089
    Epsilon-(gamma-glutamyl)-lysine

    H-Glu(H-Lys-OH)-OH; γ-Glu-ε-Lys

    Others Metabolic Disease
    Epsilon-(gamma-glutamyl)-lysine is an N(6)-acyl-L-lysine derivative. The enzyme tissue transglutaminase (tTg) helps the formation of epsilon-(gamma-glutamyl)lysine bonds between ECM components in some disease, such as non-diabetic kidney, glaucoma filtration.
  • HY-135090
    m-PEG8-Tos

    PROTAC Linker Cancer
    Tos-PEG8-m is a derivative of silybin ethers, extracted from patent CN105037337A (compound III-d). Tos-PEG8-m is a PEG-based PROTAC linker can be used in the synthesis of Silymarin (HY-W043277).
  • HY-19528
    SAH

    SAH (S-Adenosylhomocysteine)

    Endogenous Metabolite Metabolic Disease
    SAH (S-Adenosylhomocysteine) is an amino acid derivative and a modulartor in several metabolic pathways. It is an intermediate in the synthesis of cysteine and adenosine. SAH is an inhibitor for METTL3-METTL14 heterodimer complex (METTL3-14) with an IC50 of 0.9 µM.
  • HY-14518
    Aminopterin

    4-Aminofolic acid; APGA

    Antifolate Cancer Inflammation/Immunology
    Aminopterin (4-Aminofolic acid), the 4-amino derivative of folic acid, is a folic acid antagonist. Aminopterin catalyses the reduction of folic acid to tetrahydrofolic acid, and competitively inhibits dihydrofolate reductase (DHFR) with a Ki of 3.7 pM. Aminopterin has anticancer and immunosuppressive activity. Aminopterin is used in treatment of pediatric leukemia.
  • HY-B0422
    Nateglinide

    A4166; Senaglinide

    Potassium Channel Dipeptidyl Peptidase Metabolic Disease
    Nateglinide, a D-phenylalanine derivative, is an orally active and short-acting insulinotropic agent and a DPP IV inhibitor. Nateglinide inhibits ATP-sensitive K + channels in pancreatic β-cells. Nateglinide is used for the treatment of type 2 (non-insulin-dependent) diabetes mellitus.
  • HY-14776
    Quarfloxin

    CX-3543

    DNA/RNA Synthesis Cancer
    Quarfloxin (CX-3543), a fluoroquinolone derivative with antineoplastic activity, targets and inhibits RNA pol I activity, with IC50 values in the nanomolar range in neuroblastoma cells. Quarfloxin disrupts the interaction between the nucleolin protein and a G-quadruplex DNA structure in the ribosomal DNA (rDNA) template.
  • HY-134772
    AS1810722

    STAT Cytochrome P450 Inflammation/Immunology
    AS1810722 is an orally active and potent STAT6 inhibitor with an IC50 of 1.9 nM. AS1810722 shows a good profile of CYP3A4 inhibition. AS1810722, a derivative of fused bicyclic pyrimidine, has the potential for allergic diseases such as asthma and atopic diseases research.
  • HY-15236
    PSI-6206

    RO 2433; GS-331007

    HCV Infection
    PSI-6206 (RO 2433) is the deaminated derivative of PSI-6130, which is a potent and selective inhibitor of HCV NS5B polymerase. PSI-6206 low potently inhibits HCV replicon with EC90 of >100 μM.
  • HY-N5086
    Picroside IV

    Others Infection Metabolic Disease Inflammation/Immunology Neurological Disease
    Picroside IV is an iridoid glycoside found in the underground parts of Picrorhiza scrophulariiflora. Picroside IV is a derivative of Catalpol (HY-N0820). Catalpol has neuroprotective, hypoglycemic, anti-inflammatory, anti-cancer, anti-spasmodic, anti-oxidant effects and anti-HBV effects.
  • HY-125331
    DRF-1042

    Topoisomerase ADC Cytotoxin Cancer
    DRF-1042 is an orally active derivative of Camptothecin. DRF-1042 acts to inhibit DNA topoisomerase I. DRF-1042 shows good anticancer activity against a panel of human cancer cell lines including multi-drug resistance (MDR) phenotype.
  • HY-126297
    c-Fms-IN-10

    c-Fms Cancer Inflammation/Immunology
    c-Fms-IN-10 is the derivative of thieno [3,2-d] pyrimidine, an kinase inhibitor of FMS (Colony stimulating factor-1 receptor, CSF-1R) with IC50 of 2 nM. c-Fms-IN-10 has anti-tumor activity.
  • HY-B1157
    Trioxsalen

    Trisoralen; Trioxysalen; TMP

    DNA Alkylator/Crosslinker Inflammation/Immunology
    Trioxsalen (Trisoralen), a psoralen derivative, is a photochemical DNA crosslinker. Trioxsalen only works after photoactivation with near ultraviolet light. Trioxsalen is a photosensitizer that can be used for the research of vitiligo and hand eczema. Trioxsalen is used for visualization of genomic interstrand cross-links localized by laser photoactivation.
  • HY-B0024
    Prulifloxacin

    NM441

    Bacterial Antibiotic Infection
    Prulifloxacin (NM441) is an orally active fluoroquinolone antibiotic with a broad spectrum of activity against Gram-positive and -negative bacteria. Prulifloxacin is a prodrug of a thiazeto-quinoline carboxylic acid derivative Ulifloxacin (NM394). Prulifloxacin has the potential for lower urinary tract infections and exacerbations of chronic bronchitis.
  • HY-N7665
    Prosaikogenin G

    Others Metabolic Disease
    Prosaikogenin G, isolated from the roots of Buleurum bicaule Helm (Apiaceae), exhibits significant inhibitory effects on rat mesangial cell proliferation induced by Ang II. Prosaikogenin G has protective action on the kidney. Prosaikogenin G is a derivative of Saikosaponin d in the gastrointestinal tract.
  • HY-128974
    N-Dodecyl-β-D-maltoside

    Lauryl Maltoside

    Others Others
    N-Dodecyl-β-D-maltoside (Lauryl Maltoside) is a derivatives of pyrene (Py), and it is a alkyl maltopyranoside detergent, especially in transporters and respiratory complexes. N-Dodecyl-β-D-maltoside has also been employed in applications such as in the purification and stabilization of RNA polymerase and detection of protein-lipid interactions.
  • HY-W015782
    4-Ethylresorcinol

    Others Metabolic Disease
    4-Ethylresorcinol, a derivative of resorcinol, can act as substrates of tyrosinase. 4-Ethylresorcinol possess hypopigmentary effects. 4-Ethylresorcinol attenuates mRNA and protein expression of tyrosinase-related protein (TRP)-2, and possessed antioxidative effect by inhibiting lipid peroxidation.
  • HY-10218
    Everolimus

    RAD001; SDZ-RAD

    mTOR FKBP Autophagy Apoptosis Cancer
    Everolimus (RAD001) is a Rapamycin derivative and a potent, selective and orally active mTOR1 inhibitor. Everolimus binds to FKBP-12 to generate an immunosuppressive complex. Everolimus inhibits tumor cells proliferation and induces cell apoptosis and autophagy. Everolimus has potent immunosuppressive and anticancer activities.
  • HY-N7516
    4'-Hydroxy-2,4-dimethoxychalcone

    Parasite Bacterial Fungal Infection
    4'-Hydroxy-2,4-dimethoxychalcone is a natural chalcone derivatives in the red herbal resin of Dracaena cochinchinensis. 4'-Hydroxy-2,4-dimethoxychalcone displays a wide range of biological activities including antimalarial, antiprotozoal, antibacterial, antifungal activity.
  • HY-B0371A
    Terazosin hydrochloride dihydrate

    Adrenergic Receptor Endocrinology Metabolic Disease
    Terazosin hydrochloride dihydrate is a quinazoline derivative and a competitive and orally active α1-adrenoceptor antagonist. Terazosin hydrochloride dihydrate works by relaxing blood vessels and the opening of the bladder. Terazosin hydrochloride dihydrate has the potential for benign prostatic hyperplasia (BPH) and high blood pressure treatment.
  • HY-P9921
    Trastuzumab emtansine

    Ado-Trastuzumab emtansine; PRO132365; T-DM 1

    Antibody-Drug Conjugate (ADC) EGFR Cancer
    Trastuzumab emtansine (Ado-Trastuzumab emtansine) is an antibody-drug conjugate (ADC) that incorporates the HER2-targeted antitumor properties of trastuzumab with the cytotoxic activity of the microtubule-inhibitory agent DM1 (derivative of maytansine). Trastuzumab emtansine can be used for the research of advanced breast cancer.
  • HY-126415
    Magnesium Lithospermate B

    Others Inflammation/Immunology Neurological Disease Cardiovascular Disease
    Magnesium Lithospermate B, a derivative of caffeic acid tetramer, and is extracted from Salviae miltiorrhizae. Magnesium Lithospermate B is widely used for the research of cardiovascular diseases, and it can protect against glucose-induced intracellular oxidative damage. Magnesium Lithospermate B also suppresses neuroinflammation and attenuates neurodegeneration.
  • HY-103374
    Phenserine

    (-)-Eseroline phenylcarbamate; (-)-Phenserine

    AChE Amyloid-β Neurological Disease
    Phenserine ((-)-Eseroline phenylcarbamate) is a derivative of Physostigmine and is a potent, noncompetitive, long-acting and selective AChE inhibitor. Phenserine reduces β-amyloid precursor protein (APP) and β-amyloid peptide (Aβ) formation. Phenserine improves cognitive performance and attenuates the progression of Alzheimer's disease.
  • HY-136408
    Malonyl Coenzyme A lithium

    Others Metabolic Disease
    Malonyl Coenzyme A (lithium) is a coenzyme A derivative that is utilized in fatty acid and polyketide synthesis and in the transport of α-ketoglutarate across the mitochondrial membrane. Malonyl Coenzyme A (lithium) is formed by the Acetyl CoA Carboxylase-mediated carboxylation of acetyl CoA. Malonyl Coenzyme A (lithium) is exclusively used as the extender unit in the synthesis of bacterial aromatic polyketides.
  • HY-12752
    Alimemazine

    Trimeprazine

    Others Inflammation/Immunology Neurological Disease
    Alimemazine is a phenothiazine derivative that is generally used as an antipruritic agent and also a hemagglutinin (HA)-receptor antagonist.Alimemazine (Trimeprazine) is also acts as a partial agonist against the histamine H1 receptor (H1R) and other GPCRs. Alimemazine displays sedative, antiserotonin, antispasmodic, and antiemetic properties.
  • HY-141551
    GNE-274

    Estrogen Receptor/ERR Cancer
    GNE-274 is a non-degrader that is structurally related to GDC-0927 (ER degrader). GNE-274 does not induce ER turnover and functions as a partial ER agonist in breast cancer cell lines. GNE-274 increase chromatin accessibility at ER-DNA binding sites, while GDC-0927 do not. GNE-274 is a potent inhibitor of ER-ligand binding domain (LBD). GNE-274 can be used for cancer research.
  • HY-10704
    PTP1B-IN-1

    PTP1B inhibitor

    Phosphatase Metabolic Disease
    PTP1B-IN-1 is a potent protein tyrosine phosphatase-1B (PTP1B) inhibitor with IC50 of 1.6 mM; 1,2,5-thiadiazolidin-3-one-1,1-dioxide scaffold for derivatives synthesis.
  • HY-126937
    Ivermectin B1a

    Parasite SARS-CoV Infection
    Ivermectin B1a, a derivative of Avermectin B1a (HY-15308), is a main component of Ivermectin (HY-15310). Ivermectin (MK-933) is a broad-spectrum anti-parasite agent. Ivermectin is a candidate therapeutic against SARS-CoV-2/COVID-19.
  • HY-13582
    Carbendazim

    Fungal Infection Cancer
    Carbendazim is a potent and orally active broad-spectrum benzimidazole fungicide and can be acts as a pesticide for fungal diseases research, such as SeproriaFusarium and Sclerotina. Carbendazim is a benzimidazole (HY-Y1825) derivative with antitumor activity and used for cancer research, especially advanced solid tumors and lymphoma.
  • HY-N8022
    Lucidin primeveroside

