Search Result
Results for "
disulfide-linked
" in MedChemExpress (MCE) Product Catalog:
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-Y1666
-
|
Biochemical Assay Reagents
|
Others
|
2,2′-Dipyridyl disulfide is a useful reagent for the determination of sulfhydryl groups. 2,2′-Dipyridyl disulfide is a common reagent in peptide chemistry, often used in oxidation–reduction condensations to form peptide bonds or in coupling reactions to form disulfide-linked heterodimers .
|
-
-
- HY-128926
-
|
ADC Linker
|
Cancer
|
SPP is a cleavable disulfide linker, can be used to form cytotoxic compound- linker conjugate .
|
-
-
- HY-147094
-
|
ADC Linker
|
Cancer
|
vc-PABC-DM1 used to synthesize an ADC molecule based on utilize disulfide linker. vc-PABC-DM1 can be used to explore serum stability .
|
-
-
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
-
- HY-P1565
-
TD 1 disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules .
|
-
-
- HY-108003
-
-
-
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
-
- HY-P1334
-
-
-
- HY-P1334A
-
-
-
- HY-P1204
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
-
- HY-P1204A
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH TFA, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
-
- HY-P1205
-
Melanin-concentrating hormone(human, mouse, rat)
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
-
- HY-P1205A
-
Melanin-concentrating hormone(human, mouse, rat) TFA
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) TFA is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
-
- HY-P1178A
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B TFA, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B TFA non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B TFA can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects .
|
-
-
- HY-P1178
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects .
|
-
-
- HY-P2569
-
|
Apoptosis
|
Cancer
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
-
- HY-P3503
-
BMN 111
|
FGFR
|
Others
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
-
- HY-P3624
-
|
Guanylate Cyclase
|
Cardiovascular Disease
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research .
|
-
-
- HY-P3710
-
|
Calcium Channel
|
Others
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization .
|
-
-
- HY-P3898
-
-
-
- HY-P4237
-
-
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge:cys1-cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
-
- HY-P3503A
-
BMN 111 acetate
|
FGFR
|
Others
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
-
-
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
-
- HY-P1165
-
-
-
- HY-P2612
-
|
TNF Receptor
|
Others
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
-
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
-
- HY-P1018
-
-
-
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
-
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
-
- HY-P10102
-
|
Apoptosis
|
Metabolic Disease
Cancer
|
Kp7-6, a Fas mimetic peptide, is a Fas/FasL antagonist. Kp7-6 protects cells from Fas-mediated apoptosis, and protects mice from Fas-mediated hepatic injury .
|
-
-
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
-
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
-
- HY-17571A
-
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
-
- HY-P1164
-
-
-
- HY-P1235
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
-
-
- HY-P1236
-
Atrial natriuretic factor (1-28) (rat)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
-
- HY-P1508
-
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
-
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
-
- HY-P1519
-
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
-
- HY-P1556
-
|
PKG
|
Cardiovascular Disease
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
-
- HY-P1235A
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
-
-
- HY-P2093
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
-
- HY-P0178
-
|
Integrin
|
Inflammation/Immunology
|
LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
-
-
- HY-P1236A
-
Atrial natriuretic factor (1-28) (rat) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
-
- HY-P1753
-
|
HIV
|
Infection
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
-
-
- HY-P1164A
-
-
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
-
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
-
-
- HY-P1212
-
CST-14, human, rat
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, human, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
-
- HY-P2093A
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
- HY-P1565A
-
TD 1 disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P0178A
-
|
Integrin
|
Inflammation/Immunology
|
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 TFA increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
-
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
-
- HY-P1508A
-
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
-
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P1390A
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
-
- HY-P2249
-
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
-
- HY-P1519B
-
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
-
- HY-P0058A
-
-
- HY-P0058
-
-
- HY-P0203
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P1112
-
-
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
-
- HY-P0203A
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat) TFA, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) TFA can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) TFA has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P1071
-
Calcitonin gene-related peptid
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
-
- HY-P1071A
-
Calcitonin gene-related peptid TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
-
- HY-P1179
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Endocrinology
Cancer
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P1179A
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
-
- HY-P2093B
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
-
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
-
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P2545
-
-
- HY-P2196
-
-
- HY-P0058B
-
-
- HY-P1556A
-
|
PKG
|
Metabolic Disease
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P3217
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
-
- HY-P3557
-
-
- HY-P3692
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and stress-related behavior .
|
-
- HY-P3707
-
|
Apoptosis
|
Cancer
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice .
|
-
- HY-P3915
-
|
Bacterial
|
Infection
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity .
|
-
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
-
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P3217A
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin acetate is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin acetate causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin acetate has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
-
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P4680
-
|
MCHR1 (GPR24)
|
Neurological Disease
|
(Phe13,Tyr19)-MCH (human, mouse, rat) is a potent SLC-1 and S643b receptor ligand. (Phe13,Tyr19)-MCH (human, mouse, rat) can be used as an agonist for SLC-1 and S643b receptor .
|
-
- HY-P4860
-
|
Akt
|
Metabolic Disease
|
Adropin (34-76) (human, mouse, rat) regulates fuel selection preferences in skeletal muscle. Adropin increases insulin-induced Akt phosphorylation and cell-surface expression of GLUT4, in diet-induced obesity (DIO) mouse.
|
-
- HY-P5127
-
-
- HY-P5845
-
α-RgIA
|
nAChR
|
Neurological Disease
|
α-Conotoxin RgIA (α-RgIA) is a specific α9α10 nAChR antagonist. α-Conotoxin RgIA can be obtained from Conus regius venom. α-Conotoxin RgIA can be used in the study of neurological diseases .
|
-
- HY-P5848
-
|
nAChR
|
Neurological Disease
|
αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10. αO-Conotoxin GeXIVA shows analgesic in animal models of pain .
|
-
- HY-P5792
-
ANP (3-28) (human)
|
Endothelin Receptor
|
Metabolic Disease
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
-
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
-
- HY-P5011
-
-
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
-
- HY-P5188A
-
-
- HY-P5713
-
|
Bacterial
|
Infection
|
Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity .
|
-
- HY-P5718
-
|
Bacterial
|
Infection
|
Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity .
|
-
- HY-P3557A
-
-
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor comprising 14 amino acid residues. SFTI-1 is a potent Bowman-Birk inhibitor.
|
-
- HY-17571
-
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-12554
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin is a vasopressin analogue with potent vasoactive properties. Terlipressin is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin exerts anti-inflammatory and anti-oxidative effects. Terlipressin has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-A0182
-
-
- HY-P0004
-
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
-
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
-
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1483
-
-
- HY-P1534
-
-
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-106262
-
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
-
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-P1932
-
-
- HY-P1932A
-
-
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-12554A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-P2311
-
-
- HY-P1267
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .
|
-
- HY-P1267A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PnIA TFA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .
|
-
- HY-P1268
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
-
- HY-P1268A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
-
- HY-P1269
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
-
- HY-P1365
-
α-CTxMII
|
nAChR
|
Neurological Disease
|
α-Conotoxin MII (α-CTxMII), a 16-amino acid peptide from the venom of the marine snail Conus magus, potently blocks nicotinic acetylcholine receptors (nAChRs) composed of α3β2 subunits, with an IC50 of 0.5 nM. α-Conotoxin MII (α-CTxMII) potently blocks β3-containing neuronal nicotinic receptors .
|
-
- HY-P1365A
-
α-CTxMII TFA
|
nAChR
|
Neurological Disease
|
α-Conotoxin MII TFA (α-CTxMII TFA), a 16-amino acid peptide from the venom of the marine snail Conus magus, potently blocks nicotinic acetylcholine receptors (nAChRs) composed of α3β2 subunits, with an IC50 of 0.5 nM. α-Conotoxin MII TFA (α-CTxMII TFA) potently blocks β3-containing neuronal nicotinic receptors .
|
-
- HY-P1269A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB TFA, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
-
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
-
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
-
- HY-P1304
-
-
- HY-P1346A
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P2312
-
HβD-3
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml .
|
-
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
-
- HY-P1105
-
|
Chloride Channel
|
Neurological Disease
|
GaTx2 is a seletive and a high affinity inhibitor of ClC-2 channels with a voltage-dependent apparent KD of ∼20 pM. GaTx2 is a peptide toxin inhibitor from Leiurus quinquestriatus hebraeus venom. GaTx2 is useful in determining the role and the membrane localization of ClC-2 in specific cell types .
|
-
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
-
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
-
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P1163A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
- HY-P1163
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
- HY-P1282
-
-
- HY-P1282A
-
-
- HY-P2491
-
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
-
- HY-P1440A
-
|
Potassium Channel
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
-
- HY-P1218A
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-125777A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Vc1.1 TFA is a disulfide-bonded peptide isolated from Conus victoriae and is a selective nAChR antagonist. α-Conotoxin Vc1.1 TFA inhibits α3α5β2, α3β2 and α3β4 with IC50s of 7.2 μM, 7.3 μM and 4.2 μM, respectively, and has less inhibitory effect on other nAChR subtypes. α-Conotoxin Vc1.1 TFA has the potential for neuropathic pain reserach .
|
-
- HY-P1167A
-
-
- HY-106262B
-
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
-
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
-
- HY-P1218
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-P2271
-
|
Apelin Receptor (APJ)
|
Cancer
|
MM 54 (compound 5) is a competitive antagonist at APJ, with an IC50 of 93 nM. MM 54 behaves as a potent and selective inhibitor of apelin binding and APLNR activation .
|
-
- HY-P1440
-
-
- HY-P1167
-
-
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P3219
-
|
Endogenous Metabolite
|
Endocrinology
|
N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat .
|
-
- HY-P1427
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
-
- HY-P3314
-
-
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
-
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
-
- HY-P3653
-
|
mAChR
nAChR
|
Neurological Disease
|
α-Conotoxin M I is a potent and selective inhibitor of mAChR and α1β1γδ nAChR, but has no effect on nicotine-stimulated dopamine release. α-Conotoxins are small, disulfide-rich peptides that competitively inhibit muscle and neuronal nicotinic AChRs .
|
-
- HY-P3654
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin SIA is a selective nicotinic acetylcholine receptor (nAChR) antagonist with high affinity for the muscle nAChR. α-Conotoxin SIA preferentially targets the α/δ interface of the muscle nAChR in mouse muscle. In contrast, for Torpedo nAChR, α-Conotoxin SIA has a much higher affinity for the α/γ than for the α/δ interface .
|
-
- HY-P3899
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
-
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
-
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
-
- HY-P4605
-
-
- HY-P4810
-
T140
|
CXCR
|
Infection
|
Polyphemusin II-Derived Peptide (T140), a CXCR4 inhibitor, shows high inhibitory activity against HIV-1 entry and the inhibitory effect on the binding of an anti-CXCR4 monoclonal antibody (12G5) to CXCR4 .
|
-
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P4994
-
-
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
-
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
-
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I is a potent K + channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes .
|
-
- HY-P5306
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin TxID is a potent α3β4 nAChR antagonist with an IC50 value of 12.5 nM. α-Conotoxin TxID has weak inhibition activity of closely related α6/α3β4 nAChR (IC50= 94 nM). α-Conotoxin TxID has the potential for novel smoking cessation drug development .
|
-
- HY-P5847
-
-
- HY-P5850
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Bt1.8 is a potent α6/α3β2β3 and α3β2 nAChRs inhibitor with IC50s of 2.1 nM and 9.4 nM against rat α6/α3β2β3 and α3β2, respectively .
|
-
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
-
- HY-P1631
-
|
Bacterial
|
Infection
|
Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized into an amphiphilic, antiparallel β-hairpin by two disulfide bridges .
|
-
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
-
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
-
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
-
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
-
- HY-P3037
-
|
Calcium Channel
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs)? enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
-
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
-
- HY-P4976
-
-
- HY-P5014
-
-
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
-
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
-
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
-
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
-
- HY-P5780
-
|
Sodium Channel
|
Neurological Disease
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
-
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
-
- HY-P5071
-
|
Bacterial
|
Infection
|
EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4 .
|
-
- HY-P5818
-
-
- HY-P5824
-
-
- HY-12554B
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P10079
-
-
- HY-P0017
-
-
- HY-P0202
-
-
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P0204A
-
-
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P0062A
-
-
- HY-P2222
-
-
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
-
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
-
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P1286
-
-
- HY-P1286A
-
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P2538
-
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
- HY-P1424A
-
|
Potassium Channel
|
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
-
- HY-P1441A
-
|
Sodium Channel
|
|
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
|
-
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
-
- HY-P0062B
-
-
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P3277
-
|
Ras
|
Cancer
|
KRpep-2d is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
-
- HY-P3277A
-
|
Ras
|
Cancer
|
KRpep-2d (TFA) is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
-
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
-
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
-
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
-
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
-
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
-
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
-
- HY-P3711
-
|
Na+/K+ ATPase
|
Others
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase .
|
-
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
-
- HY-P3656
-
|
Potassium Channel
|
Inflammation/Immunology
|
Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker .
|
-
- HY-P3655
-
|
Calcium Channel
|
Others
|
Agelenin is a polypeptide composed of 35 amino acids. Agelenin could be isolated from the Agelenidae spider Agelena opulenta. Agelenin has structural similarity to insect-specific calcium channel inhibitor .
|
-
- HY-P3732
-
|
Integrin
|
Cancer
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
-
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
-
- HY-137788
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin GI has high affinity for nAChR.α-Conotoxin GI is a short peptide toxin that can be isolated from the venom of Conus geographus.α-Conotoxin GI has the similar activity with neuromuscular blocking agent .
|
-
- HY-P5141
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin KIIIA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2).μ-Conotoxin KIIIA can be used for research of pain .
|
-
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
-
- HY-P1403
-
|
Potassium Channel
|
Others
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
-
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
-
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
-
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
-
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
-
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
-
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
-
- HY-P5809
-
-
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
-
- HY-P5839
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin MrIC is an α7nAChR biased agonist. α-Conotoxin MrIC exclusively activates α7nAChR regulated by type II positive allosteric modulators, including PNU120596. α-Conotoxin MrIC can be used to study neurological diseases and also to probe the pharmacological properties of α7nAChR .
|
-
- HY-P5841
-
|
Liposome
|
Neurological Disease
|
α-Conotoxin LtIA is an α3β2 nAChR blocker (IC50=9.8 nM), that can be obtained from Conus litteratus venom. Alpha-Conotoxin LtIA can be used in the study of neurological diseases (such as Parkinson's disease, pain) .
|
-
- HY-P5844
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor. α-Conotoxin AuIA is a α-conotoxin that can be isolated from Conus aulicus .
|
-
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
-
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
-
- HY-P5873
-
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
-
- HY-P5887
-
-
- HY-P5736
-
|
Bacterial
|
Infection
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
-
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
-
- HY-P5797
-
-
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
-
- HY-P5786
-
-
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
-
- HY-P5793
-
-
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
-
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
-
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Inflammation/Immunology
|
Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
-
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
-
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
-
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
-
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
-
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
-
- HY-125053
-
|
Integrin
|
Cardiovascular Disease
|
Batifiban, a cyclic peptide, is a platelet glycoprotein GPⅡb/Ⅲa antagonist, and inhibits platelet aggregation. Batifiban blocks circulating vitronectin binding to integrin ανβ3, Batifiban can be used for research of acute coronary syndromes .
|
-
- HY-125053A
-
|
Glycoprotein VI
|
Cardiovascular Disease
|
Batifiban TFA, a cyclic peptide, is an antagonist of platelet glycoprotein GPⅡb/Ⅲa and inhibits platelet aggregation. Batifiban blocks the binding of circulating vitronectin to integrin ανβ3 .
|
-
- HY-P10025
-
-
- HY-P2222A
-
-
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
-
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
-
- HY-12537
-
-
- HY-P1275
-
-
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
-
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P1166A
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 TFA is a potent urotensin-II receptor (UT) ligand. UFP-803 TFA has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
-
- HY-P1166
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 is a potent urotensin-II receptor (UT) ligand. UFP-803 has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
-
- HY-P3204
-
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
-
- HY-P3282
-
|
Guanylate Cyclase
|
Metabolic Disease
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
-
- HY-P4010
-
|
Vasopressin Receptor
|
Others
|
Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin, a synthetic analog of vasopressin (AVP), is a weak agonist at antidiuretic receptor. However, Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin is a potent agonist at pituitary corticotrope receptor .
|
-
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
-
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
-
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P5158
-
|
Adrenergic Receptor
|
Others
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
-
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
-
- HY-P5159
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
-
- HY-P5146
-
-
- HY-P5148
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. α-Conotoxin BuIA can be used to distinguish nAChRs containing β2- and β4-subunit, respectively. α-Conotoxin BuIA distinguishes among αxβ2 nAChRs with a rank order potency of α6>α3>α2>α4 .
|
-
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
-
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
-
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
-
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
-
- HY-P1681
-
-
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
-
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
-
- HY-P5855
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin SxIIIC is an irreversible NaV channel inhibitor that can be obtained from the Conus striolatus. μ-Conotoxin SxIIIC can be used in the study of neurological diseases such as chronic pain .
|
-
- HY-P5865
-
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
-
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
-
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
-
- HY-P5899
-
-
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
-
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
-
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
-
- HY-P5942
-
-
- HY-P5943
-
-
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
-
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
-
- HY-P5820
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
-
- HY-108814
-
DX-88
|
Ser/Thr Protease
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
-
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
-
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
-
- HY-P5141A
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin KIIIA TFA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2). μ-Conotoxin KIIIA TFA can be used for research of pain .
|
-
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
-
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
-
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
-
- HY-P1410A
-
GsMTx4 TFA
Maximum Cited Publications
28 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-106224A
-
Hypocretin-1 (human, rat, mouse) (TFA)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) TFA has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) TFA is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P2031
-
|
Arp2/3 Complex
|
Others
|
Phallacidin is a member of the phallotoxin family of mushroom toxins. Phallacidin binds F-actin .
|
-
- HY-P1390
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
- HY-P1216A
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 TFA is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors respectively. HS014 TFA increases food intake in free-feeding rats .
|
-
- HY-P1216
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors, respectively. HS014 modulates the behavioral effects of morphine in mice. HS014 increases food intake in free-feeding rats .
|
-
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
-
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P1424
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
-
- HY-P1410
-
GsMTx4
Maximum Cited Publications
28 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
- HY-106224B
-
Hypocretin-1 (human, rat, mouse) (acetate)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate is also an OX1R agonist that induces the expression of BDNF and TH proteins in SH-SY5Y cells in a time- and dose-dependent manner. Orexin A (human, rat, mouse) acetate can be used in studies of appetite regulation, neurodegenerative diseases and modulation of injurious messaging .
|
-
- HY-P1266
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin EI is a selective nicotinic acetylcholine α1β1γδ receptor (nAChR) antagonist (IC50=187 nM) and an α3β4 receptor inhibitor. α-Conotoxin EI can block muscle and ganglionic receptors .
|
-
- HY-103277
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
-
- HY-P1960
-
|
Apoptosis
Reactive Oxygen Species
|
Cancer
|
Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer .
|
-
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
-
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively .GrTx1 can be used for neurological disease research .
|
-
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P5153
-
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
-
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
-
- HY-P3071
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
-
- HY-P5160
-
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
-
- HY-P3479
-
-
- HY-P3213
-
-
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
-
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
-
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
-
- HY-P5861
-
-
- HY-P5862
-
Mu-Conotoxin BuIIIB
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIB (Mu-Conotoxin BuIIIB) is a mammalian neuronal voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIB can be obtained from the venom of Cone snails and is a probe for ion channel function research. μ-Conotoxin BuIIIB can be used in the study of neurological diseases such as pain .
|
-
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
-
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
-
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
-
- HY-P5799
-
SNX-238
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIID (SNX-238) is a Conus peptide that blocks an ω-Conotoxin-GVIA-sensitive, high-threshold Ca 2+ current in fish retinal ganglion cells .
|
-
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
-
- HY-P5817
-
|
Sodium Channel
|
Neurological Disease
|
ω-Conotoxin CVIB is a non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs) antagonist. ω-Conotoxin CVIB inhibits depolarization-activated whole-cell VGCC currents in dorsal root ganglion (DRG) neurons with a pIC50 of 7.64 .
|
-
- HY-P5821
-
-
- HY-P5802
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin FVIA is an N-type Ca 2+channel (Ca v 2.2)
inhibitor. ω-Conotoxin FVIA reduces mechanical and thermal pain abnormalities
in a rat model of caudal nerve injury. ω-Conotoxin FVIA can be used in the
study of highly effective pain relievers with low side effects
.
|
-
- HY-P5805
-
-
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P5177
-
-
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
-
- HY-103277A
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042 TFA, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
-
- HY-P0028
-
|
Fluorescent Dye
|
Others
|
Phalloidin is a mushroom-derived toxin which can be used to label F-actin of the cytoskeleton with fluorochrome
.
|
-
- HY-P1202
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
-
- HY-P1202A
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806 TFA, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
-
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
-
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
-
- HY-P0188A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
-
- HY-P0191A
-
-
- HY-P1213A
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363 TFA, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC363 TFA blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
-
- HY-P1213
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC-363 blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
-
- HY-P3350
-
|
Bacterial
|
Infection
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
-
- HY-P3546
-
-
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
-
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
-
- HY-P2112
-
DOTA-Nal3-octreotide
|
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging .
|
-
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5147
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin GID is a paralytic peptide neurotoxin and a selective antagonist of nAChR, with IC50s of 5 nM (α7), 3 nM (α3β2), 150 nM (α4β2), respectively. α-Conotoxin GID is small disulfide-rich peptide, with potential to inhibit chronic pain. α-Conotoxin GID contains a C-terminal carboxylate, thus substitution with a C-terminal carboxamide results in loss of α4β2 nAChR. α-Conotoxin GID can be isolated from the Conus species .
|
-
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
-
- HY-P5184
-
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
-
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
-
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5336
-
-
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
FITC-α-Bungarotoxin is the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P1264F1
-
|
nAChR
|
Neurological Disease
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P5804
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin CVIF is a selective Cav2.2 channel inhibitor with an IC50 of 34.3 nM in rat isolated DRG neurons. ω-Conotoxin CVIF block of Cav2.2 channels is weakly reversible .
|
-
- HY-P5852
-
Alpha-conotoxin EIIB
|
nAChR
|
Neurological Disease
|
α-Conotoxin EIIB (Alpha-conotoxin EIIB) is a toxin peptide that can be obtained from Conus ermineus. α-Conotoxin EIIB binds to nAChR (Ki=2.2 nM). α-Conotoxin EIIB can be used in the study of neurological diseases such as schizophrenia, drug addiction, Alzheimer's disease, and Parkinson's disease .
|
-
- HY-P5858
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin SIIIA is a tetrodotoxin (TTX)-resistant sodium channel blocker. μ-Conotoxin SIIIA is a toxic peptide that can be obtained from the venom of Conus snails. μ-Conotoxin SIIIA can be used in the study of neurological diseases, such as neuropathic pain .