    Lucidin 3-O-β-primeveroside

    Others Cancer
    Lucidin primeveroside (Lucidin 3-O-β-primeveroside) is an anthraquinone derivative present in madder root, which has been used as a coloring agent and food additive. Lucidin primeveroside can be metabolically converted to genotoxic compound Lucidin, which subsequently forms lucidin-specific DNA adducts.
  • HY-N0446
    10-Methoxycamptothecin

    Others Cancer
    10-Methoxycamptothecin is a natural bioactive derivative of camptothecin (CPT) isolated from Camptotheca acuminata, and has been confirmed to possess high anti-cancer properties. 10-Methoxycamptothecin has higher cytotoxicity than 10-hydroxycamptothecin by testing antitumor activity against 2774 cell lines.
  • HY-136145
    FIDAS-3

    Wnt Cancer
    FIDAS-3 is a stilbene derivative and is a potent Wnt inhibitor with an IC50 of 4.9 μM for methionine S-adenosyltransferase 2A (MAT2A). FIDAS-3 effectively competes against S-adenosylmethionine (SAM) for MAT2A binding. FIDAS-3 has anticancer activities.
  • HY-14973
    Vidupiprant

    AMG 853

    Prostaglandin Receptor Inflammation/Immunology
    Vidupiprant (AMG 853) is a phenylacetic acid derivative. Vidupiprant is a potent and orally active CRTH2 (DP2) and prostanoid D receptor (DP or DP1) dual antagonist with IC50s of 3 nM and 4 nM in buffer, and 8 nM and 35 nM in human plasma, respectively. Vidupiprant has the potential for asthma treatment.
  • HY-119437
    FLTX1

    Estrogen Receptor/ERR Cancer
    FLTX1 is a fluorescent Tamoxifen derivative that can specifically label intracellular Tamoxifen-binding sites (estrogen receptors) under permeabilized and non-permeabilized conditions. FLTX1 exhibits the potent antiestrogenic properties of Tamoxifen in breast cancer cells. FLTX1 is devoid of the estrogenic agonistic effect on the uterus.
  • HY-111874
    SNIPER(ABL)-039

    SNIPER Bcr-Abl Cancer
    SNIPER(ABL)-039, conjugating Dasatinib (ABL inhibitor) to LCL161 derivative (IAP ligand) with a linker, induces the reduction of BCR-ABL protein with a DC50 of 10 nM. IC50s are 0.54 nM, 10 nM, 12 nM, and 50 nM for ABL, cIAP1, cIAP2, XIAP, respectively.
  • HY-137977
    DMU-212

    ERK Apoptosis Cancer
    DMU-212 is a methylated derivative of Resveratrol (HY-16561), with antimitotic, anti-proliferative, antioxidant and apoptosis promoting activities. DMU-212 induces mitotic arrest via induction of apoptosis and activation of ERK1/2 protein. DMU-212 has orally active.
  • HY-131305
    HBDDE

    PKC Apoptosis Neurological Disease
    HBDDE, a derivative of Ellagic acid, is an isoform-selective PKCα and PKCγ inhibitor with IC50s of 43 μM and 50 μM, respectively. HBDDE shows selective for PKCα/PKCγ over PKCδ, PKCβI and PKCβII isozymes. HBDDE induces neuronal apoptosis.
  • HY-111905
    BRD7-IN-1

    Epigenetic Reader Domain Cancer
    BRD7-IN-1, a modified derivative of BI7273 (BRD7/9 inhibitor), binds to a VHL ligand via a linker to form a PROTAC VZ185 (VZ185 against BRD7/9 with DC50s of 4.5 and 1.8 nM, respectively).
  • HY-105327
    P11149

    AChE Neurological Disease
    P11149 is a competitive, BBB-penetarated weakly, orally active and selective inhibitor of AChE. P11149 exhibits an IC50 of 1.3 μM for rat BChE/AChE. P11149, a Galanthamine derivative, demonstrates central cholinergic activity, behavioral efficacy and safety. P11149 is used in the study for Alzheimer's disease.
  • HY-19469
    Roluperidone

    CYR-101; MIN-101; MT-210

    5-HT Receptor Sigma Receptor Neurological Disease
    Roluperidone (CYR-101) is a novel cyclic amide derivative that has high equipotent affinities for 5-HT2A and sigma-2 receptors (Ki of 7.53 nM and 8.19 nM for 5-HT2A and sigma-2, respectively).
  • HY-N6084
    Humulone

    α-Lupulic acid

    COX GABA Receptor Apoptosis Cardiovascular Disease
    Humulone (α-Lupulic acid), a prenylated phloroglucinol derivative, is a potent cyclooxygenase-2 (COX-2) inhibitor. Humulone acts as a positive modulator of GABAA receptor at low micromolar concentrations. Humulone is an inhibitor of bone resorption. Humulone possesses antioxidant, anti-angiogenic and apoptosis-inducing properties.
  • HY-131760
    2'-NH2-ATP

    2'-Amino-2'-deoxyadenosine-5'-triphosphate

    Others Metabolic Disease
    2'-NH2-ATP (2'-Amino-2'-deoxyadenosine-5'-triphosphate), an adenosine derivative, is a weak competitive inhibitor of ATP, with a Ki of 2.3 mM. 2'-NH2-ATP can be used in nucleic acid labeling.
  • HY-18030A
    CEP-28122 mesylate salt

    ALK Cancer
    CEP-28122 mesylate salt, a diaminopyrimidine derivative, is a potent, selective, and orally bioavailable ALK inhibitor, with an IC50 value of 1.9 nM for recombinant ALK kinase activity. CEP-28122 has antitumor activity in experimental models of ALK-positive human cancers. CEP-28122 mesylate salt has good pharmacodynamic and pharmacokinetic activity.
  • HY-133869
    cGMP-HTL

    cGMP-HaloTag-ligand

    Autophagy Cancer
    cGMP-HTL contains a HT-ligand, a linker and the Cys-S-cGMP (autophagy tag). cGMP-HTL increases the K63-linked ubiquitination of mitochondria. AUTAC (autophagy-targeting chimera) is a novel targeted-clearance strategy that contains a degradation tag (guanine derivatives) and a warhead to provide target specificity.
  • HY-W009156
    Hydroxycitric acid tripotassium hydrate

    Potassium citrate monohydrate

    ATP Citrate Lyase HIF/HIF Prolyl-Hydroxylase Cancer Metabolic Disease Inflammation/Immunology
    Hydroxycitric acid tripotassium hydrate (Potassium citrate monohydrate) is the major active ingredient of Garcinia cambogia and a derivative of citric acid. Hydroxycitric acid tripotassium hydrate competitively inhibits ATP citrate lyase with weight loss benefits. Hydroxycitric acid tripotassium hydrate effective inhibits stones formation and also inhibits HIF, and has antioxidation, anti-inflammation and anti-tumor effects.
  • HY-139402
    MRTX849 acid

    Ras Cancer
    MRTX849 acid, a derivative of MRTX849, can be used in the synthesis of PROTAC LC-2 (HY-137516). LC-2 is a potent and first-in-class PROTAC capable of degrading endogenous KRAS G12C (DC 50s between 0.25 and 0.76 μM).
  • HY-111022
    Icerguastat

    Sephin1; IFB-088

    Phosphatase Infection Inflammation/Immunology
    Icerguastat (Sephin1), a derivative of Guanabenz lacking the α2-adrenergic activity, is a selective inhibitor of the phosphatase regulatory subunit PPP1R15A (R15A). Icerguastat inhibits eIF2α dephosphorylation, thereby prolonging the protective response. Anti-prion effect.
  • HY-136557
    PAD2-IN-1

    Protein Arginine Deiminase Cancer Inflammation/Immunology
    PAD2-IN-1, a benzimidazole-based derivative, is a potent and selective protein arginine deiminase 2 (PAD2) inhibitor. PAD2-IN-1 shows superior selectivity for PAD2 over PAD4 (95-fold) and PAD3 (79-fold).
  • HY-N0262
    Cordycepin

    3'-Deoxyadenosine

    MMP Bacterial Autophagy Antibiotic Cancer Infection Inflammation/Immunology
    Cordycepin (3'-Deoxyadenosine) is a nucleoside derivative and inhibits IL-1β-induced MMP-1 and MMP-3 expression in rheumatoid arthritis synovial fibroblasts (RASFs) in a dose-dependent manner. Cordycepin kills Mycobacterium tuberculosis through hijacking the bacterial adenosine kinase.
  • HY-76772
    Cevimeline hydrochloride hemihydrate

    SNI-2011; AF102B hydrochloride hemihydrate

    mAChR Neurological Disease
    Cevimeline hydrochloride hemihydrate (SNI-2011) is a quinuclidine derivative of acetylcholine and a selective and orally active muscarinic M1 and M3 receptor agonist. Cevimeline hydrochloride hemihydrate stimulates secretion by the salivary glands and can be used as a sialogogue for xerostomia. Cevimeline hydrochloride hemihydrate can cross the blood-brain barrier (BBB).
  • HY-122723
    GOT1 inhibitor-1

    Others Cancer
    GOT1 inhibitor-1 (compound 2c), a tryptamine-based derivative, acts as a novel, potent and non-covalent inhibitor of glutamate oxaloacetate transaminase 1 (GOT1) with an IC50 of 8.2 uM. GOT1 inhibitor-1 can be used for the research of pancreatic ductal adenocarcinoma (PDAC).
  • HY-N5112B
    β,β-Dimethylacrylshikonin

    Isoarnebin I

    Others Cancer
    β,β-Dimethylacrylshikonin (Isoarnebin I) is a naphthoquinone derivative isolated from Arnebia nobilis, promotes angiogenesis by inducing eNOS, VEGF and HIF-1α expression through the PI3K-dependent pathway.β,β-Dimethylacrylshikonin has anti-tumor activity.
  • HY-101647
    Intoplicine

    RP 60475

    Topoisomerase Cancer
    Intoplicine (RP 60475), an antitumor derivative in the 7H-benzo[e]pyrido[4,3-b]indole series, is a DNA topoisomerase I and II inhibitor. Intoplicine strongly binds DNA (KA = 2 x 10 5 /M) and thereby increases the length of linear DNA.
  • HY-118284
    Vicagrel

    P2Y Receptor Cardiovascular Disease
    Vicagrel, an acetate derivative of Clopidogrel, is a P2Y12 platelet inhibitor potentially for the treatment of thrombosis, the substrate of carboxylesterase 2 (CES2). Vicagrel demonstrates a favorable safety profile and excellent anti-platelet activity, which could be an anti-platelet drug and for the unmet medical needs of cardiovascular diseases.
  • HY-N4286
    4-Methyldaphnetin

    Apoptosis Cancer
    4-Methyldaphnetin is a precursor in the synthesis of derivatives of 4-methyl coumarin. 4-Methyldaphnetin has potent, selective anti-proliferative and apoptosis-inducing effects on several cancer cell lines. 4-Methyldaphnetin possesses radical scavenging property and strongly inhibits membrane lipid peroxidation.
  • HY-70020B
    Cevimeline hydrochloride

    AF102B hydrochloride

    mAChR Neurological Disease
    Cevimeline hydrochloride (AF102B hydrochloride) is a quinuclidine derivative of acetylcholine and a selective and orally active muscarinic M1 and M3 receptor agonist. Cevimeline hydrochloride stimulates secretion by the salivary glands and can be used as a sialogogue for xerostomia. Cevimeline hydrochloride can cross the blood-brain barrier (BBB).
  • HY-133513
    (±)-H3RESCA-TFP

    (±)-H3L28

    Others Cancer
    (±)-H3RESCA-TFP ((±)-H3L28) is a tetrafluorophenyl ester derivative of restrained complexing agent (RESCA). (±)-H3RESCA-TFP can be used to conjugate the chelator with a biomolecule via amine coupling (e.g., N terminus and/or the ε-amino groups of lysine).
  • HY-130081
    DM3-SMe

    ADC Cytotoxin Microtubule/Tubulin Cancer
    DM3-SMe is a maytansine derivative and a tubulin inhibitor, and is a cytotoxic moiety of antibody-drug conjugates (ADCs), which can be linked to antibody through disulfide bond or stable thioether bond. DM3-SMe shows highly cytotoxic activity in vitro with an IC50 of 0.0011 nM.
  • HY-P1102
    TC14012