|
-
- HY-P5864
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
-
- HY-P1410B
-
-
- HY-P2785
-
-
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P5626
-
|
Bacterial
|
Infection
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
-
- HY-P1695
-
Ro 09-0198
|
Antibiotic
Bacterial
|
Infection
|
Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) .
|
-
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
-
- HY-P2786A
-
-
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
-
- HY-P10046
-
|
Vasopressin Receptor
|
Metabolic Disease
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
-
- HY-P1410C
-
-
- HY-P2785A
-
-
- HY-P1156A
-
-
- HY-P0061
-
-
- HY-P0061A
-
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
-
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P1215
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
-
- HY-P1215A
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
-
- HY-P1980
-
|
Apoptosis
|
Metabolic Disease
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
-
- HY-103048
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 can be used for the research of various diseases, including cancer and infectious diseases .
|
-
- HY-103048A
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3 TFA, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 TFA interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 TFA can be used for the research of various diseases, including cancer and infectious diseases .
|
-
- HY-P3143
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P2974
-
EC 3.2.1.35; Pancreatopeptidase E
|
Elastase
|
Metabolic Disease
|
Elastase, Porcine pancreas (EC 3.2.1.35) is a single polypeptide chain of 240 amino acid residues, derived from pig pancreas. Elastase, Porcine pancreas is a serine protease that can hydrolyze proteins and polypeptide. Elastase from porcine pancreas can induce emphysema in hamsters .
|
-
- HY-P3143A
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
-
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
-
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
-
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
-
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
-
- HY-P1952
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin-CnIIIC is a 22-residue conopeptide that can be isolated from Conus consors. μ-Conotoxin-CnIIIC is a potent and persistent blocker of NaV1.4 channel. μ-Conotoxin-CnIIIC has analgesic, anaesthetic and myorelaxant properties .
|
-
- HY-P2700
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin GIIIB is a 22-residue polypeptide that can be isolated from the venom of piscivorous cone snail Conus geographus. μ-Conotoxin GIIIB is a NaV1.4 channel inhibitor. μ-Conotoxin GIIIB blocks muscle cell's contraction .
|
-
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P5143
-
|
Calcium Channel
|
Inflammation/Immunology
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
-
- HY-P5144
-
-
- HY-P5149
-
αC-PrXA
|
nAChR
|
Neurological Disease
|
αC-Conotoxin PrXA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 1.8 nM (α1β1εδ, adult) and 3.0 nM (α1β1γδ, fetal), respectively. αC-Conotoxin PrXA competes with α-bungarotoxin at the α/δ and α/γ subunit interfaces of the nAChR, shows high specificity against neuromuscular nAChR .
|
-
- HY-P1285
-
Con-R
|
iGluR
|
Neurological Disease
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
-
- HY-P5849
-
αA-OIVA
|
nAChR
|
Neurological Disease
|
αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR. αA-Conotoxin OIVA is a peptide that can be derived from conotoxin. αA-Conotoxin OIVA paralyzes muscles .
|
-
- HY-P5902
-
-
- HY-P1952A
-
|
Sodium Channel
|
Neurological Disease
|
µ-Conotoxin-CnIIIC acetate, a 22-residue conopeptide, is a potent antagonist of the voltage-gated NaV1.4 sodium channel with an IC50 of 1.3 nM acting at the neuromuscular junction. µ-Conotoxin-CnIIIC acetate has myorelaxant and analgesic effects .
|
-
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
-
- HY-P5822
-
-
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
-
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
-
- HY-P1726A
-
|
Melanocortin Receptor
|
|
MSG606 TFA is a potent human MC1 receptor antagonist (IC50=17 nM). MSG606 TFA also partial agonist at human MC3 and MC5 receptors (EC50 values are 59 and 1300 nM, respectively). MSG606 TFA exhibits binding affinity for A375 melanoma cells in vitro. MSG606 TFA reverses the induced hyperalgesia in female mice, with no effect in male mice.
|
-
- HY-P1726
-
-
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
-
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
-
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
-
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
-
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
-
- HY-P4764
-
|
Melanocortin Receptor
|
Cardiovascular Disease
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
-
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
-
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
-
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P1682A
-
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-P1682
-
POL6326
|
CXCR
Arrestin
|
Cancer
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
-
- HY-P1102A
-
|
CXCR
HIV
|
Infection
Cancer
|
TC14012 TFA, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 TFA is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 TFA has anti-HIV activity and anti-cancer activity .
|
-
- HY-P1102
-
TC14012
2 Publications Verification
|
CXCR
HIV
|
Infection
Cancer
|
TC14012, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 has anti-HIV activity and anti-cancer activity .
|
-
- HY-P4745
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
-
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
-
- HY-P2244A
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM) .
|
-
- HY-P1717A
-
Cp40 TFA
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 TFA (Cp40 TFA), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P1717
-
Cp40
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P1717B
-
Cp40 acetate
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 acetate (Cp40 acetate), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 acetate (Cp40 acetate) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
-
- HY-P3066
-
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
-
- HY-P2244
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM) .
|
-
- HY-108719
-
-
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-106302
-
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
-
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
-
- HY-P5006
-
d(CH2)5[Tyr(Me)2, Dab5]AVP
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(d(CH2)51,Tyr(Me)2,Dab5,Arg8)-Vasopressin (d(CH2)5[Tyr(Me)2, Dab5]AVP) is a specific antagonist of vasopressin V1a receptor, with a pA2 of 6.71 .
|
-
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P5856
-
|
nAChR
|
Neurological Disease
|
αA-Conotoxin PIVA is a selective mouse musclenAChR inhibitor with IC50 for adult and fetal mouse musclenAChR sub> values are 2.3 nM and 22 nM respectively. αA-Conotoxin PIVA can be used in the study of neurological diseases.
|
-
- HY-P0189A
-
-
- HY-P5145
-
-
- HY-P1162
-
-
- HY-P5808A
-
-
- HY-P1270
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors. α-Conotoxin Im-I is toxic and induces seizures in rodents. α-Conotoxin Im-I is a tool for studying neuronal nAChR .
|
-
- HY-P4469
-
-
- HY-P5825
-
-
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
-
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
-
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
-
- HY-P0171
-
BKT140 (4-fluorobenzoyl); BL-8040; TF14016
|
CXCR
|
Endocrinology
Cancer
|
Motixafortide (BKT140 4-fluorobenzoyl) is a novel CXCR4 antagonist with an IC50 vakue of ~1 nM.
|
-
- HY-P4895
-
|
Oxytocin Receptor
|
Neurological Disease
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
-
- HY-P5828
-
-
- HY-P4452
-
-
- HY-P5362
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
- HY-P5362A
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
-
- HY-P4890
-
-
- HY-P4890A
-
-
- HY-P1955
-
AMG 416; KAI-4169
|
CaSR
|
Endocrinology
|
Etelcalcetide (AMG 416) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
-
- HY-P1955A
-
AMG 416 hydrochloride; KAI-4169 hydrochloride
|
CaSR
|
Endocrinology
|
Etelcalcetide hydrochloride (AMG 416 hydrochloride) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide hydrochloride is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
-
- HY-P0041A
-
-
- HY-P1607
-
-
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-108003
-
-
- HY-P1949A
-
|
Peptides
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
-
- HY-P5783
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P1565
-
TD 1 disulfide(peptide)
|
Na+/K+ ATPase
|
Inflammation/Immunology
|
Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide can enhance the transdermal delivery of many macromolecules .
|
-
- HY-P1815
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P1334
-
-
- HY-P1334A
-
-
- HY-P1204
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
- HY-P1204A
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
[Ala17]-MCH TFA, a MCH analogue (HY-P1525A), is a selective ligand for MCHR1 (Ki=0.16 nM) over MCHR2 (Ki=34 nM). [Eu 3+ chelate-labeled [Ala17]-MCH shows high affnity for MCHR1 (Kd=0.37 nM) while has little demonstrable binding affnity for MCHR2 .
|
-
- HY-P1205
-
Melanin-concentrating hormone(human, mouse, rat)
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
- HY-P1205A
-
Melanin-concentrating hormone(human, mouse, rat) TFA
|
MCHR1 (GPR24)
|
Neurological Disease
|
MCH (human, mouse, rat) TFA is a potent peptide agonist of MCH-R and exhibits binding IC50 values of 0.3nM and 1.5 nM for MCH1R and MCH2R, respectively. MCH (human, mouse, rat) is a highly sensitive to MCH-2R in a CHO cell line and monitoring mobilization of intracellular calcium with FLIPR, exhibits functional activation EC50 values of 3.9 nM and 0.1nM for human MCH-1R and MCH-2R, respectively .
|
-
- HY-P2469
-
BNP-45, mouse
|
Peptides
|
Cardiovascular Disease
|
Brain Natriuretic Peptide-45, mouse (BNP-45, mouse) is a circulating form of mouse brain natriuretic peptide isolated from mouse heart with potent hypotensive and natriuretic potency .
|
-
- HY-P1178A
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B TFA, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B TFA non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B TFA can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects .
|
-
- HY-P3062
-
|
Peptides
|
Neurological Disease
|
[Tyr11]-Somatostatin is a neuroavtive peptide for proteomics research. Somatostatin is one of many neuroactive substances that influence retinal physiology .
|
-
- HY-P1949
-
|
Peptides
|
Cardiovascular Disease
Cancer
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
-
- HY-P1178
-
|
Trk Receptor
|
Neurological Disease
|
Cyclotraxin B, a cyclic peptide, is a highly potent and selective TrkB inhibitor without altering the binding of BDNF. Cyclotraxin B non-competitively inhibits BDNF-induced TrkB activity with an IC50 of 0.30 nM. Cyclotraxin B can crosse the blood-brain-barrier and has analgesic and anxiolytic-like behavioral effects .
|
-
- HY-P3216
-
9-Deamidooxytocin
|
Peptides
|
Endocrinology
|
Oxytocin free acid (9-Deamidooxytocin) is an analog of oxytocin in which the glycinamide residue at position 9 in oxytocin has been replaced by a glycine residue. Oxytocin is a pleiotropic, peptide hormone with broad implications for general health, adaptation, development, reproduction, and social behavior .
|
-
- HY-P2569
-
|
Apoptosis
|
Cancer
|
Malformin A1, a cyclic pentapeptide isolated from Aspergillus niger, possess a range of bioactive properties including antibacterial activity. Malformin A1 shows potent cytotoxic activities on human colorectal cancer cells. Malformin A1 induces apoptosis by activating PARP, caspase 3, -7, and -9 .
|
-
- HY-P2687
-
Urodilatin (human)
|
Peptides
|
Cardiovascular Disease
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
-
- HY-P3503
-
BMN 111
|
FGFR
|
Others
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
- HY-P3624
-
|
Guanylate Cyclase
|
Cardiovascular Disease
|
Cenderitide is a potent agonist of particulate guanylyl cyclase receptor (pGC). Cenderitide is a natriuretic peptide (NP) composed of C-type natriuretic peptide (CNP) fused to the C-terminus of Dendroaspis natriuretic peptide (DNP). Cenderitide activates both pGC-A and pGC-B, activates the second messenger cGMP, suppresses aldosterone, and preserves GFR without reducing blood pressure. Cenderitide can be used for heart failure research .
|
-
- HY-P3710
-
|
Calcium Channel
|
Others
|
Ser-Ala-alloresact is a sperm activating peptide (SAP). The peptides released from eggs of marine invertebrates play a central role in fertilization .
|
-
- HY-P3765
-
|
Peptides
|
Cardiovascular Disease
|
Auriculin A is a synthetic atrial natriuretic factor (ANF) with hemodynamic effect. Auriculin A antagonizes renal vasoconstriction in the dog, and influences on arterial baroreflex control of heart rate, systemic blood pressure, and perfusion pressure in the hind limb (perfused at constant flow) in rabbits .
|
-
- HY-P3767
-
ANP (126-150) (Rat); Atrial natriuretic peptide(126-150)(rat)
|
Peptides
|
Cardiovascular Disease
Metabolic Disease
|
Auriculin B (ANP (126-150) (Rat)) is a rat-derived atrial natriuretic peptide. Auriculin B has potent vasodilatory and diuretic properties .
|
-
- HY-P3898
-
-
- HY-P3952
-
|
Peptides
|
Metabolic Disease
|
(D-Trp8,D-Cys14)-Somatostatin-14 is a Somatostatin synthetic analogue. (D-Trp8,D-Cys14)-Somatostatin-14 can be used for the research of metabolic related diseases .
|
-
- HY-P4058
-
CGRP free acid
|
Peptides
|
Neurological Disease
|
Calcitonin gene-related peptide (CGRP) free acid is a neuropeptide. Calcitonin gene-related peptide can be used for the research of nociception, ingestive behaviour and modulation of the endocrine systems .
|
-
- HY-P4237
-
-
- HY-P4320
-
|
Integrin
|
Cancer
|
Cys-Arg-Gly-Asp-Phe-Pro-Ala-Ser-Ser-Cys (Disulfide bridge:cys1-cys10), a decapeptide containing a cyclic RGD active sequence, is an Integrin αIIbβ3 antagonist that inhibits platelet and Adhesion of proMMP-13 .
|
-
- HY-P4703
-
|
Peptides
|
Others
|
Hydrin 1′ is found in the neurohypophysis of Xenopus. Hydrin 1′ possesses a considerable steroid-releasing activity in Xenopus adrenal gland in vitro .
|
-
- HY-P4916
-
|
Peptides
|
Others
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P3503A
-
BMN 111 acetate
|
FGFR
|
Others
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
-
- HY-P1815A
-
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P1165
-
-
- HY-P2612
-
|
TNF Receptor
|
Others
|
WP9QY, TNF-a Antagonist, TNF-a Antagonist is a biological active peptide. (This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.)
|
-
- HY-P5465
-
|
Bacterial
|
Others
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P1018
-
-
- HY-P4204
-
|
Bacterial
|
Infection
|
Ranalexin is an antimicrobial peptide. Ranalexin inhibits S. aureus, E. coli, P. aerugiaosa with MICs of 4, 32, 128 μg/mL .
|
-
- HY-P5601
-
|
Bacterial
Fungal
|
Infection
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P5656
-
|
Peptides
|
Infection
|
Brevinin-1Ea is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5658
-
|
Peptides
|
Infection
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5659
-
|
Peptides
|
Infection
|
Brevinin-1 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5660
-
|
Peptides
|
Infection
|
Brevinin-2 is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5662
-
|
Peptides
|
Infection
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P5978
-
ANP 127-150 (rat)
|
Peptides
|
Cardiovascular Disease
|
Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure .
|
-
- HY-P10102
-
|
Apoptosis
|
Metabolic Disease
Cancer
|
Kp7-6, a Fas mimetic peptide, is a Fas/FasL antagonist. Kp7-6 protects cells from Fas-mediated apoptosis, and protects mice from Fas-mediated hepatic injury .
|
-
- HY-P5601A
-
|
Bacterial
Fungal
|
Infection
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P4062
-
BIL
|
Insulin Receptor
|
Metabolic Disease
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
- HY-17571A
-
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P0084
-
SRIF-14; Somatostatin-14
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline with an IC50 value of 13 nM. Cyclic somatostatin can be used for the research of cardiovascular disease .
|
- HY-P0003
-
Brain Natriuretic Peptide-32 human; BNP-32
|
Peptides
|
Cancer
|
Nesiritide (Brain Natriuretic Peptide-32 human) is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively.
|
- HY-P0123
-
|
Peptides
|
Others
|
SPACE peptide is a skin penetrating peptide (SPPs). SPACE peptide can enhance topical delivery of a macromolecule, hyaluronic acid .
|
- HY-P1164
-
- HY-P1487
-
|
Peptides
|
Neurological Disease
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
- HY-P1235
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P1236
-
Atrial natriuretic factor (1-28) (rat)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P1237
-
|
Peptides
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
|
C-Type Natriuretic Peptide (CNP) (1-22), human, a 1-22 fragment of CNP, is a natriuretic peptide receptor B (NPR-B) agonist. C-Type Natriuretic Peptide (CNP) (1-22), human inhibits cAMP synthesis stimulated by the physiological agonists histamine and 5-HT or directly by Forskolin. CNP is a potent, endothelial-derived relaxant and growthinhibitory factor .
|
- HY-P1508
-
Bactenecin, bovine
|
Bacterial
Fungal
Antibiotic
|
Infection
|
Bactenecin (Bactenecin, bovine) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
- HY-P1525
-
MCH (salmon)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P1519
-
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P1547
-
|
Peptides
|
Neurological Disease
|
Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone.
|
- HY-P1556
-
|
PKG
|
Cardiovascular Disease
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-P1573
-
BNP-45, rat
|
Peptides
|
Cardiovascular Disease
|
Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency .
|
- HY-P1600
-
|
Peptides
|
Others
|
Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.
|
- HY-P1235A
-
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P2093
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P0178
-
|
Integrin
|
Inflammation/Immunology
|
LXW7, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
- HY-P1236A
-
Atrial natriuretic factor (1-28) (rat) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (ANP) (1-28), rat (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P1753
-
|
HIV
|
Infection
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
- HY-P1164A
-
- HY-P1789
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P1791
-
Lactoferricin B; Lfcin B
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B), a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 has antitumor activities .
|
- HY-P1212
-
CST-14, human, rat
|
Somatostatin Receptor
|
Neurological Disease
|
Cortistatin 14, human, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
- HY-P1525A
-
MCH (salmon) (TFA)
|
MCHR1 (GPR24)
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
Endocrinology
|
Melanin Concentrating Hormone, salmon TFA (MCH (salmon) TFA) is a 19-amino-acid neuropeptide initially identified in the pituitary gland of teleost fish, which regulates food intake, energy balance, sleep state, and the cardiovascular system. Melanin-concentrating hormone is a ligand for an orphan G protein-coupled receptor (SLC-1/GPR24) and MCHR2.
|
- HY-P1573A
-
BNP-45, rat TFA
|
Peptides
|
Cardiovascular Disease
|
Brain Natriuretic Peptide-45, rat TFA (BNP-45, rat TFA) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency .
|
- HY-P2093A
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 TFA is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P1565A
-
TD 1 disulfide(peptide) TFA
|
Na+/K+ ATPase
|
Others
|
Transdermal Peptide Disulfide TFA (TD 1 Disulfide(peptide) TFA) is a 11-amino acid peptide, binds to Na +/K +-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. Transdermal Peptide Disulfide TFA can enhance the transdermal delivery of many macromolecules .
|
- HY-P0178A
-
|
Integrin
|
Inflammation/Immunology
|
LXW7 TFA, a cyclic peptide containing Arg-Gly-Asp (RGD), is an integrin αvβ3 inhibitor. LXW7 has a high binding affinity to αvβ3 integrin with an IC50 of 0.68 μM. LXW7 TFA increases phosphorylation of VEGFR-2 and activation of ERK1/2. Anti-inflammatory effect .
|
- HY-P1791B
-
Lactoferricin B acetate; Lfcin B acetate
|
Bacterial
Fungal
Apoptosis
|
Infection
Cancer
|
Lactoferrin 17-41 (Lactoferricin B) acetate, a peptide corresponding to residues 17-41 of bovine lactoferrin, has antimicrobial activity against a wide range of microorganisms, including Gram-positive and Gramnegative bacteria, viruses, protozoa, and fungi. Lactoferrin 17-41 acetate has antitumor activities .
|
- HY-P1508A
-
Bactenecin, bovine TFA
|
Bacterial
Fungal
|
Infection
|
Bactenecin TFA (Bactenecin, bovine TFA) is a potent 12-aa looped antimicrobial peptide isolated from bovine neutrophils. Bactenecin TFA inhibits the growth of bacteria and yeast, and kills the fungus Trichophyton rubrum. Bactenecin TFA increass membrane permeability, inhibits the growth and biofilm formation of B. pseudomallei .
|
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P1390A
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P2273
-
|
CGRP Receptor
|
Metabolic Disease
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
- HY-P2250
-
ELA-32 negative control
|
Peptides
|
Others
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
- HY-P2249
-
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
- HY-P1519B
-
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P1335A
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP TFA is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP TFA displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP TFA can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P1789A
-
|
MMP
|
Inflammation/Immunology
Cancer
|
CTTHWGFTLC, CYCLIC TFA is a cyclic peptide inhibitor for matrix metalloproteinases MMP-2 and MMP-9. The IC50 value for MMP-9 is ~8 μM .
|
- HY-P0058A
-
- HY-P0058
-
- HY-P0203
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1112
-
- HY-P1112A
-
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
- HY-P0203A
-
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
α-CGRP (mouse, rat) TFA, a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) TFA can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) TFA has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1071
-
Calcitonin gene-related peptid
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
- HY-P1071A
-
Calcitonin gene-related peptid TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
- HY-P1179
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Endocrinology
Cancer
|
Guanylin(human), a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
- HY-P1179A
-
|
Guanylate Cyclase
Endogenous Metabolite
|
Metabolic Disease
|
Guanylin(human) TFA, a 15-amino acid peptide, is an endogenous intestinal guanylate cyclase activator. Guanylin(human) TFA is mainly found in gastrointestinal tract which regulates electrolytead water transport in intestinal and renal epithelia through cyclic GMP-dependent mechanism .
|
- HY-P2093B
-
|
Insulin Receptor
|
Metabolic Disease
|
S961 acetate is an high-affinity and selective insulin receptor (IR) antagonist with IC50s of 0.048, 0.027, and 630 nM for HIR-A, HIR-B, and human insulin-like growth factor I receptor (HIGF-IR) in SPA-assay, respectively .
|
- HY-P2196A
-
|
Apelin Receptor (APJ)
|
Cancer
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P2545
-
- HY-P2526
-
|
Peptides
|
Cancer
|
LyP-1 is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
- HY-P2196
-
- HY-P0058B
-
- HY-P2526A
-
|
Peptides
|
Cancer
|
LyP-1 TFA is a cyclic 9‐amino‐acids tumor homing peptide and selectively bind to p32 receptors overexpressed in various tumor-associated cells .
|
- HY-P3218
-
|
Peptides
|
Endocrinology
|
[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution .
|
- HY-P3221
-
|
Peptides
|
Endocrinology
|
[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu) .
|
- HY-P1556A
-
|
PKG
|
Metabolic Disease
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-P3217
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
- HY-P1237A
-
|
Peptides
|
Cardiovascular Disease
Neurological Disease
Metabolic Disease
|
C-Type Natriuretic Peptide (CNP) (1-22), human (TFA),a 1-22 fragment of CNP, is a natriuretic peptide receptor B (NPR-B) agonist. C-Type Natriuretic Peptide (CNP) (1-22), human (TFA) inhibits cAMP synthesis stimulated by the physiological agonists histamine and 5-HT or directly by Forskolin. CNP is a potent, endothelial-derived relaxant and growthinhibitory factor .