    CXCR HIV Cancer Infection
    TC14012, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 has anti-HIV activity and anti-cancer activity.
  • HY-W008859
    Tetrac

    Tetraiodothyroacetic acid; 3,3',5,5'-Tetraiodothyroacetic acid

    Integrin Endogenous Metabolite Cancer
    Tetrac (Tetraiodothyroacetic acid), a derivative of L-thyroxine (T4), is a thyrointegrin receptor antagonist. Tetrac blocks the actions of T4 and 3,5,3'-triiodo-L-thyronine (T3) at the cell surface receptor for thyroid hormone on integrin αvβ3. Tetra has anti-angiogenic and anti-tumor activities.
  • HY-N6013
    Aloin(mixture of A&B)

    MMP Bacterial Fungal Cancer Infection Inflammation/Immunology
    Aloin (mixture of A&B) is anthraquinone derivative isolated from Aloe vera. Aloin (mixture of A&B) has diverse biological activities such as anti-inflammatory, immunity, antidiabetic, antioxidant, antibacterial, antifungal, and antitumor activities. Aloin (mixture of A&B) also an effective inhibitor of stimulated granulocyte matrix metalloproteinases (MMPs).
  • HY-112900
    DC41SMe

    ADC Cytotoxin Cancer
    DC41SMe, a DC1 derivative, shows cytotoxicity in Ramos, Namalwa, and HL60/s cells with IC50s ranging from 18-25 pM. DC1, a simplified analogue of CC-1065, is an antibody conjugate of cytotoxic DNA alkylators for the targeted treatment of cancer.
  • HY-W010970
    5'-Guanylic acid disodium salt

    5'-GMP disodium salt; 5'-guanosine monophosphate disodium salt

    Endogenous Metabolite Others
    5'-Guanylic acid disodium salt (5'-GMP disodium salt) is composed of guanine, ribose, and phosphate moieties and it is a nucleotide monomer in messenger RNA. Guanosine derivatives are involved in intracellular signal transduction and have been identified in repetitive genomic sequences in telomeres, in ribosomal DNA, immunoglobulin heavy‐chain switch regions, and in the control regions of proto-oncogenes.
  • HY-N3446
    IVHD-valtrate

    Apoptosis Cancer
    IVHD-valtrate, an active Valeriana jatamansi derivative, is against human ovarian cancer cells in vitro and in vivo. IVHD-valtrate induces cancer cells apoptosis and arrests the ovarian cancer cells in the G2/M phase. IVHD-valtrate has the potential to be a novel chemotherapeutic agent for the human ovarian cancer research.
  • HY-111905A
    BRD7-IN-1 free base

    Epigenetic Reader Domain Cancer
    BRD7-IN-1 free base, a modified derivative of BI7273 (BRD7/9 inhibitor), binds to a VHL ligand via a linker to form a PROTAC VZ185 (VZ185 against BRD7/9 with DC50s of 4.5 and 1.8 nM, respectively).
  • HY-116852
    Thiocolchicine

    Microtubule/Tubulin Apoptosis Cancer
    Thiocolchicine, a derivative modified in the C Ring of Colchicine (HY-16569) with enhanced biological properties. Thiocolchicine is a potent inhibitor of tubulin polymerization (IC50=2.5 µM) and competitively binds to tubulin with a Ki of 0.7 µM. Thiocolchicine induces cell apoptosis. Thiocolchicine can be used as an ADC cytotoxin in ADC technology.
  • HY-120574
    TH1338

    Others Cancer
    TH1338 (compound 3b), an orally active camptothecin derivative and a potent chemotherapeutic agent for cancer, demonstrates excellent cytotoxic potency against human tumor cell lines in vitro. TH1338 (compound 3b) possesses significant brain penetration, favorable efflux pump properties, and hematological toxicity profile.
  • HY-B0422S
    Nateglinide D5

    A4166 D5; Senaglinide D5

    Potassium Channel Dipeptidyl Peptidase Metabolic Disease
    Nateglinide D5 is a deuterium labeled Nateglinide. Nateglinide, a D-phenylalanine derivative, is an orally active and short-acting insulinotropic agent and a DPP IV inhibitor. Nateglinide inhibits ATP-sensitive K + channels in pancreatic β-cells. Nateglinide is used for the treatment of type 2 (non-insulin-dependent) diabetes mellitus.
  • HY-139409A
    2-Deoxy-D-glucose 6-phosphate disodium

    Others Metabolic Disease
    2-Deoxy-D-glucose 6-phosphate disodium, a derivative of 2-Deoxy-D-glucose, is produced in mammalian cells by the action of hexokinase on 2-DG. 2-Deoxy-D-glucose is a glucose analog that acts as a competitive inhibitor of glucose metabolism, inhibiting glycolysis via its actions on hexokinase.
  • HY-101647A
    Intoplicine dimesylate

    RP 60475 dimesylate

    Topoisomerase Cancer
    Intoplicine (RP 60475) dimesylate, an antitumor derivative in the 7H-benzo[e]pyrido[4,3-b]indole series, is a DNA topoisomerase I and II inhibitor. Intoplicine dimesylate strongly binds DNA (KA = 2 x 10 5 /M) and thereby increases the length of linear DNA.
  • HY-W010231
    β-Cyclocitral

    Others Others
    β-Cyclocitral, a volatile oxidized derivative of β-carotene, is a grazer defence signal unique to the Cyanobacterium Microcystis. β-Cyclocitral, one of the predominant volatile terpenoid compounds, can upregulate the expression of defence genes to enhance excess light (EL) acclimation. β-Cyclocitral is a powerful repellent.
  • HY-130809
    DBCO-PEG4-Biotin

    Others Cancer
    DBCO-PEG4-Biotin is an azadibenzocyclooctyne-biotin derivative containing a biotin group and 4 PEGs. DBCO-PEG4-Biotin is a versatile biotinylation reagent used for the introduction of a biotin moiety to azide-labeled biomolecules via copper-free strain-promoted alkyne-azide click chemistry (SPAAC) reaction.
  • HY-N0069
    Solamargine

    Solamargin; δ-Solanigrine

    P-glycoprotein Apoptosis Cancer
    Solamargine, a derivative from the steroidal solasodine in Solanum species, exhibits anticancer activities in numerous types of cancer. Solamargine induces non-selective cytotoxicity and P-glycoprotein inhibition. Solamargine significantly inhibits migration and invasion of HepG2 cells by down-regulating MMP-2 and MMP-9 expression and activity.
  • HY-70020
    Cevimeline

    AF102B

    mAChR Neurological Disease
    Cevimeline (AF-102B) is a quinuclidine derivative of acetylcholine and a selective and orally active muscarinic M1 and M3 receptor agonist. Cevimeline stimulates secretion by the salivary glands and can be used as a sialogogue for xerostomia. Cevimeline can cross the blood-brain barrier (BBB).
  • HY-131019
    JF-NP-26

    mGluR Neurological Disease
    JF-NP-26, an inactive photocaged derivative of raseglurant, is the first caged mGlu5 receptor negative allosteric modulator. Uncaging of JF-NP-26 is elicited with light pulses in the visible spectrum (405 nm). JF-NP-26 induces light-dependent analgesia in models of inflammatory and neuropathic pain in freely behaving animals.
  • HY-135981
    CMS-121

    Acetyl-CoA Carboxylase Inflammation/Immunology Neurological Disease
    CMS-121 is a quinolone derivative and an orally active acetyl-CoA carboxylase 1 (ACC1) inhibitor. CMS-121 protects HT22 cells against ischemia and oxidative damage with EC50 values of 7 nM and 200 nM, respectively. CMS-121 has strong neuroprotective, anti-inflammatory, antioxidative and renoprotective activities.
  • HY-137756
    JAK2-IN-6

    JAK Cancer
    JAK2-IN-6, a multiple-substituted aminothiazole derivative, is a potent and selective JAK2 inhibitor with an IC50 of 22.86 μg/mL. JAK2-IN-6 shows no activity against JAK1 and JAK3. JAK2-IN-6 has anti-proliferative effect against cancer cells.
  • HY-130442
    Mal-PEG2-acid

    ADC Linker PROTAC Linker Cancer
    Mal-PEG2-acid is a non-cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs). Mal-PEG2-acid can be conjugated to Tubulysin (HY-128914) and its derivative cytotoxic molecule. Mal-PEG2-acid is also a PROTAC linker that can be used in the synthesis of PROTACs.
  • HY-N0367
    Trans-Anethole

    (E)​-Anethole

    Endogenous Metabolite Endocrinology Cancer
    Trans-Anethole ((E)-Anethole), a phenylpropene derivative isolated from Pimpinella, shows estrogenic activity at lower concentrations and cytotoxic at higher concentrations in cancer cell lines. Trans-Anethole ((E)-Anethole) contributes a large component of the odor and flavor of anise and fennel, anise myrtle, liquorice, camphor, magnolia blossoms, and star anise.
  • HY-P1102A
    TC14012 TFA

    CXCR HIV Cancer Infection
    TC14012 TFA, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 TFA is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 TFA has anti-HIV activity and anti-cancer activity.
  • HY-134653
    5-Ph-IAA

    Others Cancer
    5-Ph-IAA is a derivative of IAA. 5-Ph-IAA, a ligand, establishes the auxin-inducible degron 2 (AID2) system together with an OsTIR1 (F74G) mutant. AID2 induces rapid and efficient depletion of mAID-fused proteins to study protein function in living cells, causing tumor suppression.
  • HY-141464
    Fmoc-L-Asn(beta-D-GlcNAc(Ac)3)-OH

    Fmoc-Asn(Ac3AcNH-beta-Glc)-OH

    Others Cancer
    Fmoc-L-Asn(beta-D-GlcNAc(Ac)3)-OH (Fmoc-Asn(Ac3AcNH-beta-Glc)-OH) can be used in the synthesis of silicon-fluoride acceptor (SiFA) derivatized octreotate derivatives. SiFA-octreotate analogues, as tumor imaging agents, are useful tool for the research of positron emission tomography (PET).
  • HY-125841
    EGFR mutant-IN-1

    EGFR Cancer
    EGFR mutant-IN-1, a 5-methylpyrimidopyridone derivative, is a potent and selective EGFR L858R/T790M/C797S mutant inhibitor with an IC50 of 27.5 nM, while being a significantly less potent for EGFR WT (IC50 >1.0 μM).
  • HY-Y0469
    1-Aminohydantoin hydrochloride

    Others Others
    1-Aminohydantoin hydrochloride is a major metabolite of nitrofurantoin in animal tissues and can be used as a standard for the determination of residues of veterinary agents in meat, milk et.al. 1-Aminohydantoin hydrochloride covalently binds to tissue proteins and is released from the tissues under slightly acidic conditions and derivatized with 2-nitrobenzaldehyde to form nitrophenyl derivatives of AHD before detection.
  • HY-12283
    Rostafuroxin

    PST 2238

    Na+/K+ ATPase RSV Cardiovascular Disease
    Rostafuroxin (PST 2238), a digitoxigenin derivative, is an orally active and potent Na +,K +-ATPase (ATP1A1) antognist. Rostafuroxin binds specifically to the ATP1A1 extracellular domain and blocks respiratory syncytial virus (RSV)-triggered EGFR Tyr845 phosphorylation. Rostafuroxin has antihypertensive and anti-RSV activity.
  • HY-N7155
    2,4,7-Trihydroxy-9,10-dihydrophenanthrene

    Reactive Oxygen Species Inflammation/Immunology
    2,4,7-Trihydroxy-9,10-dihydrophenanthrene is a dihydrophenanthrene derivative that can be isolated from the air-dried whole plant of Pholidota chinensis Lindl.. 2,4,7-Trihydroxy-9,10-dihydrophenanthrene shows potent activities of IC50 at 16.2 μM in DPPH radical-scavenging assay.
  • HY-131179
    Influenza A virus-IN-1

    Influenza Virus Infection
    Influenza A virus-IN-1 is a dihydropyrrolidones derivative and is a potent inhibitor against wide subtypes of influenza A virus (IAV) with IC50 values from 3.11 μM to 7.13 μM. Influenza A virus-IN-1 efficiently inhibits replication of IAV, up-regulates the expression of key antiviral cytokines IFN-β and antiviral protein MxA.
  • HY-106019C
    Liarozole dihydrochloride