|
- HY-P3557
-
- HY-P3627
-
|
Peptides
|
Cancer
|
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis .
|
- HY-P3692
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART (55-76), rat is a neuropeptide (55-76 residues of the CART peptide) and constitutes the N-terminal fragments of CART (55-102). CART (55-76), rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (55-76), rat can induce anxiety and stress-related behavior .
|
- HY-P3707
-
|
Apoptosis
|
Cancer
|
Tumor targeted pro-apoptotic peptide (CNGRC-GG-D(KLAKLAK)2) is an anti-tumor peptide. Tumor targeted pro-apoptotic peptide disrupts mitochondrial membranes and promotes apoptosis, showing anticancer activity in mice .
|
- HY-P3825
-
CCAP
|
Peptides
|
Cardiovascular Disease
|
Crustacean cardioactive peptide (CCAP) is a insect cardioregulatory peptides that contmns 9 amino acid, first isolated from the tobacco hawkmoth, Manduca sexta. There are two cystemes at pnsttons 3 and 9 forming a disulfide bridge and the carboxyl-terminns is amldated .
|
- HY-P3912
-
|
Peptides
|
Infection
|
Endotoxin inhibitor a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor inhibits the febrile response to LPS with very low toxicity and lethality .
|
- HY-P3915
-
|
Bacterial
|
Infection
|
Esculentin 1A is a frog skin-derived antimicrobial peptide (AMP) with potent in vitro anti-Pseudomonas activity .
|
- HY-P3954
-
|
Somatostatin Receptor
|
Metabolic Disease
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
- HY-P3957
-
|
Peptides
|
Others
|
Urotensin II, teleost fish is a cyclic peptide. It can be isolated from the caudal neurosecretory system of teleost fish .
|
- HY-P3912A
-
|
Peptides
|
Infection
|
Endotoxin inhibitor TFA is a synthetic peptide that binds lipid A with high affinity, thereby detoxifying LPS (HY-D1056) and preventing LPS-induced cytokine release in vivo. Endotoxin inhibitor TFA inhibits the febrile response to LPS with very low toxicity and lethality .
|
- HY-P4159B
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159A
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159
-
|
ERK
|
Cardiovascular Disease
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P3218A
-
|
Peptides
|
Endocrinology
|
[Glu4]-Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution .
|
- HY-P3217A
-
|
Oxytocin Receptor
|
Endocrinology
|
[Asp5]-Oxytocin acetate is the first 5-position neurohypophyseal hormone analogue possessing significant biological activity. [Asp5]-Oxytocin acetate causes uterine contractions in vitro, enhanced by Mg 2+. [Asp5]-Oxytocin acetate has the ability of rat uteroconstrictor, avian vasodilator, and rat antidiuretic .
|
- HY-P4205
-
|
Aminopeptidase
|
Cancer
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
- HY-P4680
-
|
MCHR1 (GPR24)
|
Neurological Disease
|
(Phe13,Tyr19)-MCH (human, mouse, rat) is a potent SLC-1 and S643b receptor ligand. (Phe13,Tyr19)-MCH (human, mouse, rat) can be used as an agonist for SLC-1 and S643b receptor .
|
- HY-P4587
-
|
Peptides
|
Metabolic Disease
|
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism .
|
- HY-P4906
-
|
Peptides
|
Others
|
Atrial Natriuretic Factor (5-27) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4723
-
|
Peptides
|
Others
|
Intermedin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4728
-
|
Peptides
|
Others
|
Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4588
-
|
Peptides
|
Metabolic Disease
|
(Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism .
|
- HY-P4860
-
|
Akt
|
Metabolic Disease
|
Adropin (34-76) (human, mouse, rat) regulates fuel selection preferences in skeletal muscle. Adropin increases insulin-induced Akt phosphorylation and cell-surface expression of GLUT4, in diet-induced obesity (DIO) mouse.
|
- HY-P4997
-
|
Peptides
|
Others
|
Tyr-Uroguanylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5080
-
|
Peptides
|
Others
|
Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5127
-
- HY-P5129
-
|
Peptides
|
Others
|
ASB20123 is a CNP/ghrelin chimeric peptide. ASB20123 stimulate bone growth. ASB20123 can be used in research of growth disorders and dwarfism .
|
- HY-P4767
-
|
Peptides
|
Metabolic Disease
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
- HY-P5322
-
|
Peptides
|
Others
|
Thrombospondin (TSP-1)-derived CD36 binding motif is a biological active peptide. (This peptide is derived from thrombospondin and represents a binding motif responsible for thrombospondin-CD36 interaction. It is cyclized through a disulfide bond. Thrombospondin is a matrix-bound glycoprotein involved in cancer metastasis, tumor adhesion, and angiogenesis. This peptide has been shown to competitively inhibit platelet aggregation and tumor metastasis.)
|
- HY-P5495
-
|
Peptides
|
Others
|
Uroguanylin-15 (Rat) is a biological active peptide. (Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.)
|
- HY-P5845
-
α-RgIA
|
nAChR
|
Neurological Disease
|
α-Conotoxin RgIA (α-RgIA) is a specific α9α10 nAChR antagonist. α-Conotoxin RgIA can be obtained from Conus regius venom. α-Conotoxin RgIA can be used in the study of neurological diseases .
|
- HY-P5848
-
|
nAChR
|
Neurological Disease
|
αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10. αO-Conotoxin GeXIVA shows analgesic in animal models of pain .
|
- HY-P5792
-
ANP (3-28) (human)
|
Endothelin Receptor
|
Metabolic Disease
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
- HY-P4909
-
|
Peptides
|
Infection
|
Autoinducing Peptide I is a cyclic octapeptide secreted by Staphylococcus aureus and can be used in vaccine research .
|
- HY-P4911
-
|
CXCR
|
Cardiovascular Disease
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
- HY-P5011
-
- HY-P5059
-
- HY-P5624
-
|
Bacterial
|
Infection
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
- HY-P5645
-
Human liver expressed antimicrobial peptide-2
|
Peptides
|
Infection
|
LEAP-2 is an antimicrobial peptide derived from human blood .
|
- HY-P5188A
-
- HY-P5217
-
|
Peptides
|
Others
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
- HY-P5713
-
|
Bacterial
|
Infection
|
Des(8-14)brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Des(8-14)brevinin-1PMa also shows hemolytic activity .
|
- HY-P5718
-
|
Bacterial
|
Infection
|
Brevinin-1PMa is a host-defense peptide that exhibits antimicrobial activity against Staphylococcus aureus and Echerichia coli. Brevinin-1PMa also shows hemolytic activity .
|
- HY-P3557A
-
- HY-P10033
-
|
Ser/Thr Protease
|
Others
|
SFTI-1 is a cyclic peptide trypsin inhibitor comprising 14 amino acid residues. SFTI-1 is a potent Bowman-Birk inhibitor.
|
- HY-17571
-
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
- HY-P0049
-
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
- HY-A0182
-
- HY-P0004
-
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
- HY-P0090
-
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
- HY-P1036
-
|
Complement System
|
Others
|
Compstatin, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin inhibits only the activation of primates’ complement system. Compstatin exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
- HY-P1455
-
Human adrenomedullin-(1-52)-NH2
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer.
|
- HY-P1457
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
|
- HY-P1464
-
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
- HY-P1070
-
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1463
-
Thyrocalcitonin eel
|
Peptides
|
Endocrinology
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P1483
-
- HY-P1534
-
- HY-P1548
-
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-106262
-
KAI-9803; BMS-875944
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
- HY-P1574
-
- HY-P1455A
-
Human adrenomedullin-(1-52)-NH2 TFA
|
Peptides
|
Cancer
|
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
|
- HY-P1574A
-
- HY-P1548A
-
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P1463A
-
Thyrocalcitonin eel TFA
|
Peptides
|
Others
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P1737
-
Con-S
|
Peptides
|
Cardiovascular Disease
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
- HY-P1766
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
- HY-P1871
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P1913
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
- HY-P1932
-
- HY-P1932A
-
- HY-P1913A
-
|
CGRP Receptor
|
Cardiovascular Disease
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
- HY-P1070A
-
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1280
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P1548B
-
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-A0182A
-
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
- HY-P2289
-
pBD-1
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P2289A
-
pBD-1 TFA
|
Bacterial
|
Infection
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-12554A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-P2310
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-P2311
-
- HY-P1267
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .
|
- HY-P1267A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PnIA TFA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease .
|
- HY-P1268
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
- HY-P1268A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin PIA TFA is a nicotinic acetylcholine receptor (nAChR) antagonist that targets nAChR subtypes containing α6 and α3 subunits. α-Conotoxin PIA has the potential for the research of Parkinson’s disease, and schizophrenia 。
|
- HY-P1269
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
- HY-P1365
-
α-CTxMII
|
nAChR
|
Neurological Disease
|
α-Conotoxin MII (α-CTxMII), a 16-amino acid peptide from the venom of the marine snail Conus magus, potently blocks nicotinic acetylcholine receptors (nAChRs) composed of α3β2 subunits, with an IC50 of 0.5 nM. α-Conotoxin MII (α-CTxMII) potently blocks β3-containing neuronal nicotinic receptors .
|
- HY-P1365A
-
α-CTxMII TFA
|
nAChR
|
Neurological Disease
|
α-Conotoxin MII TFA (α-CTxMII TFA), a 16-amino acid peptide from the venom of the marine snail Conus magus, potently blocks nicotinic acetylcholine receptors (nAChRs) composed of α3β2 subunits, with an IC50 of 0.5 nM. α-Conotoxin MII TFA (α-CTxMII TFA) potently blocks β3-containing neuronal nicotinic receptors .
|
- HY-P1269A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIB TFA, a potent and selective α3β4 nicotinic acetylcholine receptor (nAChR) antagonist, blocks α3β4 nAChRs expressed in Xenopus oocytes with an IC50 of 0.75 μM .
|
- HY-P1305A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
- HY-P1304A
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
- HY-P1304
-
- HY-P1346
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P2312
-
HβD-3
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml .
|
- HY-P1305
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
- HY-P1105
-
|
Chloride Channel
|
Neurological Disease
|
GaTx2 is a seletive and a high affinity inhibitor of ClC-2 channels with a voltage-dependent apparent KD of ∼20 pM. GaTx2 is a peptide toxin inhibitor from Leiurus quinquestriatus hebraeus venom. GaTx2 is useful in determining the role and the membrane localization of ClC-2 in specific cell types .
|
- HY-P1073
-
|
Calcium Channel
Sodium Channel
Potassium Channel
|
Cancer
|
ProTx-I, a venom toxin of the tarantula Thrixopelma pruriens, is a potent, selective CaV3.1 channel blocker with IC50 values of 0.2 μM and 31.8 μM for hCaV3.1 and hCaV3.2 respectively. ProTx-I is also a potent blocker for voltage-gated Na + channels and inhibits KV 2.1 channels .
|
- HY-P1074
-
|
Calcium Channel
|
Neurological Disease
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
- HY-P1078
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P1078A
-
|
Calcium Channel
|
Neurological Disease
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P1163A
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P1163
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P1282
-
- HY-P1282A
-
- HY-P2491
-
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
- HY-P1440A
-
|
Potassium Channel
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
- HY-P1218A
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-125777A
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Vc1.1 TFA is a disulfide-bonded peptide isolated from Conus victoriae and is a selective nAChR antagonist. α-Conotoxin Vc1.1 TFA inhibits α3α5β2, α3β2 and α3β4 with IC50s of 7.2 μM, 7.3 μM and 4.2 μM, respectively, and has less inhibitory effect on other nAChR subtypes. α-Conotoxin Vc1.1 TFA has the potential for neuropathic pain reserach .