    R75251 dihydrochloride

    Cytochrome P450 RAR/RXR Cancer Metabolic Disease Inflammation/Immunology
    Liarozole (R75251) dihydrochloride is an imidazole derivative and orally active retinoic acid (RA) metabolism-blocking agent (RAMBA). Liarozole dihydrochloride inhibits the cytochrome P450 (CYP26)-dependent 4-hydroxylation of RA (IC50=7 μM), resulting in increased tissue levels of RA. Liarozole dihydrochloride shows antitumoral properties.
  • HY-113056A
    N1-Acetylspermidine hydrochloride

    Endogenous Metabolite Cancer
    N1-Acetylspermidine hydrochloride is an acetyl derivative of polyamine. N1-acetylspermine is the substrate for the polyamine oxidase (PAO). N1-Acetylspermidine hydrochloride selectively elevates its level in human colorectal adenocarcinomas. N1-acetylspermidine shows cleavage efficiency at apurinic sites in DNA.
  • HY-137817
    BCH001

    DNA/RNA Synthesis Metabolic Disease
    BCH001, a quinoline derivative, is a specific PAPD5 inhibitor. BCH001 restores telomerase activity and telomere length in dyskeratosis congenita (DC) induced pluripotent stem cells. BCH001 shows no inhibition of poly(A)-specific ribonuclease (PARN) or several other canonical and non-canonical polynucleotide polymerases. BCH001 is used to regulate aging.
  • HY-N6023
    Thermopsoside

    Cytochrome P450 Others
    Thermopsoside is a flavone derivative isolated from Aspalathus linearis. Thermopsoside exhibits inhibitory effects on CYP450 isozymes with IC50 values of 6.0 μM, 9.5 μM, 12.0 μM, 32.0 μM, for CYP3A4, CYP2C19, CYP2D6 and CYP2C9, respectively.
  • HY-135810
    Cletoquine

    Desethylhydroxychloroquine

    Influenza Virus Parasite Infection Inflammation/Immunology
    Cletoquine (Desethylhydroxychloroquine) is a major active metabolite of Hydroxychloroquine. Cletoquine is produced in the liver by CYP2D6, CYP3A4, CYP3A5, and CYP2C8 isoenzymes. Cletoquine is also a Chloroquine derivative and has the ability to against the chikungunya virus (CHIKV). Cletoquine has antimalarial effects and has the potential for autoimmune diseases treatment.
  • HY-N1434
    Methyl p-coumarate

    Methyl 4-hydroxycinnamate

    Fungal Cancer Infection
    Methyl p-coumarate (Methyl 4-hydroxycinnamate), an esterified derivative of p-Coumaric acid (pCA), is isolated from the flower of Trixis michuacana var longifolia. Methyl p-coumarate could inhibit the melanin formation in B16 mouse melanoma cells. Methyl p-coumarate also has strong in vitro inhibitory effect on A. alternata and other pathogens.
  • HY-135954A
    PDK4-IN-1 hydrochloride

    PDHK Apoptosis Cancer Metabolic Disease Inflammation/Immunology
    PDK4-IN-1 hydrochloride is an anthraquinone derivative and a potent and orally active pyruvate dehydrogenase kinase 4 (PDK4) inhibitor with an IC50 value of 84 nM. PDK4-IN-1 hydrochloride potently represses cellular transformation and cellular proliferation and induces apoptosis. PDK4-IN-1 hydrochloride has antidiabetic, anticancer and anti-allergic activity.
  • HY-136153
    Amphotericin X1

    Fungal Infection
    Amphotericin X1 is an 13-O-methyl derivative of Amphotericin B with good antifungal activity. Amphotericin X1 inhibits Candida albicans 33/079, C.parapsilosis 937A, Cryptococcus neoformans 451, Aspergillus niger 57A and A.fumigatus with MIC values of 1 μg/mL, 8 μg/mL, 1 μg/mL, 2 μg/mL and 2 μg/mL, respectively.
  • HY-103193
    NKH477

    Colforsin dapropate hydrochloride

    Adenylate Cyclase Cardiovascular Disease
    NKH477 (Colforsin dapropate hydrochloride) directly activates the catalytic unit of adenylate cyclase and increases intracellular cAMP. NKH477 is a forskolin derivative that improves cardiac failure mainly through its beneficial effects on diastolic cardiac function. NKH477 exerts an antiproliferative effect in vivo with an altered cytokine profile to inhibit the acute rejection of rat orthotopic lung allografts.
  • HY-B0956
    Paromomycin sulfate

    Aminosidine sulfate

    Antibiotic Parasite Bacterial Infection
    Paromomycin (Aminosidine) sulfate, a neomycin (HY-B0470) derivative, is a broad spectrum aminoglycoside antibiotic with amebicidal and bactericidal effects. Paromomycin sulfate prematures termination of translation of mRNA and inhibits protein synthesis by specifically binds to the RNA oligonucleotide at the A site of bacterial 30S ribosomes. Paromomycin sulfate can be used for the research of bacterial and parasitic infections.
  • HY-106019
    Liarozole

    R75251

    Cytochrome P450 RAR/RXR Cancer Metabolic Disease Inflammation/Immunology
    Liarozole (R75251; R85246) is an imidazole derivative and orally active retinoic acid (RA) metabolism-blocking agent (RAMBA). Liarozole inhibits the cytochrome P450 (CYP26)-dependent 4-hydroxylation of retinoic acid (IC50=7 μM), resulting in increased tissue levels of retinoic acid. Liarozole shows antitumoral properties.
  • HY-107412
    Proteasome inhibitor IX

    PS-IX; AM114

    Proteasome Cancer
    Proteasome inhibitor IX (PS-IX; AM114) is a Chalcone derivative and a chymotrypsin-like activity of the 20S proteasome inhibitor with an IC50 value of ~1 μM. Proteasome inhibitor IX exhibits HCT116 p53 +/+ cells growth inhibitory activity with an IC50 value of 1.49 μM. Proteasome inhibitor IX has potent anticancer activity.
  • HY-122643
    NITD-916

    Bacterial Infection
    NITD-916, a 4-hydroxy-2-pyridone derivative, is an orally active and highly lipophilic mycobacterial enoyl reductase InhA inhibitor with an IC50 of 570 nM. NITD-916 forms a ternary complex with InhA and NADH to block access to the fatty acyl substrate binding pocket. NITD-916 has potent anti-tuberculosis effects.
  • HY-112769
    EX229

    AMPK Metabolic Disease
    EX229, a Benzimidazole derivative, is a potent and allosteric activator of AMP-activated protein kinase (AMPK), with Kds of 0.06 μM, 0.06 μM and 0.51 μM for α1β1γ1, α2β1γ1 and α1β2γ1 in biolayer interferometry, respectively.
  • HY-N0061
    Ethyl ferulate

    Reactive Oxygen Species Neurological Disease
    Ethyl ferulate, a naturally lipophilic derivative of ferulic acid originally derived from giant fennel (F. communis), induces heme oxygenase-1 (HO-1) and protects rat neurons against oxidative stress. Ethyl ferulate also protects neurons against amyloid β peptide (1-42)-induced oxidative stress and neurotoxicity.
  • HY-100028
    AT-130

    HBV DNA/RNA Synthesis Cancer Infection
    AT-130, a phenylpropenamide derivative, is a potent hepatitis B virus (HBV) replication non-nucleoside inhibitor. AT-130 inhibits the viral DNA synthesis with an EC50 of 0.13 μM. AT-130 inhibits both wt and mutant HBVs. AT-130 has anti-HBV activity in hepatoma cells.
  • HY-N0747
    Oxypeucedanin

    Potassium Channel Cancer Cardiovascular Disease
    Oxypeucedanin is a furocoumarin derivative isolated from Angelica dahurica. Oxypeucedanin is a selective open-channel blocker, inhibits the hKv1.5 current with an IC50 value of 76 nM. Oxypeucedanin prolongs cardiac action potential duration (APD), is a potential antiarrhythmic agent for atrial fibrillation. Oxypeucedanin induces cell apoptosis through inhibition of cancer cell migration.
  • HY-109714
    3,4-Benzocoumarin

    Others Inflammation/Immunology
    3,4-Benzocoumarin is a kind of the expanded structure of coumarin derivatives.Coumarin is a chemical compound in the benzopyrone chemical class that can be found in many natural species. Coumarins possess variety of biological activities and unique photophysical properties. 3,4-Benzocoumarin, a AOH‐like compound , has the sensibility of the antibody with an IC50 of 919.2 ng/mL.
  • HY-136093
    HL271

    IM156 hydrochloride; HL156A hydrochloride

    AMPK Cancer Neurological Disease
    HL271 (IM156 hydrochloride; HL156A hydrochloride), a chemical derivative of Metformin (HY-B0627), is a potent AMPK activator that increases AMPK phosphorylation. HL271 attenuates aging-associated cognitive impairment in animal model. HL271 is a potent oxidative phosphorylation (OXPHOS) inhibitor which can be used for the research of solid tumors.
  • HY-138660
    HM-JF526 NHS

    Others Others
    HM-JF526 NHS is a derivative of hydroxymethyl JF526 (HM-JF526). SMLM (single-molecule localization microscopy) imaging in standard phosphate-buffered saline (pH 7.4) revealed that the HM-JF526 label showed spontaneous blinking behavior throughout the imaging session and did not require short-wavelength activation light.
  • HY-135954
    PDK4-IN-1

    PDHK Apoptosis Cancer Metabolic Disease Inflammation/Immunology
    PDK4-IN-1 is an anthraquinone derivative and a potent and orally active pyruvate dehydrogenase kinase 4 (PDK4) inhibitor with an IC50 value of 84 nM. PDK4-IN-1 potently represses cellular transformation and cellular proliferation and induces apoptosis. PDK4-IN-1 has antidiabetic, anticancer and anti-allergic activity.
  • HY-D0128
    4-Methylherniarin

    7-Methoxy-4-methylcoumarin

    Bacterial Infection
    4-Methylherniarin (7-Methoxy-4-methylcoumarin) is a coumarin derivative and fluorescent label, has an antimicrobial activitiy against both gram positive and gram negative bacterial stains. 4-Methylherniarin displays good activity against B. subtilis and S.sonnei with IC50 values of 11.76 μg/ml and 13.47 μg/ml.
  • HY-137315
    TML-6

    Amyloid-β NF-κB mTOR Keap1-Nrf2 Neurological Disease
    TML-6, an orally active curcumin derivative, inhibits the synthesis of the β-amyloid precursor protein and β-amyloid (Aβ). TML-6 can upregulate Apo E, suppress NF-κB and mTOR, and increase the activity of the anti-oxidative Nrf2 gene. TML-6 has the potential for Alzheimer’s disease (AD) research.
  • HY-B0185A
    Lidocaine hydrochloride

    Lignocaine hydrochloride

    Sodium Channel MEK ERK NF-κB Apoptosis Cancer Cardiovascular Disease
    Lidocaine hydrochloride (Lignocaine hydrochloride) inhibits sodium channels involving complex voltage and using dependence. Lidocaine hydrochloride decreases growth, migration and invasion of gastric carcinoma cells via up-regulating miR-145 expression and further inactivation of MEK/ERK and NF-κB signaling pathways. Lidocaine hydrochloride is an amide derivative commonly used to anesthetize. hydrochloride is a a drug to treat ventricular arrhythmia and an effective tumor-inhibitor.
  • HY-12137A
    Volasertib trihydrochloride

    BI 6727 trihydrochloride

    Polo-like Kinase (PLK) Apoptosis Cancer
    Volasertib (BI 6727) trihydrochloride is an orally active, highly potent and ATP-competitive Polo-like kinase 1 (PLK1) inhibitor with an IC50 of 0.87 nM. Volasertib trihydrochloride inhibits PLK2 and PLK3 with IC50s of 5 and 56 nM, respectively. Volasertib trihydrochloride induces mitotic arrest and apoptosis. Volasertib trihydrochloride, a dihydropteridinone derivative, shows marked antitumor activity in multiple cancer models.
  • HY-109562A
    GRK2-IN-1 hydrochloride

    Others Cardiovascular Disease
    GRKs-IN-1 hydrochloride, Compound 14as, has remarkable potency against and selectivity for G protein-coupled receptor kinase 2 GRK2 (IC50=130 nM) and GRK5 (IC50=7.1 μM). GRKs-IN-1 hydrochloride is a derivative 14as of paroxetine, shows a 100-fold improvement in cardiomyocyte contractility assays over paroxetine.
  • HY-N1391
    10-Deacetyltaxol