|
- HY-P1167A
-
- HY-106262B
-
KAI-9803 hydrochloride; BMS-875944 hydrochloride
|
PKC
|
Cardiovascular Disease
Inflammation/Immunology
|
Delcasertib (KAI-9803) hydrochloride is a potent and selective δ-protein kinase C (δPKC) inhibitor. Delcasertib (KAI-9803) hydrochloride could ameliorate injury associated with ischemia and reperfusion in animal models of acute myocardial infarction (MI) .
|
- HY-P1871A
-
|
Amylin Receptor
|
Metabolic Disease
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P1036A
-
|
Complement System
|
Others
|
Compstatin TFA, a 13-residue cyclic peptide, is a potent inhibitor of the complement system C3 with species specificity. Compstatin TFA binds to baboon C3 and is resistant to proteolytic cleavage in baboon blood (similar to humans). Compstatin TFA inhibits only the activation of primates’ complement system. Compstatin TFA exhibits IC50 values of 63 μM and 12 μM for classical and alterative complement pathway, respectively .
|
- HY-P1218
-
|
Sodium Channel
|
Neurological Disease
|
Phrixotoxin 3 is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-P2271
-
|
Apelin Receptor (APJ)
|
Cancer
|
MM 54 (compound 5) is a competitive antagonist at APJ, with an IC50 of 93 nM. MM 54 behaves as a potent and selective inhibitor of apelin binding and APLNR activation .
|
- HY-P1440
-
- HY-P1167
-
- HY-P1221
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P3219
-
|
Endogenous Metabolite
|
Endocrinology
|
N-Acetyloxytocin is isolated and characterized in the neurointermediate lobe of the rat pituitary (NIL) and their presence in several brain areas of the rat .
|
- HY-P1427
-
|
Potassium Channel
|
Neurological Disease
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
- HY-P3314
-
- HY-P3089
-
|
Potassium Channel
|
Others
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P2310A
-
|
Bacterial
Parasite
|
Infection
Cardiovascular Disease
|
Defensin HNP-1 human TFA is a Human neutrophil peptides (HNPs), involved in endothelial cell dysfunction at the time of early atherosclerotic development. Defensin HNP-1 human TFA exhibits broad antimicrobial and anti-leishmanial activities .
|
- HY-P0049A
-
Arg8-vasopressin diacetate; AVP diacetate; ADH
|
Apoptosis
Vasopressin Receptor
|
Neurological Disease
|
Argipressin (diacetate) (AVP (diacetate), also known as antidiuretic hormone (ADH)) is a 9 amino acid neuropeptide secreted by the posterior pituitary. Argipressin (diacetate) (AVP (diacetate)) can regulate the biological effects of fluid balance, osmolality and cardiovascular through three separate G-protein coupled receptors (GPCRs), namely Avpr1a (V1a), Avpr1b (V1b) and Avpr2 (V2). Argipressin (diacetate) (AVP (diacetate)) also have potentially important effects on centrally regulated metabolic processes .
|
- HY-P3653
-
|
mAChR
nAChR
|
Neurological Disease
|
α-Conotoxin M I is a potent and selective inhibitor of mAChR and α1β1γδ nAChR, but has no effect on nicotine-stimulated dopamine release. α-Conotoxins are small, disulfide-rich peptides that competitively inhibit muscle and neuronal nicotinic AChRs .
|
- HY-P3654
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin SIA is a selective nicotinic acetylcholine receptor (nAChR) antagonist with high affinity for the muscle nAChR. α-Conotoxin SIA preferentially targets the α/δ interface of the muscle nAChR in mouse muscle. In contrast, for Torpedo nAChR, α-Conotoxin SIA has a much higher affinity for the α/γ than for the α/δ interface .
|
- HY-P3899
-
|
Somatostatin Receptor
|
Metabolic Disease
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
- HY-P4008
-
dVDAVP
|
Peptides
|
Endocrinology
|
[Deamino-4-valine, 8-D-arginine]-Vasopressin (dVDAVP) is a highly potent and specific antidiuretic agent possessing protracted effects .
|
- HY-P3953
-
|
Peptides
|
Metabolic Disease
|
Wy 41747 is a long-acting Somatostatin analogue. Wy 41747 can be used for the research of diabetes mellitus .
|
- HY-W539944
-
Arg8-vasopressin acetate; AVP acetate
|
Vasopressin Receptor
Apoptosis
|
Neurological Disease
|
Argipressin (Arg8-vasopressin) (acetate) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1 .
|
- HY-108905
-
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
- HY-P4184
-
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4912
-
|
Peptides
|
Others
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4127
-
|
Peptides
|
Neurological Disease
|
M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches .
|
- HY-P4605
-
- HY-P4791
-
|
Peptides
|
Others
|
Orexin A (1-15) (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4810
-
T140
|
CXCR
|
Infection
|
Polyphemusin II-Derived Peptide (T140), a CXCR4 inhibitor, shows high inhibitory activity against HIV-1 entry and the inhibitory effect on the binding of an anti-CXCR4 monoclonal antibody (12G5) to CXCR4 .
|
- HY-P4853
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) .
|
- HY-P4902
-
|
Peptides
|
Infection
|
Retrocyclin-1 is a kind of Theta-defensin. Retrocyclin-1 recognizes and binds to carbohydrate-containing surface molecules, to protect cells from HIV-1 infection. Retrocyclin-1 exhibits high affinity to fetuin, gp120 (Kd=35.4 nM), CD4 (Kd=31 nM), and galactosylceramide (Kd=24.1 nM) .
|
- HY-P4973
-
|
Peptides
|
Others
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4942
-
|
Peptides
|
Others
|
Biotinyl-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4934
-
|
Peptides
|
Others
|
Biotinyl-BNP-32 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4990
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P5114
-
|
Calcium Channel
|
Others
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P3089A
-
|
Potassium Channel
|
Others
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P4994
-
- HY-P5017
-
|
Oxytocin Receptor
|
Endocrinology
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
- HY-P5166
-
|
Peptides
|
Others
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
- HY-P2302
-
|
Antibiotic
Bacterial
Fungal
|
Infection
|
Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
|
- HY-P4990A
-
|
Oxytocin Receptor
|
Endocrinology
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P1221A
-
|
Sodium Channel
|
Neurological Disease
|
ProTx II TFA is a selective blocker of Nav1.7 sodium channels with an IC50 of 0.3 nM, and is at least 100-fold selective for Nav1.7 over other sodium channel subtypes. ProTx-II inhibits sodium channels by decreasing channel conductance and shifting activation to more positive potentials and blocks action potential propagation in nociceptors .
|
- HY-P1280A
-
|
Potassium Channel
|
Neurological Disease
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P3055
-
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
Dendrotoxin-I is a potent K + channels blocker and targets voltage-gated potassium channel subunits KV1.1 and KV1.2. Dendrotoxin-I is a neurotoxin isolated from thevenom of Dendroaspis snakes .
|
- HY-P4184A
-
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5306
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin TxID is a potent α3β4 nAChR antagonist with an IC50 value of 12.5 nM. α-Conotoxin TxID has weak inhibition activity of closely related α6/α3β4 nAChR (IC50= 94 nM). α-Conotoxin TxID has the potential for novel smoking cessation drug development .
|
- HY-P5847
-
- HY-P5850
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Bt1.8 is a potent α6/α3β2β3 and α3β2 nAChRs inhibitor with IC50s of 2.1 nM and 9.4 nM against rat α6/α3β2β3 and α3β2, respectively .
|
- HY-P5907
-
|
Opioid Receptor
|
Neurological Disease
|
Helianorphin-19 is a potent and selective κ-opioid receptor (KOR) activator with a Ki of 21 nM and an EC50 of 45 nM. Helianorphin-19 exhibits strong KOR-specific peripheral analgesic activity in a mouse model of chronic visceral pain .
|
- HY-P1631
-
|
Bacterial
|
Infection
|
Polyphemusin I is a natural antimicrobial peptide with excellent antimicrobial activity against Gram-negative and Gram-positive bacteria. Polyphemusin I contains 18 amino acids and is stabilized into an amphiphilic, antiparallel β-hairpin by two disulfide bridges .
|
- HY-P1632
-
|
Bacterial
|
Infection
Cancer
|
Tachyplesin I is a β-hairpin antimicrobial peptide that contains 17 amino acid residues. Tachyplesin I exhibits cytotoxic properties against various human tumor cell lines acting primarily by impairing the integrity of the outer cell membrane .
|
- HY-P1168
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
[Orn8]-Urotensin II (human), a peptide analog of urotensin II, is a UT receptor agonist. [Orn8]-Urotensin II (human) increases intracellular calcium levels in HEK293 .
|
- HY-P3099
-
|
Guanylate Cyclase
|
Cancer
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
- HY-P5603
-
BNBD-12
|
Bacterial
|
Infection
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
- HY-P1633
-
PG1
|
Peptides
|
Others
|
Protegrin-1 is a antimicrobial peptide with antimicrobial activity
|
- HY-P3037
-
|
Calcium Channel
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs)? enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P4766
-
|
Peptides
|
Cardiovascular Disease
|
Adrenomedullin (porcine) is a peptide that regulates vasodilation. Adrenomedullin (porcine) induces endothelium-dependent relaxation in rat aorta with IC50 value of 2.4 nM. Adrenomedullin (porcine) induces endothelium-independent relaxation of porcine coronary arteries with an IC50 of 27.6 nM .
|
- HY-P5319
-
|
Peptides
|
Others
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
- HY-P5790
-
|
Sodium Channel
|
Neurological Disease
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
- HY-P3014
-
|
Potassium Channel
|
Others
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
- HY-P4976
-
- HY-P5014
-
- HY-P5631
-
|
Peptides
|
Infection
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
- HY-P5632
-
|
Bacterial
|
Infection
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
- HY-P5642
-
RC-101
|
Peptides
|
Infection
|
Retrocyclin-101 is an antimicrobial peptide against of bacterial and viral .
|
- HY-P5647
-
|
Peptides
|
Infection
|
PhD1 is an antimicrobial peptide derived from monkey white blood cells. PhD1 has activity against bacteria and fungus Candida albicans .
|
- HY-P5694
-
|
HPV
Parasite
|
Infection
|
Human α-defensin 5 is an antiviral peptide. Human α-defensin 5 blocks infection of non-enveloped viruses, including AdV, HPV, and polyomaviruses (IC50: 0.6-1.25 μM for HPV16). Human α-defensin 5 can bind to the viral capsid and blocks escape of the virus from the endosome. Human α-defensin 5 increases HIV binding to the cell surface. Human α-defensin 5 also has parasiticidal activity .
|
- HY-P5772
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
- HY-P5773
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
- HY-P5780
-
|
Sodium Channel
|
Neurological Disease
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
- HY-P5781
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1b is a 42-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. δ-Theraphotoxin-Hm1b selectively inhibits inactivation of NaV1.1 but have no effect on NaV1.7 .
|
- HY-P5071
-
|
Bacterial
|
Infection
|
EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11–13)C3XXXC4 .
|
- HY-P5818
-
- HY-P5824
-
- HY-12554B
-
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-P10079
-
- HY-P4127A
-
- HY-P0017
-
- HY-P0202
-
- HY-P0256
-
Apamin
3 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0207
-
Endothelin-2 (human, canine); Human endothelin-2
|
Peptides
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (Endothelin-2 (human, canine)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P0204
-
- HY-108741A
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
- HY-P0204A
-
- HY-P0256A
-
Apamine TFA
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Apamin TFA (Apamine TFA) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P0062A
-
- HY-P2171
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P2171A
-
|
Peptides
|
Inflammation/Immunology
|
CCP peptide TFA is a synthetic cyclic citrullinated peptide (CCP) and used as the substrate for detecting anti-CCP antibodies serologically. CCP peptide TFA functions as a target for autoantibodies with a very high specificity for rheumatoid arthritis (RA) .
|
- HY-P2222
-
- HY-P0207A
-
Endothelin-2 (49-69) (human, canine) TFA; Human endothelin-2 TFA
|
Peptides
|
Cardiovascular Disease
Cancer
|
Endothelin-2 (49-69), human (TFA) (Endothelin-2 (49-69) (human, canine) (TFA)) is a 21-amino acid vasoactive peptide that binds to G-protein-linked transmembrane receptors, ET-RA and ET-RB.
|
- HY-P1080
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
- HY-P1079
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
- HY-P1189
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P1189A
-
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P1286
-
- HY-P1286A
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P2538
-
- HY-P2539
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P1424A
-
|
Potassium Channel
|
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
- HY-P1441A
-
|
Sodium Channel
|
|
Mambalgin 1 TFA is a selective ASIC1a inhibitor (IC50 values are 192 and 72 nM for human ASIC1a and ASIC1a/1b dimer, respectively). Mambalgin 1 TFA binds to closed/inactive channel. Mambalgin 1 TFA is selective for ASIC1a over ASIC2a, ASIC3, TRPV1, P2X2, 5-HT3, Nav1.8, Cav3.2 and Kv1.2 channels. Mambalgin 1 TFA increases latency of withdrawal response in mouse tail-flick and paw-flick tests.
|
- HY-108741
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
- HY-P1441
-
|
Sodium Channel
|
Others
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
- HY-P0062B
-
- HY-P0202A
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P3277
-
|
Ras
|
Cancer
|
KRpep-2d is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
- HY-P3277A
-
|
Ras
|
Cancer
|
KRpep-2d (TFA) is a potent K-Ras inhibitor and inhibits proliferation of K-Ras-driven cancer cells. KRpep-2d can be used for cancer research .
|
- HY-P3448
-
CEND-1; iRGD; LSTA1
|
Integrin
Complement System
|
Cancer
|
Certepetide (CEND-1) is a bifunctional cyclic peptide (a.k.a. iRGD). Certepetide is a tumor-penetrating enhancer via RGD motif interaction with alphav-integrins and via activating NRP-1, and transforms the solid tumor microenvironment into a temporary agent conduit. Certepetide accumulates in tumors, and is used in the research of pancreatic cancer and other solid tumors .
|
- HY-P3433
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6b is a vasoconstrictor peptide, and a non-selective endothelin receptor agonist. Sarafotoxin S6b can induce contraction in isolated human coronary arteries , the Ki values of Coronary artery, Saphenous vein and Coronary artery are 0.27, 0.55 and 19.5 nM, respectively .
|
- HY-P3512
-
IB-367
|
Bacterial
Fungal
Parasite
|
Infection
|
Iseganan is an anti-microbial peptide that is active against both Gram-positive and Gram-negative bacteria and fungi. Iseganan kills a broad-spectrum of bacteria and fungi by attaching to and destroying the integrity of the lipid cell membranes. Iseganan can be used for oral mucositis research .
|
- HY-102029
-
SRTX-c
|
Endothelin Receptor
|
Cardiovascular Disease
|
Sarafotoxin S6c (SRTX-c) is a potent endothelin-B receptor agonist. Sarafotoxin S6c can cause vasoconstriction in both endothelium-intact and endothelium-denuded vessels .
|
- HY-P3571
-
|
Endothelin Receptor
|
Cancer
|
[Ala2] Endothelin-3, human is a linear analog of endothelin-3 (ET-3) where substitution of Ala for Cys residues. TE-3 is a vasoactive peptide, produced by human rhabdomyosarcoma cell lines, whereas it is not expressed by human sarcoma cell lines of non-muscle origin. ET-3 acts as a paracrine factor, since it promotes migration of endothelial cells .
|
- HY-P3563
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
[Lys4] Sarafotoxin S6c, a sarafotoxin analogue, is a potent and partial agonist of endothelin receptor. [Lys4] Sarafotoxin S6c elicits contraction of pig coronary artery, with an EC50 of 1.5 nM .
|
- HY-P3711
-
|
Na+/K+ ATPase
|
Others
|
SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. SPAI-1 is a peptide isolated from porcine duodenum, inhibits Na +, K +-ATPase and H +, K +-ATPase in vitro, stimulates Mg 2+-ATPase .
|
- HY-P1281
-
|
Potassium Channel
|
Neurological Disease
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
- HY-P3656
-
|
Potassium Channel
|
Inflammation/Immunology
|
Kaliotoxin (1-37) is a toxin from the scorpion Artdroctonus mauretanicus mauretanicus. Kaliotoxin (1-37) is a potent calcium-dependent potassium channel blocker .
|
- HY-P3655
-
|
Calcium Channel
|
Others
|
Agelenin is a polypeptide composed of 35 amino acids. Agelenin could be isolated from the Agelenidae spider Agelena opulenta. Agelenin has structural similarity to insect-specific calcium channel inhibitor .
|
- HY-P3732
-
|
Integrin
|
Cancer
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
- HY-P3903
-
|
Peptides
|
Endocrinology
|
[D-Trp8,Tyr11] Somatostatin is an analogue of somatostatin. Somatostatin is a hormone that regulates a variety of bodily functions. DTrp8 residue can increase stability .
|
- HY-P3902
-
|
Peptides
|
Neurological Disease
|
[D-Trp8] Somatostatin-14, a tetradecapeptide, is an analog of Somatostatin more potent than the native Somatostatin .
|
- HY-P3901
-
|
Peptides
|
Neurological Disease
|
[Leu8,D-Trp22,Tyr25] Somatostatin-28 is the analog of Somatostatin-28. Somatostatin-28 is a intestinal peptide containing somatostatin in its C-terminal portion .
|
- HY-P3900
-
- HY-P4066
-
|
Peptides
|
Cancer
|
Emfilermin is a recombinant human leukaemia inhibitory factor (LIF) that can be used in chemotherapy-induced peripheral neuropathy studies .
|
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Others
|
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver .
|
- HY-P4869
-
- HY-P4975
-
|
Peptides
|
Others
|
CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4946
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4928
-
|
Peptides
|
Others
|
Biotinyl-Amylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4941
-
|
Peptides
|
Others
|
Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1080A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
- HY-137788
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin GI has high affinity for nAChR.α-Conotoxin GI is a short peptide toxin that can be isolated from the venom of Conus geographus.α-Conotoxin GI has the similar activity with neuromuscular blocking agent .
|
- HY-P5141
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin KIIIA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2).μ-Conotoxin KIIIA can be used for research of pain .
|
- HY-17571F
-
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Peptides
|
Others
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P0190A
-
|
Potassium Channel
|
Others
|
Iberiotoxin (TFA) is a selective high conductance high conductance Ca 2+-activated K + channel inhibitor with a Kd of ~1 nM. Iberiotoxin (TFA) does not block other types of voltage-dependent ion channels .
|
- HY-P1403
-
|
Potassium Channel
|
Others
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
- HY-P2699
-
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
- HY-P5851
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
- HY-P5863
-
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
- HY-P5782
-
|
Sodium Channel
|
Neurological Disease
|
δ-Theraphotoxin-Hm1a toxin is a selective Nav1.1 activator. δ-Theraphotoxin-Hm1a toxin elicits pain and touch sensitivity. δ-Theraphotoxin-Hm1a toxin can be used for the research of irritable bowel syndrome .
|
- HY-P5791
-
- HY-P5795
-
|
Sodium Channel
Potassium Channel
|
Neurological Disease
|
GsAF-I is a potent Nav and hERG1 channels blocker with IC50s of 0.36, 0.6, 1.28, 0.33, 1.2, 0.04 and 4.8 μM against Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6, Nav1.7 and hERG1, respectively .
|
- HY-P5796
-
|
Calcium Channel
|
Neurological Disease
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
- HY-P5809
-
- HY-P5810
-
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
- HY-P5839
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin MrIC is an α7nAChR biased agonist. α-Conotoxin MrIC exclusively activates α7nAChR regulated by type II positive allosteric modulators, including PNU120596. α-Conotoxin MrIC can be used to study neurological diseases and also to probe the pharmacological properties of α7nAChR .
|
- HY-P5841
-
|
Liposome
|
Neurological Disease
|
α-Conotoxin LtIA is an α3β2 nAChR blocker (IC50=9.8 nM), that can be obtained from Conus litteratus venom. Alpha-Conotoxin LtIA can be used in the study of neurological diseases (such as Parkinson's disease, pain) .
|
- HY-P5844
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor. α-Conotoxin AuIA is a α-conotoxin that can be isolated from Conus aulicus .
|
- HY-P5853
-
|
Potassium Channel
|
Inflammation/Immunology
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
- HY-P5870
-
|
Potassium Channel
|
Inflammation/Immunology
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
- HY-P5873
-
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
- HY-P5887
-
- HY-P5901
-
- HY-P4863
-
|
Peptides
|
Others
|
Biotinyl-Amylin (human) is abiotinylated Amylin, amide, human (HY-P1070).
|
- HY-P5736
-
|
Bacterial
|
Infection
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
- HY-P5077
-
|
Guanylate Cyclase
|
Metabolic Disease
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
- HY-P5797
-
- HY-P2949
-
|
Potassium Channel
|
Cancer
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
- HY-P5786
-
- HY-P5788
-
|
Potassium Channel
|
Neurological Disease
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
- HY-P5793
-
- HY-P5811
-
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
- HY-P5816
-
|
Sodium Channel
|
Neurological Disease
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
- HY-P5925
-
SsTx Toxin
|
Potassium Channel
|
Inflammation/Immunology
|
Ssm Spooky Toxin from?Scolopendra mutilans, exhibits lethal toxicity in hematological and respiratory systems by potently inhibiting KCNQ (voltage-gated potassium channel family 7) channels, with IC50? of 2.8 μM, 5.26 μM and 0.1-0.3 M for Kv7.4, Kv1.3, and Shal channel, respectivily. Ssm Spooky Toxin inhibits cytokine generation by specifically acting on the KV1.3 channel in T cells. Ssm Spooky Toxin plays an essential role in the centipede’s circulatory system .
|
- HY-P2710
-
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
- HY-P4971
-
|
Complement System
|
Inflammation/Immunology
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
- HY-P5089
-
|
Peptides
|
Infection
|
Enterotoxin STp (E. coli) is a heat-stable enterotoxin that can be used in vaccine research .
|
- HY-P5628
-
|
Peptides
|
Infection
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
- HY-P5643
-
|
Peptides
|
Infection
|
Retrocyclin-2 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
- HY-P5644
-
|
Peptides
|
Infection
|
Retrocyclin-3 is an antimicrobial peptide against human immunodeficiency virus, influenza A and herpes simplex virus .
|
- HY-P5651
-
|
Peptides
|
Infection
|
PhD4 is an antimicrobial peptide derived from monkey white blood cells. PhD4 has activity against bacteria and fungus Candida albicans .
|
- HY-P5770
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM) .
|
- HY-P5771
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3 .
|
- HY-P5784
-
|
Sodium Channel
|
Neurological Disease
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
- HY-P5785
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P5914
-
WaTx
|
Peptides
|
Neurological Disease
|
Wasabi Receptor Toxin (WaTx) active TRPA1 by prolonged channel openings and decreased Ca 2+ permeability. Wasabi Receptor Toxin can be used in the research of acute and persistent pain .
|
- HY-P5806
-
ErgTx1
|
Peptides
|
Neurological Disease
|
Ergtoxin-1 is a potassium channel blocker.