    10-Deacetylpaclitaxel

    Microtubule/Tubulin Cancer
    10-Deacetyltaxol (10-Deacetylpaclitaxel) is a taxane derivative isolated from Taxus wallichiana Zucc. 10-Deacetyltaxol (10-Deacetylpaclitaxel) promotes the polymerization of tubulin and to inhibit the depolymerization of microtubules induced by cold or by calcium ions in vitro. 10-Deacetyltaxol (10-Deacetylpaclitaxel) exhibits cytotoxicity in human glial and neuroblastoma cell-lines.
  • HY-136093A
    IM156

    HL156A; HL271 acetate

    AMPK Cancer Neurological Disease
    IM156 (HL156A; HL271 acetate), a chemical derivative of Metformin (HY-B0627), is a potent and orally active AMPK activator that increases AMPK phosphorylation. IM156 attenuates aging-associated cognitive impairment in animal model. IM156 is a potent oxidative phosphorylation (OXPHOS) inhibitor which can be used for the research of solid tumors.
  • HY-12137
    Volasertib

    BI 6727

    Polo-like Kinase (PLK) Apoptosis Cancer
    Volasertib (BI 6727) is an orally active, highly potent and ATP-competitive Polo-like kinase 1 (PLK1) inhibitor with an IC50 of 0.87 nM. Volasertib inhibits PLK2 and PLK3 with IC50s of 5 and 56 nM, respectively. Volasertib induces mitotic arrest and apoptosis. Volasertib, a dihydropteridinone derivative, shows marked antitumor activity in multiple cancer models.
  • HY-109562
    GRK2-IN-1

    Others Cardiovascular Disease
    GRKs-IN-1, Compound 14as, has remarkable potency against and selectivity for G protein-coupled receptor kinase 2 GRK2 (IC50=30 nM) and GRK5 (IC50=7.1 μM). GRKs-IN-1 is a derivative 14as of paroxetine, shows a 100-fold improvement in cardiomyocyte contractility assays over paroxetine.
  • HY-103118
    PU02

    5-HT Receptor Apoptosis Cancer Neurological Disease
    PU02, a derivative of 6-MP (HY-13677), is a negative allosteric modulator (NAM) of 5-HT3 receptor, with IC50 values of 0.36 and 0.73 μM in HEK293 cells transfected with human 5-HT3A and 5-HT3AB receptors respectively.
  • HY-101931
    hVEGF-IN-1

    VEGFR Cancer
    hVEGF-IN-1, a quinazoline derivative, could specifically bind to the G-rich sequence in the internal ribosome entry site A (IRES-A) and destabilize the G-quadruplex structure. hVEGF-IN-1 binds to the IRES-A (WT) with a Kd of 0.928 μM in SPR experiments. hVEGF-IN-1 could hinder tumor cells migration and repress tumor growth by decreasing VEGF-A protein expression.
  • HY-N0761
    Isoferulic acid

    3-Hydroxy-4-methoxycinnamic acid

    Adrenergic Receptor Influenza Virus Infection Endocrinology Metabolic Disease
    Isoferulic acid (3-Hydroxy-4-methoxycinnamic acid) is a cinnamic acid derivative that has antidiabetic activity. Isoferulic acid binds to and activates α1-adrenergic receptors (IC50=1.4 µM) to enhance secretion of β-endorphin (EC50=52.2 nM) and increase glucose use. Isoferulic acid also has anti-influenza virus activities.
  • HY-135969
    Glycol chitosan

    Bacterial Infection
    Glycol chitosan is a chitosan derivative with ethylene glycol branches. Glycol chitosan enhances membrane permeability and leadkage in Glycine max Harosoy 63W cells. Glycol chitosan is biocompatible and biodegradable. Glycol chitosan inhibits E. coli, S. aureus and S. enteritidis growths with MIC values of 4 μg/mL, 32 μg/mL and <0.5 μg/mL, respectively.
  • HY-101311
    UPF-523

    AIDA

    mGluR Inflammation/Immunology
    UPF-523 (AIDA), a rigid (carboxyphenyl) glycine derivative, is a relatively potent and selective antagonist of group I metabotropic glutamate receptors (mGlu1a) with an IC50 of 214 μM. But UPF-523 has no effect on group II (mGlu2), group III (mGlu4) receptors or ionotropic glutamate receptors. UPF-523 has the potential for the research of the acute arthritis.
  • HY-B0024S
    Prulifloxacin-d8

    Bacterial Antibiotic Infection
    Prulifloxacin-d8 (NM441-d8) is the deuterium labeled Prulifloxacin. Prulifloxacin (NM441) is an orally active fluoroquinolone antibiotic with a broad spectrum of activity against Gram-positive and -negative bacteria. Prulifloxacin is a prodrug of a thiazeto-quinoline carboxylic acid derivative Ulifloxacin (NM394). Prulifloxacin has the potential for lower urinary tract infections and exacerbations of chronic bronchitis.
  • HY-135810A
    Cletoquine oxalate

    Desethylhydroxychloroquine oxalate

    Influenza Virus Parasite Infection Inflammation/Immunology
    Cletoquine oxalate (Desethylhydroxychloroquine oxalate) is a major active metabolite of Hydroxychloroquine. Cletoquine oxalate is produced in the liver by CYP2D6, CYP3A4, CYP3A5, and CYP2C8 isoenzymes. Cletoquine oxalate is also a Chloroquine derivative and has the ability to against the chikungunya virus (CHIKV). Cletoquine oxalate has antimalarial effects and has the potential for autoimmune diseases treatment.
  • HY-13295
    Vinpocetine

    Ethyl apovincaminate

    Sodium Channel IKK Phosphodiesterase (PDE) Inflammation/Immunology Neurological Disease Cardiovascular Disease Cancer
    Vinpocetine (Ethyl apovincaminate) is a derivative of the alkaloid Vincamine that blocks voltage-gated Na + channels. The IC50 value of Vinpocetine on direct IKK inhibition in the cell-free system is 17.17 μM. Vinpocetine is a phosphodiesterase (PDE) inhibitor and inhibits NF-κB-dependent inflammatory responses by directly targeting IκB kinase complex (IKK), and has been widely used for the treatment of cerebrovascular disorders.
  • HY-B0185
    Lidocaine

    Lignocaine

    Sodium Channel MEK ERK NF-κB Apoptosis Cancer Cardiovascular Disease
    Lidocaine (Lignocaine) inhibits sodium channels involving complex voltage and using dependence. Lidocaine decreases growth, migration and invasion of gastric carcinoma cells via up-regulating miR-145 expression and further inactivation of MEK/ERK and NF-κB signaling pathways. Lidocaine is an amide derivative commonly used to anesthetize. Lidocaine is a drug to treat ventricular arrhythmia and an effective tumor-inhibitor.
  • HY-15236S
    PSI-6206 13CD3

    RO-2433 13CD3; GS-331007 13CD3; Sofosbuvir metabolite GS-331007 13CD3

    HCV Infection
    PSI-6206 13CD3 is the deuterium labeled PSI-6206. PSI-6206 is the deaminated derivative of PSI-6130, which is a potent and selective inhibitor of HCV NS5B polymerase. PSI-6206 low potently inhibits HCV replicon with EC90 of >100 μM.
  • HY-N6652
    1-beta-D-Arabinofuranosyluracil

    Uracil 1-β-D-arabinofuranoside

    Others Cancer Inflammation/Immunology Cardiovascular Disease
    1-beta-D-Arabinofuranosyluracil (Uracil 1-β-D-arabinofuranoside) isolated from the Caribbean sponge Tectitethya crypta, is a methoxyadenosine derivative. 1-beta-D-Arabinofuranosyluracil has demonstrated a diverse bioactivity profile including anti-inflammatory activity, analgesic and vasodilation properties. 1-beta-D-Arabinofuranosyluracil reduces a proliferation of mouse lymphoma cells.
  • HY-N0678
    Icaritin

    Anhydroicaritin

    Autophagy Apoptosis Cancer
    Icaritin (Anhydroicaritin) is a prenylflavonoid derivative from Epimedium Genusis and potently inhibits proliferation of K562 cells (IC50 of 8 µM) and primary CML cells (IC50 of 13.4 µM for CML-CP and 18 µM for CML-BC). Icaritin can regulate MAPK/ERK/JNK and JAK2/STAT3 /AKT signalings, also enhances osteogenesis[3.
  • HY-111875
    SNIPER(BRD)-1

    SNIPER Epigenetic Reader Domain Cancer
    SNIPER(BRD)-1, consists of an IAP antagonist LCL-161 derivative and a BET inhibitor, (+)-JQ-1, connected by a linker. SNIPER(BRD)-1 induces the degradation of BRD4 via the ubiquitin-proteasome pathway. SNIPER(BRD)-1 also degrades cIAP1 , cIAP2 and XIAP with IC50s of 6.8 nM, 17 nM, and 49nM, respectively.
  • HY-A0016
    Dronedarone

    SR 33589

    mAChR Sodium Channel Calcium Channel Adrenergic Receptor Cytochrome P450 Autophagy Cardiovascular Disease
    Dronedarone (SR 33589), a derivative of amiodarone (HY-14187), is a class III antiarrhythmic agent for the study of atrial fibrillation (AF) and atrial flutter. Dronedarone is a potent blocker of multiple ion currents, including potassium current, sodium current, and L-type calcium current, and exhibits antiadrenergic effects by noncompetitive binding to β-adrenergic receptors. Dronedarone is a substrate for and a moderate inhibitor of CYP3A4.
  • HY-133036
    APJ receptor agonist 1

    Others Cardiovascular Disease
    APJ receptor agonist 1, a biphenyl acid derivative, is a potent APJ receptor (APJ-R) agonist (EC50s 0.093 and 0.12 nM for human and rat APJ-R, respectively). APJ receptor agonist 1 displays in vitro potency to apelin-13, the endogenous peptidic ligand for the APJ receptor. APJ receptor agonist 1 has the potential for the research of heart failure.
  • HY-N2500
    Deoxypodophyllotoxin

    Microtubule/Tubulin Apoptosis Autophagy Infection Cardiovascular Disease
    Deoxypodophyllotoxin (DPT), a derivative of podophyllotoxin, is a lignan with potent antimitotic, anti-inflammatory and antiviral properties isolated from rhizomes of Sinopodophullumhexandrum (Berberidaceae). Deoxypodophyllotoxin, targets the microtubule, has a major impact in oncology not only as anti-mitotics but also as potent inhibitors of angiogenesis. Deoxypodophyllotoxin induces cell autophagy and apoptosis. Deoxypodophyllotoxin evokes increase of intracellular Ca 2+ concentrations in DRG neurons.
  • HY-124308
    PS315

    PKC Cancer
    PS315, a derivative of PS48 (HY-15967), is an allosteric PKC inhibitor by binding to the PIF-pocket of aPKC and inducing a displacement of the active site residue Lys111. PS315 inhibits the full-length and catalytic domain constructs of PKCζ (IC50=10 μM) and PKCη (IC50=30 μM). PS315 has anti-cancer activity.
  • HY-134622
    GSK-3/CDK5/CDK2-IN-1

    CDK GSK-3 Cancer Neurological Disease
    GSK-3/CDK5/CDK2-IN-1, an imidazole derivative, is an inhibitor of cdk5, cdk2, and GSK-3 extracted from patent WO2002010141A1, example 9a. GSK-3/CDK5/CDK2-IN-1 can be used for the research of cancer, and neurodegenerative diseases.
  • HY-112898
    DC1SMe

    ADC Cytotoxin Cancer
    DC1Sme, a DC1 derivative, exhibits IC50 values of 22 pM, 10 pM, 32 pM and 250 pM for Ramos, Namalwa, HL60/s and COLO 205 cancer cells, respectively. DC1, an analogue of the minor groove-binding DNA alkylator CC-1065, is a ADC Cytotoxin. DC1 can be used in synthesis of antibody-drug conjugates for the targeted treatment of cancer.
  • HY-128895
    KL1333

    Mitochondrial Metabolism Metabolic Disease
    KL1333, a derivative of β-lapachone, is an orally available NAD+ modulator. KL1333 reacts with NAD(P)H:quinone oxidoreductase 1 (NQO1) as a substrate, resulting in increases in intracellular NAD+ levels via NADH oxidation. KL1333 improves energy metabolism and mitochondrial dysfunction in MELAS fibroblasts. KL1333 protects against Cisplatin-induced ototoxicity in mouse cochlear cultures.
  • HY-120373
    MB710

    MDM-2/p53 Cancer
    MB710, an aminobenzothiazole derivative, is a stabilizer of oncogenic p53 mutation Y220C. MB710 binds tightly to the Y220C pocket and stabilizes p53-Y220C, with a Kd of 4.1 μM. MB710 shows anticancer activity in p53-Y220C cell lines.
  • HY-120400
    KDM5-C70

    Histone Demethylase Cancer
    KDM5-C70 is an ethyl ester derivative of KDM5-C49 and a potent, cell-permeable and pan-KDM5 histone demethylase inhibitor. KDM5-C70 has an antiproliferative effect in myeloma cells, leading to genome-wide elevation of H3K4me3 levels.
  • HY-135218
    AV-153

    DNA/RNA Synthesis Cancer
    AV-153, a 1,4-dihydropyridine (1,4-DHP) derivative, is an antimutagenic. AV-153 intercalates to DNA in a single strand break and reduces DNA damage, stimulates DNA repair in human cells in vitro. AV-153 interacts with thymine and cytosine and has an influence on poly(ADP)ribosylation. AV-153 has anti-cancer activity.
  • HY-119309
    Sucrose octaacetate

    Others Others
    Sucrose octaacetate is an acetylated derivative of sucrose with an intensely bitter tasting and can be used as bitter tasting surrogate. Sucrose octaacetate can be used as food additive and also used as an adhesive and plasticizer. Sucrose octaacetate also used in many pesticides, insecticides, and other toxic products as a deterrent to accidental poisoning. Sucrose octaacetate can also be used as an in situ seed and a soft template to synthesize polyaniline (PANI) nanofibers.
  • HY-106634
    Mitoguazone

    Methylglyoxal-bis(guanylhydrazone); MGBG; Methyl-GAG

    HIV Apoptosis Cancer Infection
    Mitoguazone (Methylglyoxal-bis(guanylhydrazone)) is a synthetic polycarbonyl derivative with potent antineoplastic activity. Mitoguazone is a brain-penetrant and competitive S-adenosyl-methionine decarboxylase (SAMDC) inhibitor that disrupts polyamine biosynthesis. Mitoguazone induces cell apoptosis. Mitoguazone inhibits HIV DNA integration into the cellular DNA in both monocytes and macrophages. Mitoguazone has the potential for acute leukemia, Hodgkin's and non-Hodgkin's lymphoma treatment.
  • HY-N5132
    (-)-Fenchone

    Others Others
    (-)-Fenchone, a bicyclic monoterpene, is widely distributed in plants and found in essential oils from Thuja occidentalis. (-)-Fenchone is oxidized to 6-endo-hydroxyfenchone, 6-exo-hydroxyfenchone and 10-hydroxyfenchone derivatives by CYP2A6 and CYP2B6 in human liver microsomes with CYP2A6 playing a more important role than CYP2B6.
  • HY-N0548
    α-Angelica lactone

    Gutathione S-transferase Cancer
    α-Angelica lactone is a naturally occurring anticarcinogen and an vinylogous nucleophile. α-Angelica lactone can give the chiral δ-amino γ,γ-disubstituted butenolide carbonyl derivatives and exhibitselectrophilic trapping at the γ-carbon. α-Angelica lactone exerts strong chemoprotective effects by selective enhancement of glutathione-S-thansferase (GST) and UDP-glucononosyltransferase (UGT) detoxification enzymes.
  • HY-111817
    ACT-451840

    Parasite Infection
    ACT-451840 is an orally active, potent and low-toxicity compound, showing activity against sensitive and resistant plasmodium falciparum strains. ACT-451840 targets all asexual blood stages of the parasite, has a rapid onset of action. ACT-451840 behaves in a way similar to artemisinin derivatives, with very rapid onset of action and elimination of parasite. ACT-451840 can be used for the research of malarial.
  • HY-132334S
    9-cis-Retinoic acid-d5

    RAR/RXR Apoptosis Cancer Inflammation/Immunology Neurological Disease
    9-cis-Retinoic acid-d5 (ALRT1057-d5) is the deuterium labeled 9-cis-Retinoic acid. 9-cis-Retinoic acid (ALRT1057), a vitamin A derivative, is a potent RAR/RXR agonist. 9-cis-Retinoic acid induces apoptosis, regulates cell cycle and has anticancer, anti-inflammatory and neuroprotection activities.
  • HY-135595
    6-Raloxifene-β-D-glucopyranoside

    Estrogen Receptor/ERR Drug Metabolite Metabolic Disease
    6-Raloxifene-β-D-glucopyranoside, a derivative of Raloxifene, is a benzothiophene glucuronidated at the 6' postion. 6-Raloxifene-β-D-glucopyranoside is a selective and orally active estrogen receptor antagonist. 6-Raloxifene-β-D-glucopyranoside can be used for inhibiting bone loss and resorption, and lowering lipid levels. 6'-Raloxifene-β-D-glucopyranoside, compound Ia, is extracted from patent US5567820A.
  • HY-N5081
    1αH,5αH-Guaia-6-ene-4β,10β-diol

    Others Cancer
    1αH,5αH-Guaia-6-ene-4β,10β-diol is a sesquiterpenoid derivative identified from Alisma orientale. 1αH,5αH-Guaia-6-ene-4β,10β-diol has anti-cancer activities.
  • HY-124652
    TBK1/IKKε-IN-4

    IKK Cancer
    TBK1/IKKε-IN-4 is a 6-aminopyrazolopyrimidine derivative and a potent, selective TBK1 and IKKε inhibitor with IC50 values of 13 nM and 59 nM, respectively. TBK1/IKKε-IN-4 shows 100- to 1000-fold less activity against other protein kinases including PDK1, PI3K family members and mTOR.
  • HY-106387
    Dexanabinol

    HU-211

    NF-κB TNF Receptor Interleukin Related Neurological Disease
    Dexanabinol (HU-211) is an artificially synthesized cannabinoid derivative and lacks cannabimimetic effects. Dexanabinol exhibits not only the antioxidant and neuroprotective activities in brain but also anti-inflammatory activity by inhibiting NF-κB and decreasing cytokines such as TNFα and interleukin-6, which could ensure the integrity of BBB and reduce cell apoptosis and death. Dexanabinol is widely used in head injury or stroke treatment and has been shown to be safe in animals and humans.
  • HY-117026
    LKY-047

    Cytochrome P450 Metabolic Disease Inflammation/Immunology
    LKY-047, a Decursin derivative, is a potent and selective reversible competitive cytochrome P45022J2 (CYP2J2) inhibitor with an IC50 of 1.7 μM. LKY-047 is inactive against other human P450s, such as CYPs 1A2, 2A6, 2B6, 2C8, 2C9, 2C19, 2D6, 2E1, and 3A.
  • HY-18346
    Mozavaptan

    OPC-31260

    Vasopressin Receptor Cancer Endocrinology Metabolic Disease
    Mozavaptan (OPC-31260) is a benzazepine derivative and a potent, selective, competitive and orally active vasopressin V2 receptor antagonist with an IC50 of 14 nM. Mozavaptan shows ~85-fold selectivity for V2 receptor over V1 receptor (IC50 of 1.2 μM), and can antagonize the antidiuretic action of arginine vasopressin (AVP) in vivo. Mozavaptan has the potential for hyponatremia, syndrome of inappropriate antidiuretic hormone (SIADH), and congestive heart failure treatment.
  • HY-N6851
    Glycyrrhetic acid 3-O-β-D-glucuronide

    Others Inflammation/Immunology
    Glycyrrhetic acid 3-O-β-D-glucuronide, isolated from glycyrrhiza, is an important derivative of glycyrrhizin (GL) with an anti -allergic activity. Glycyrrhetic acid 3-O-β-D-glucuronide (GAMG) shows that β‐glucuronidases (β‐GUS) are key GAMG-producing enzymes, displaying a high potential to convert GL directly into GAMG.Glycyrrhetic acid 3-O-β-D-glucuronide is valuable as a sweetener.
  • HY-136314
    DBCO-PEG4-VC-PAB-MMAE

    Drug-Linker Conjugates for ADC Cancer
    DBCO-PEG4-VC-PAB-MMAE consists a ADC linker (DBCO-PEG4-VC-PAB) and a tubulin polymerization inhibitor MMAE (HY-15162). DBCO-PEG4-VC-PAB-MMAE can be used in the synthesis of antibody-drug conjugates (ADCs). MMAE is a synthetic derivative of dolastatin 10 and functions as a potent mitotic inhibitor by inhibiting tubulin polymerization.
  • HY-130851
    HS-27

    HSP Cancer
    HS-27, a fluorescently-tethered Hsp90 inhibitor, assays surface Hsp90 expression on intact tissue specimens. HS-27 is made up of the core elements of SNX-5422, an Hsp90 inhibitor, tethered via a PEG linker to a fluorescein derivative (fluorescein isothiocyanate or FITC), that binds to ectopically expressed Hsp90. HS-27 has potential use in a see-and-treat paradigm in breast cancer.
  • HY-130983
    N-piperidine Ibrutinib hydrochloride

    Btk Ligand for Target Protein for PROTAC Cancer
    N-piperidine Ibrutinib hydrochloride (Compound 1) is a reversible Ibrutinib derivative. N-piperidine Ibrutinib hydrochloride is a potent BTK inhibitor with IC50s of 51.0 and 30.7 nM for WT BTK and C481S BTK, respectively. N-piperidine Ibrutinib hydrochloride can be used as a BTK ligand in the synthesis of a series of PROTACs, such as SJF620 (HY-133137). SJF620 is a potent PROTAC BTK degrader with a DC50 of 7.9 nM.
  • HY-15978
    P7C3-A20

    Others Neurological Disease
    P7C3-A20 is a derivative of P7C3 with potent proneurogenic and neuroprotective activity. P7C3-A20 exerts an antidepressant-like effect. P7C3-A20 can cross the blood-brain barrier and therefore has the potential for brain injury treatment.
  • HY-N2348
    Tubulysin D

    Microtubule/Tubulin Apoptosis Cancer
    Tubulysin D is one of the most potent derivatives among the tubulysins isolated from the myxobacterial species Archangium geophyra and Angiococcus disciformis. Tubulysin D is a novel tetrapeptide that displays potent antitumor activity and leads to cell cycle arrest and apoptosis by inhibiting tubulin polymerization with an IC50 of 1.7 μM. Tubulysin displays extremely potent cytotoxic activity in mammalian cells, including multidrug-resistant cell lines, with IC50 values in the lower nanomolar range.
  • HY-A0016S
    Dronedarone D6 hydrochloride

    mAChR Sodium Channel Calcium Channel Adrenergic Receptor Cytochrome P450 Autophagy Cardiovascular Disease
    Dronedarone D6 hydrochloride is the deuterium labeled Dronedarone. Dronedarone hydrochloride, a derivative of Amiodarone (HY-14187), is a class III antiarrhythmic agent for the study of atrial fibrillation (AF) and atrial flutter. Dronedarone hydrochloride is a potent blocker of multiple ion currents, including potassium current, sodium current, and L-type calcium current, and exhibits antiadrenergic effects by noncompetitive binding to β-adrenergic receptors. Dronedarone hydrochloride is a substrate for and a moderate inhibitor of CYP3A4.
  • HY-W018643
    Ferulic acid methyl ester

    Methyl ferulate

    p38 MAPK Autophagy Inflammation/Immunology Neurological Disease Cancer
    Ferulic acid methyl ester (Methyl ferulate) is a derivative of ferulic acid, isolated from Stemona tuberosa, with anti-inflammatory and antioxidant properties. Ferulic acid methyl ester is a cell membrane and brain permeable compound, shows free radical scavenging ability, used in the research of neurodegenerative disorders. Ferulic acid methyl ester inhibits COX-2 expression, blocks p-p38 and p-JNK in primary bone marrow derived-macrophages.
  • HY-123593
    Mozavaptan hydrochloride

    OPC-31260 hydrochloride

    Vasopressin Receptor Cancer Endocrinology Metabolic Disease
    Mozavaptan hydrochloride (OPC-31260 hydrochloride) is a benzazepine derivative and a potent, selective, competitive and orally active vasopressin V2 receptor antagonist with an IC50 of 14 nM. Mozavaptan hydrochloride shows ~85-fold selectivity for V2 receptor over V1 receptor (IC50 of 1.2 μM), and can antagonize the antidiuretic action of arginine vasopressin (AVP) in vivo. Mozavaptan hydrochloride has the potential for hyponatremia, syndrome of inappropriate antidiuretic hormone (SIADH), and congestive heart failure treatment.
  • HY-19340
    TMS

    (E)-2,3',4,5'-tetramethoxystilbene

    Cytochrome P450 Cancer
    TMS ((E)-2,3',4,5'-tetramethoxystilbene) is a selective and competitive CYP1B1 inhibitor with an IC50 of 6 nM and a Ki value of 3 nM. TMS shows a lesser extent inhibitory effect on CYP1A1 (IC5050derivative of resveratrol and has anti-cancer activity.
  • HY-B0837
    Emamectin Benzoate

    MK-244

    Parasite GABA Receptor Reactive Oxygen Species Apoptosis Infection Neurological Disease
    Emamectin Benzoate (MK-244) is an orally active nervoussystem toxicant by binding g-aminobutyric (GABA) receptor in insects. Emamectin Benzoate is one of semi-synthetic derivative of Avermectin (HY-15311) with a broadspectrum of insecticidal and acaricidal activity. Emamectin Benzoate induces ROS-mediated DNA damage and cell apoptosis. Emamectin Benzoate, a mixture of the natural Emamectin B1a benzoate and Emamectin B1b benzoate, has the main component of Emamectin B1a benzoate.
  • HY-B0185AS
    Lidocaine-d10 hydrochloride

    Sodium Channel MEK ERK NF-κB Apoptosis Cancer Cardiovascular Disease
    Lidocaine-d10 (Lignocaine-d10) hydrochloride is the deuterium labeled Lidocaine hydrochloride. Lidocaine hydrochloride (Lignocaine hydrochloride) inhibits sodium channels involving complex voltage and using dependence. Lidocaine hydrochloride decreases growth, migration and invasion of gastric carcinoma cells via up-regulating miR-145 expression and further inactivation of MEK/ERK and NF-κB signaling pathways. Lidocaine hydrochloride is an amide derivative commonly used to anesthetize. hydrochloride is a a drug to treat ventricular arrhythmia and an effective tumor-inhibitor.
  • HY-N0930B
    Galegine hydrochloride

    AMPK Bacterial Infection Metabolic Disease
    Galegine hydrochloride, a guanidine derivative, contributes to weight loss in mice. Guanidine hydrochloride is the compound derived from G. officinalis, which gave rise to the biguanides, metformin and phenformin. Galegine hydrochloride activates AMPK in 3T3-L1 adipocytes and L6 myotubes, as well as in the H4IIE rat hepatoma and HEK293 human kidney cell lines. Galegine hydrochloride has antibacterial activity, with minimum inhibitory concentration of 4 mg/L against Staphylococcus aureus strains.
  • HY-W011428
    Olomoucine

    CDK Others
    Olomoucine is an ATP competitive inhibitor of CDKs. Olomoucine is a purine (HY-34431) derivative and inhibits CDC2/cyclin B, Cdk2/cyclin A, Cdk2/cyclin E (both IC50=7 µM), CDK/p35 kinase (IC50=3 µM) and ERK1/p44 MAP kinase (IC50=25 µM).
  • HY-14520S
    Tetrahydrofolic acid-d4

    Endogenous Metabolite Metabolic Disease
    Tetrahydrofolic acid-d4 (L-5,6,7,8-Tetrahydrofolic acid-d4) is the deuterium labeled Tetrahydrofolic acid. Tetrahydrofolic acid (L-5,6,7,8-Tetrahydrofolic acid) is the biologically active vitamin B9 folate derivative. Tetrahydrofolic acid is a donor of one-carbon groups for amino acids, nucleic acids, and lipids. Tetrahydrofolic acid serves as an acceptor of free formaldehyde, producing 5,10-methylenetetrahydrofolate-Tetrahydrofolic acid.
  • HY-103701
    L-Ascorbic acid 2-phosphate

    2-Phospho-L-ascorbic acid

    Phosphatase Metabolic Disease
    L-ascorbic acid 2-phosphate (2-Phospho-L-ascorbic acid) is a long-acting vitamin C derivative that can stimulate collagen formation and expression. L-ascorbic acid 2-phosphate (2-Phospho-L-ascorbic acid) can be used as a culture medium supplement for the osteogenic differentiation of human adipose stem cells (hASCs). L-ascorbic acid 2-phosphate increases alkaline phosphatase (ALP) activity and expression of runx2A in hASCs during the osteogenic differentiation.
  • HY-135218A
    AV-153 free base

    DNA/RNA Synthesis Cancer
    AV-153 free base, a 1,4-dihydropyridine (1,4-DHP) derivative, is an antimutagenic. AV-153 free base intercalates to DNA in a single strand break and reduces DNA damage, stimulates DNA repair in human cells in vitro. AV-153 free base interacts with thymine and cytosine and has an influence on poly(ADP)ribosylation. AV-153 free base has anti-cancer activity.
  • HY-128850
    N-Acetyl-D-mannosamine

    N-Acetylmannosamine; ManNAc

    Bacterial Neurological Disease
    N-Acetyl-D-mannosamine (ManNAc) is an essential precursor of N-acetylneuraminic acid (NeuAc), the specific monomer of bacterial capsular polysialic acid (PA). N-Acetyl-D-mannosamine (ManNAc) can be metabolized by GNE and GlcNAc 2-epimerase (Renin binding protein, RnBP), into ManNAc-6-phosphate and GlcNAc, respectively.  N-Acetyl-d-mannosamine (ManNAc) and its derivatives activates hypocretin (HCRT) gene expression in the orexin neurons, providing a potential model for the testing of a therapy for neural disorders.
  • HY-B1367
    Carbenoxolone disodium

    Gap Junction Protein Infection Inflammation/Immunology
    Carbenoxolone disodium is the active metabolite of Glycyrrhizic acid (HY-N0184) and the inhibitor of human 11β-HSD and bacterial 3α, 20β-HSD. Carbenoxolone disodium is an uncoupling agent for gap junctions and a potent inhibitor of Vaccinia virus replication. Carbenoxolone disodium is used for the study of peptic, esophageal and oral ulceration and inflammation.
  • HY-A0003B
    Lenalidomide hemihydrate

    CC-5013 hemihydrate

    Ligand for E3 Ligase Molecular Glue Apoptosis Cancer
    Lenalidomide hemihydrate (CC-5013 hemihydrate), a derivative of Thalidomide, acts as molecular glue. Lenalidomide hemihydrate is an orally active immunomodulator. Lenalidomide hemihydrate (CC-5013 hemihydrate) is a ligand of ubiquitin E3 ligase cereblon (CRBN), and it causes selective ubiquitination and degradation of two lymphoid transcription factors, IKZF1 and IKZF3, by the CRBN-CRL4 ubiquitin ligase. Lenalidomide hemihydrate (CC-5013 hemihydrate) specifically inhibits growth of mature B-cell lymphomas, including multiple myeloma, and induces IL-2 release from T cells.
  • HY-110155
    LM11A-31 dihydrochloride

    Others Neurological Disease
    LM11A-31 dihydrochloride, a non-peptide p75 NTR (neurotrophin receptor p75) modulator, is an orally active and potent proNGF (nerve growth factor) antagonist. LM11A-31 dihydrochloride is an amino acid derivative with high blood-brain barrier permeability and blocks p75-mediated cell death. M11A-31 dihydrochloride reverses cholinergic neurite dystrophy in Alzheimer's disease mouse models with mid- to late-stage disease progression.
  • HY-N0281
    Daphnetin

    7,8-Dihydroxycoumarin

    EGFR PKA PKC Autophagy Parasite Inflammation/Immunology Cancer
    Daphnetin (7,8-dihydroxycoumarin), one coumarin derivative isolated from plants of the Genus Daphne, is a protein kinase inhibitor, with IC50s of 7.67 μM, 9.33 μM and 25.01 μM for EGFR, PKA and PKC in vitro, respectively. Daphnetin (7,8-dihydroxycoumarin) is a secondary metabolite of plants used in folk medicine to counter inflammatory and allergic diseases, also has has the potential in the treatment of coagulation disorders, rheumatoid arthritis with anti-malarian and anti-pyretic properties.
  • HY-101287
    MPT0B392

    Microtubule/Tubulin JNK Apoptosis Caspase Cancer
    MPT0B392, an orally active quinoline derivative, induces c-Jun N-terminal kinase (JNK) activation, leading to apoptosis. MPT0B392 inhibits tubulin polymerization and triggers induction of the mitotic arrest, followed by mitochondrial membrane potential loss and caspases cleavage by activation of JNK and ultimately leads to apoptosis. MPT0B392 is demonstrated to be a novel microtubule-depolymerizing agent and enhances the cytotoxicity of sirolimus in sirolimus-resistant acute leukemic cells and the multidrug resistant cell line.
  • HY-106136
    TIK-301

    PD-6735; LY-156735

    Melatonin Receptor 5-HT Receptor Neurological Disease
    TIK-301 (PD-6735) is a chlorinated melatonin derivative and a potent, high-affinity and orally active melatonin MT1 and MT2 receptors agonist with Kis of 0.081 nM and 0.042 nM, respectively. TIK-301 is also a 5-HT2B/5-HT2C receptors antagonist with antidepressant action. TIK-301 has the potential for sleep disorders and other circadian rhythm disorders treatment.
  • HY-A0003
    Lenalidomide

    CC-5013

    Ligand for E3 Ligase Molecular Glue Apoptosis Cancer Inflammation/Immunology
    Lenalidomide (CC-5013), a derivative of Thalidomide, acts as molecular glue. Lenalidomide is an orally active immunomodulator. Lenalidomide (CC-5013) is a ligand of ubiquitin E3 ligase cereblon (CRBN), and it causes selective ubiquitination and degradation of two lymphoid transcription factors, IKZF1 and IKZF3, by the CRBN-CRL4 ubiquitin ligase. Lenalidomide (CC-5013) specifically inhibits growth of mature B-cell lymphomas, including multiple myeloma, and induces IL-2 release from T cells.
  • HY-N1584
    Halofuginone

    RU-19110

    DNA/RNA Synthesis TGF-beta/Smad Parasite Sodium Channel Calcium Channel Cancer Infection Inflammation/Immunology Cardiovascular Disease
    Halofuginone (RU-19110), a Febrifugine derivative, is a competitive prolyl-tRNA synthetase inhibitor with a Ki of 18.3 nM. Halofuginone is a specific inhibitor of type-I collagen synthesis and attenuates osteoarthritis (OA) by inhibition of TGF-β activity. Halofuginone is also a potent pulmonary vasodilator by activating Kv channels and blocking voltage-gated, receptor-operated and store-operated Ca 2+ channels. Halofuginone has anti-malaria, anti-inflammatory, anti-cancer, anti-fibrosis effects.
  • HY-129619
    SNIPER(ER)-87

    SNIPER Estrogen Receptor/ERR Cancer
    SNIPER(ER)-87 consists of an inhibitor of apoptosis protein (IAP) ligand LCL161 derivative that is conjugated to the estrogen receptor α (ERα) ligand 4-hydroxytamoxifen by a PEG linker, and efficiently degrades the ERα protein (IC50=0.097 μM). SNIPER(ER)-87 preferentially recruits XIAP to ERα in the cells, and XIAP is the primary E3 ubiquitin ligase responsible for the SNIPER(ER)-87-induced ERα degradation.
  • HY-108137
    Z-LVG-CHN2

    Cathepsin HSV SARS-CoV Infection Inflammation/Immunology
    Z-LVG-CHN2 is a cell-permeable and irreversible inhibitor of cysteine proteinase. Z-LVG-CHN2 is a tripeptide derivative and mimics part of the human cysteine proteinase-binding center. Z-LVG-CHN2 displays an inhibition on HSV whereas no significant effect on poliovirus replication. Z-LVG-CHN2 effectively blocks SARS-COV-2 replication (EC50=190 nM) via inhibition of SARS-COV-2 3CL pro protease.
  • HY-136522
    S2116

    Histone Demethylase Apoptosis Cancer
    S2116, a N-alkylated tranylcypromine (TCP) derivative, is a potent lysine-specific demethylase 1 (LSD1) inhibitor. S2116 increases H3K9 methylation and reciprocal H3K27 deacetylation at super-enhancer regions. S2116 induces apoptosis in TCP-resistant T-cell acute lymphoblastic leukemia (T-ALL) cells by repressing transcription of the NOTCH3 and TAL1 genes. S2116 significantly retardes the growth of T-ALL cells in xenotransplanted mice.
  • HY-A0003A
    Lenalidomide hydrochloride

    CC-5013 hydrochloride

    Ligand for E3 Ligase Molecular Glue Cancer Inflammation/Immunology
    Lenalidomide hydrochloride (CC-5013 hydrochloride), a derivative of Thalidomide, acts as molecular glue. Lenalidomide hydrochloride is an orally active immunomodulator. Lenalidomide hydrochloride (CC-5013 hydrochloride) is a ligand of ubiquitin E3 ligase cereblon (CRBN), and it causes selective ubiquitination and degradation of two lymphoid transcription factors, IKZF1 and IKZF3, by the CRBN-CRL4 ubiquitin ligase. Lenalidomide hydrochloride (CC-5013 hydrochloride) specifically inhibits growth of mature B-cell lymphomas, including multiple myeloma, and induces IL-2 release from T cells.
  • HY-134542
    CaV1.3 antagonist-1

    Calcium Channel Neurological Disease
    CaV1.3 antagonist-1 is a potent and highly selective CaV1.3 L-type calcium channel (LTCC) antagonist with an IC50 of 1.7 μM. CaV1.3 antagonist-1 inhibits CaV1.3 LTCC >600-fold more potently than CaV1.2 LTCC. CaV1.3 antagonist-1, a cyclopentyl derivative, has the potential for Parkinson's disease research.
  • HY-14393
    Emodin

    Frangula emodin

    SARS-CoV Casein Kinase Autophagy Cancer
    Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice.
  • HY-123823
    Nitroaspirin

    NCX 4016

    COX Apoptosis Cancer
    Nitroaspirin (NCX 4016) is a nitric oxide (NO) donor and a nitro-derivative of Aspirin, which combines with Nitroaspirin to inhibit cyclooxygenase. Nitroaspirin (NCX 4016) has antithrombotic and anti-platelet properties and acts as a direct and irreversible inhibitor of COX-1. Nitroaspirin (NCX 4016) causes significant induction of cell cycle arrest and apoptosis in Cisplatin-resistant human ovarian cancer cells via down-regulation of EGFR/PI3K/STAT3 signaling and modulation of Bcl-2 family proteins.
  • HY-103701A
    L-Ascorbic acid 2-phosphate magnesium

    2-Phospho-L-ascorbic acid magnesium

    Phosphatase Metabolic Disease
    L-Ascorbic acid 2-phosphate magnesium (2-Phospho-L-ascorbic acid magnesium) is a long-acting vitamin C derivative that can stimulate collagen formation and expression. L-Ascorbic acid 2-phosphate magnesium (2-Phospho-L-ascorbic acid magnesium) can be used as a culture medium supplement for the osteogenic differentiation of human adipose stem cells (hASCs). L-Ascorbic acid 2-phosphate magnesium (2-Phospho-L-ascorbic acid magnesium) increases alkaline phosphatase (ALP) activity and expression of runx2A in hASCs during the osteogenic differentiation.
  • HY-135699
    TD52

    Apoptosis Phosphatase Akt Cancer
    TD52, an Erlotinib (HY-50896) derivative, is an orally active, potent cancerous inhibitor of protein phosphatase 2A (CIP2A) inhibitor. TD52 mediates the apoptotic effect in triple-negative breast cancer (TNBC) cells via regulating the CIP2A/PP2A/p-Akt signalling pathway. TD52 indirectly reduced CIP2A by disturbing Elk1 binding to the CIP2A promoter. TD52 has less p-EGFR inhibition and has potent anti-cancer activity.
  • HY-N1584A
    Halofuginone hydrobromide

    RU-19110 hydrobromide

    DNA/RNA Synthesis TGF-beta/Smad Parasite Sodium Channel Calcium Channel Cancer Infection Inflammation/Immunology Cardiovascular Disease
    Halofuginone (RU-19110) hydrobromid, a Febrifugine derivative, is a competitive prolyl-tRNA synthetase inhibitor with a Ki of 18.3 nM. Halofuginone hydrobromid is a specific inhibitor of type-I collagen synthesis and attenuates osteoarthritis (OA) by inhibition of TGF-β activity. Halofuginone hydrobromid is also a potent pulmonary vasodilator by activating Kv channels and blocking voltage-gated, receptor-operated and store-operated Ca 2+ channels. Halofuginone hydrobromid has anti-malaria, anti-inflammatory, anti-cancer, anti-fibrosis effects.
  • HY-124719
    hSMG-1 inhibitor 11j

    PI3K mTOR GSK-3 CDK Cancer
    hSMG-1 inhibitor 11j, a pyrimidine derivative, is a potent and selective inhibitor of hSMG-1, with an IC50 of 0.11 nM. hSMG-1 inhibitor 11j exhibits >455-fold selectivity for hSMG-1 over mTOR (IC50=50 nM), PI3Kα/γ (IC50=92/60 nM) and CDK1/CDK2 (IC50=32/7.1 μM). hSMG-1 inhibitor 11j can be used for the research of cancer.
  • HY-19408
    Pyr10

    TRP Channel Others
    Pyr10 is a pyrazole derivative and a selective TRP cation 3 (TRPC3) inhibitor. Pyr10 inhibits Ca 2+ influx in carbachol-stimulated TRPC3-transfected HEK293 cells with an IC50 of 0.72 μM (IC50 of 13.08 μM for store operated Ca 2+ entry in BRL-2H3 cells). Pyr10 has the ability to distinguish between receptor-operated TRPC3 and native stromal interaction molecule 1 (STIM1)/Orai1 channels.
  • HY-136523
    S2157

    Histone Demethylase Apoptosis Cancer
    S2157, a N-alkylated tranylcypromine (TCP) derivative, is a potent lysine-specific demethylase 1 (LSD1) inhibitor. S2157 increases H3K9 methylation and reciprocal H3K27 deacetylation at super-enhancer regions. S2157 induces apoptosis in TCP-resistant T-cell acute lymphoblastic leukemia (T-ALL) cells by repressing transcription of the NOTCH3 and TAL1 genes. S2157 efficiently pass through the blood-brain barrier and can almost completely eradicate CNS leukemia in mice transplanted with T-ALL cells.
  • HY-136208
    TAN-452

    Opioid Receptor Neurological Disease
    TAN-452 is an orally active, selective peripherally acting δ-opioid receptor (DOR) antagonist with a Ki of 0.47 nM and a Kb of 0.21 nM. TAN-452 is an antagonist for μ-opioid receptor (MOR; Ki=36.56 nM and Kb=9.43 nM) and κ-opioid receptor (KOR; Ki=5.31 nM and Kb=7.18 nM). TAN-452, a derivative of Naltrindole, demonstrates low brain penetrability and attenuates morphine-induced side effects without affecting pain control.
  • HY-139254
    Indirubin-3′-oxime

    IDR3O; I3O

    CDK GSK-3 JNK Neurological Disease
    Indirubin-3′-oxime (IDR3O), a synthetic derivative of indirubin, is a potent inhibitor of cyclin-dependent kinases (CDKs) and glycogen synthase kinase 3β (GSK3β). Indirubin-3′-oxime directly inhibits the activity of all three isoforms of JNK (JNK1, JNK2, and JNK3), with IC50s of 0.8 μM, 1.4 μM, and 1.0 μM, respectively. Indirubin-3′-oxime can enhance height growth via activation of Wnt/β-catenin signaling in chondrocytes.
  • HY-108511A
    PB28

    Sigma Receptor Apoptosis SARS-CoV Cancer Infection
    PB28 is a cyclohexylpiperazine derivative and a high affinity and selective sigma 2 (σ2) receptor agonist with a Ki of 0.68 nM. PB28 is also a σ1 antagonist with a Ki of 0.38 nM. PB28 is less affinity for other receptors. PB28 inhibits electrically evoked twitch in guinea pig bladder and ileum with EC50 values of 2.62 μM and 3.96 μM, respectively. PB28 can modulate SARS-CoV-2-human protein-protein interaction. PB28 induces caspase-independent apoptosis and has antitumor activity.
  • HY-108511
    PB28 dihydrochloride

    Sigma Receptor Apoptosis SARS-CoV Cancer Infection
    PB28 dihydrochloride, a cyclohexylpiperazine derivative, is a high affinity and selective sigma 2 (σ2) receptor agonist with a Ki of 0.68 nM. PB28 dihydrochloride is also a σ1 antagonist with a Ki of 0.38 nM. PB28 dihydrochloride is less affinity for other receptors. PB28 dihydrochloride inhibits electrically evoked twitch in guinea pig bladder and ileum with EC50 values of 2.62 μM and 3.96 μM, respectively. PB28 dihydrochloride can modulate SARS-CoV-2-human protein-protein interaction. PB28 dihydrochloride induces caspase-independent apoptosis and has antitumor activity.
  • HY-136813
    Multitarget AD inhibitor-1

    Beta-secretase Amyloid-β Neurological Disease
    Multitarget AD inhibitor-1 is a selective and reversible butyrylcholinesterase (BuChE) inhibitor with IC50s of 7.22 μM and 1.55 μM for hBuChE and eqBuChE (BuChE from equine serum), respectively. Multitarget AD inhibitor-1 inhibits β-secretase (IC50hBACE-1=41.60 μM), amyloid β aggregation (IC50Aβ=3.09 μM), tau aggregation. Multitarget AD inhibitor-1, a diphenylpropylamine derivative, has the potential for multifunctional disease-modifying anti-Alzheimer’s research.
  • HY-N6954
    Garcinone C

    ATM/ATR STAT CDK Cancer
    Garcinone C, a xanthone derivative, is a natural compound extracted from Garcinia oblongifolia Champ that is used as an anti-inflammatory, analgesia, astringency and granulation-promoting medicine, and has potential cytotoxic effects on certain cancers. Garcinone C stimulates the expression levels of ATR and 4E-BP1, while efficiently inhibiting the expression levels of cyclin B1, cyclin D1, cyclin E2, cdc2, Stat3 and CDK7. Garcinone C significantly inhibits cell viability of the human Nasopharyngeal carcinoma (NPC) cell lines CNE1, CNE2, HK1 and HONE1 in a time‑ and dose‑dependent manner.
  • HY-105099
    Rifalazil

    KRM-1648; ABI-1648

    DNA/RNA Synthesis Bacterial Infection Inflammation/Immunology
    Rifalazil (KRM-1648; ABI-1648), a rifamycin derivative, inhibits the bacterial DNA-dependent RNA polymerase and kills bacterial cells by blocking off the β-subunit in RNA polymerase. Rifalazil (KRM-1648; ABI-1648) is an antibiotic, exhibits high potency against mycobacteria, gram-positive bacteria, Helicobacter pyloriC. pneumoniae and C. trachomatis with MIC values from 0.00025 to 0.0025 μg/ml. Rifalazil (KRM-1648; ABI-1648) has the potential for the treatment of Chlamydia infection, Clostridium difficile associated diarrhea (CDAD), and tuberculosis (TB).
  • HY-10587
    BIX-01294

    Histone Methyltransferase Autophagy Cancer
    BIX-01294 is a reversible and highly selective G9a Histone Methyltransferase inhibitor, with an IC50 of 2.7 μM in DELFIA assay. BIX-01294 specifically inhibits G9a (H3K9me2) and GLP enzyme (H3K9me3), with IC50s of 1.7 μM and 38 μM, respectively. BIX-01294 inhibits G9a/GLP by competing for binding with the amino acids N-terminal of the substrate lysine residue. BIX-01294, a (1H-1,4-diazepin-1-yl)-quinazolin-4-yl amine derivative, induces necroptosis and autophagy. BIX-01294 has antitumor activity in recurrent tumor cells.