Ergtoxin-1 is isolated from the venom of the Mexican scorpion
Centruroides noxius. Ergtoxin 1 can block
ERG-K + channels in nerve, heart and endocrine cells .
|
- HY-P5813
-
β-TRTX-cd1a; β-Theraphotoxin-cd1a
|
Peptides
|
Neurological Disease
|
Cd1a is a β-toxin derived from the African spider Ceratogyrus darlingi. Cd1a can regulate calcium ion channels. Cd1a inhibits human calcium ion channels (Cav2.2)(IC502.6 μM) and mouse sodium ion channels (Nav1.7). Cd1a can be used in the development of peripheral pain treatment drugs .
|
- HY-P5798
-
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
- HY-125053
-
|
Integrin
|
Cardiovascular Disease
|
Batifiban, a cyclic peptide, is a platelet glycoprotein GPⅡb/Ⅲa antagonist, and inhibits platelet aggregation. Batifiban blocks circulating vitronectin binding to integrin ανβ3, Batifiban can be used for research of acute coronary syndromes .
|
- HY-125053A
-
|
Glycoprotein VI
|
Cardiovascular Disease
|
Batifiban TFA, a cyclic peptide, is an antagonist of platelet glycoprotein GPⅡb/Ⅲa and inhibits platelet aggregation. Batifiban blocks the binding of circulating vitronectin to integrin ανβ3 .
|
- HY-P10025
-
- HY-P2222A
-
- HY-P5785A
-
|
Potassium Channel
|
Neurological Disease
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P4898
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
- HY-P4898A
-
|
Sodium Channel
|
Cardiovascular Disease
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
- HY-P0083
-
- HY-12537
-
- HY-P1275
-
- HY-P2313
-
HβD-2
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-2 (HβD-2) is a small cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by a number of epithelial cells.Human β-defensin-2 has antimicrobial activity against gram-negative bacteria and Candida, but not gram-positive Staphylococcus aureus . Human β-defensin-2 can be used for the study of colitis .
|
- HY-P2315
-
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P1166A
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 TFA is a potent urotensin-II receptor (UT) ligand. UFP-803 TFA has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
- HY-P1166
-
|
Urotensin Receptor
|
Cardiovascular Disease
|
UFP-803 is a potent urotensin-II receptor (UT) ligand. UFP-803 has lower residual agonist activity, so it may be an important tool for the investigations on the role played by the UT system in physiology and pathology .
|
- HY-P3204
-
AL-78898A
|
Complement System
|
Metabolic Disease
|
POT-4 (AL-78898A), a Compstatin derivative, is a potent inhibitor of complement factor C3 activation. POT-4 can be used for age-related macular degeneration research
|
- HY-P3220
-
|
Peptides
|
Endocrinology
|
[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin .
|
- HY-P3282
-
|
Guanylate Cyclase
|
Metabolic Disease
|
MM 419447, a linaclotide metabolite, is a guanylate cyclase-C agonist. MM 419447 has the potential for the research of the irritable bowel syndrome with constipation (IBS-C) .
|
- HY-P3682
-
|
Peptides
|
Neurological Disease
|
w-Conotoxin SVIB is a peptide toxin, it can be isolated from Conus venoms. w-Conotoxin SVIB inhibits twitch response with an IC50 value of 37 nM. w-Conotoxin SVIB induces respiratory distress and it can be lethal to mice at a high concentration .
|
- HY-P4010
-
|
Vasopressin Receptor
|
Others
|
Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin, a synthetic analog of vasopressin (AVP), is a weak agonist at antidiuretic receptor. However, Desamino(D-3-(3′-pyridyl)-Ala2,Arg8)-Vasopressin is a potent agonist at pituitary corticotrope receptor .
|
- HY-P4678
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P4732
-
|
Peptides
|
Others
|
5-FAM-Amylin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4562
-
|
Peptides
|
Others
|
(D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4370
-
|
Bacterial
Fungal
|
Infection
|
Hepcidin-20 (human) is a histidine-containing, cysteine-rich, β-sheet structured peptide. Hepcidin-20 (human) shows antifungal activity. Hepcidin-20 (human) inhibits biofilm formation and bacterial cell metabolism of polysaccharide intercellular adhesin (PIA)-positive and PIA-negative strains .
|
- HY-P4373
-
|
Cathepsin
MMP
|
Metabolic Disease
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
- HY-P4929
-
|
Peptides
|
Others
|
Biotinyl-(Gln1)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4678A
-
|
Vasopressin Receptor
|
Neurological Disease
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P5158
-
|
Adrenergic Receptor
|
Others
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
- HY-P5142
-
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
- HY-P5159
-
|
Sodium Channel
|
Inflammation/Immunology
|
Crotamine is a Na + channel modulator. Crotamine is a 42 amino acid toxin cross-linked by three disulfide bridges. Crotamine has analgesic activity. Crotamine also interacts with lipid membranes and shows myonecrotic activity. Crotamine can be isolated from Crotalus durissus terrificus venom .
|
- HY-P5146
-
- HY-P5148
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. α-Conotoxin BuIA can be used to distinguish nAChRs containing β2- and β4-subunit, respectively. α-Conotoxin BuIA distinguishes among αxβ2 nAChRs with a rank order potency of α6>α3>α2>α4 .
|
- HY-P5156
-
|
Potassium Channel
|
Neurological Disease
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
- HY-P5157
-
|
Potassium Channel
|
Neurological Disease
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
- HY-P5163
-
|
Peptides
|
Inflammation/Immunology
|
NMB-1 is a conopeptide analogue. NMB-1 selectively inhibits sustained mechanically activated currents in sensory neurons (IC50: 1 μM). NMB-1 inhibits mechanical pain. NMB-1 can be used for research of hearing and pressure-evoked pain .
|
- HY-P4373A
-
|
Cathepsin
MMP
|
Inflammation/Immunology
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
- HY-P5625
-
|
Bacterial
|
Infection
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
- HY-P1681
-
- HY-P5835
-
|
Potassium Channel
|
Neurological Disease
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
- HY-P5846
-
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
- HY-P5855
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin SxIIIC is an irreversible NaV channel inhibitor that can be obtained from the Conus striolatus. μ-Conotoxin SxIIIC can be used in the study of neurological diseases such as chronic pain .
|
- HY-P5865
-
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
- HY-P5869
-
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P5871
-
JzTx-XII
|
Potassium Channel
|
Others
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
- HY-P5872
-
JZTX-XI
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin XI (JZTX-XI) is a sodium conductance inhibitor with an IC50 of 124 nM. Jingzhaotoxin XI slows the fast inactivation (EC50=1.18±0.2 μM) of Nav1.5 expressed in Chinese hamster ovary (CHO-K1) cells .
|
- HY-P5899
-
- HY-P5900
-
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
- HY-P3269
-
|
Calcium Channel
|
Others
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
- HY-P5800
-
μ-TrTx-Phlo1b
|
Sodium Channel
|
Neurological Disease
|
Phlo1b (μ-TrTx-Phlo1b) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1b has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5801
-
μ-TrTx-Phlo1a
|
Sodium Channel
|
Neurological Disease
|
Phlo1a (μ-TrTx-Phlo1a) is a peptide toxin contains 35-amino acid residues. Phlo1b is a selective Nav1.7 inhibitor. Phlo1a has a weak inhibitory effect on Nav1.2 and Nav1.5 .
|
- HY-P5942
-
- HY-P5943
-
- HY-P5630
-
|
Bacterial
|
Infection
|
Aeschna defensing is an antimicrobial peptide derived from hemolymph of dragonfly aquatic larvae. Aeschna defensing has strong activity against gram-positive bacteria .
|
- HY-P5648
-
|
Peptides
|
Infection
|
PhD2 is an antimicrobial peptide derived from monkey white blood cells. PhD2 has activity against bacteria and fungus Candida albicans .
|
- HY-P5649
-
|
Peptides
|
Infection
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
- HY-P5738
-
|
Bacterial
|
Infection
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P5739
-
|
Bacterial
|
Infection
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
- HY-P5820
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin Bu8 is a ω-conotoxin, which consists of 25 amino acid residues and three disulfide bridges. ω-Conotoxin Bu8 selectively and potently inhibits depolarization-activated Ba2+ currents mediated by rat CaV2.2 expressed in HEK293T cells (IC50= 89 nM) .
|
- HY-P5807
-
β-Mammal toxin Cn2
|
Peptides
|
Neurological Disease
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
- HY-108814
-
DX-88
|
Ser/Thr Protease
|
Cardiovascular Disease
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
- HY-108814A
-
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
- HY-P5807A
-
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
- HY-P5141A
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin KIIIA TFA is an analgesic μ-conotoxin that can be isolated from Conus kinoshitai. μ-Conotoxin KIIIA blocks mammalian neuronal voltage-gated sodium channels (VGSCs) (Nav1.2). μ-Conotoxin KIIIA TFA can be used for research of pain .
|
- HY-P0173A
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.
|
- HY-106224
-
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P1411
-
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
- HY-P0173B
-
|
Chloride Channel
|
Cancer
|
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .
|
- HY-P1410A
-
GsMTx4 TFA
Maximum Cited Publications
28 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 TFA is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 TFA also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 TFA is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
- HY-106224A
-
Hypocretin-1 (human, rat, mouse) (TFA)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)) TFA, a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) TFA is a specific, high-affinity agonist for G-protein-coupled receptor OX1R. Orexin A (human, rat, mouse) TFA has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) TFA is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P2031
-
|
Arp2/3 Complex
|
Others
|
Phallacidin is a member of the phallotoxin family of mushroom toxins. Phallacidin binds F-actin .
|
- HY-P1390
-
|
Vasopressin Receptor
|
Endocrinology
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P1216A
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 TFA is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors respectively. HS014 TFA increases food intake in free-feeding rats .
|
- HY-P1216
-
|
Melanocortin Receptor
|
Neurological Disease
|
HS014 is a potent and selective melanocortin-4 (MC4) receptor antagonist, with Kis of 3.16, 108, 54.4 and 694 nM for human MC4, MC1, MC3 and MC5 receptors, respectively. HS014 modulates the behavioral effects of morphine in mice. HS014 increases food intake in free-feeding rats .
|
- HY-P1264
-
|
nAChR
|
Neurological Disease
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
- HY-P2496
-
|
Endothelin Receptor
|
Cardiovascular Disease
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-106244A
-
|
Peptides
|
Cancer
|
DOTATATE acetate is a DOTA-conjugated peptide. DOTATATE acetate can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) .
|
- HY-P2695
-
|
Peptides
|
Infection
|
STh, an Escherichia coli heat-stable toxin, is a 19 amino acid polypeptide encompassing three disulfide bridges. STh is an antigen of interest in the search for a broad coverage enterotoxigenic Escherichia coli (ETEC) vaccine .
|
- HY-P1424
-
|
Potassium Channel
|
Neurological Disease
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
- HY-P1410
-
GsMTx4
Maximum Cited Publications
28 Publications Verification
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
- HY-P3462
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
- HY-P3462A
-
|
CGRP Receptor
|
Metabolic Disease
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
- HY-106224B
-
Hypocretin-1 (human, rat, mouse) (acetate)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
Orexin A (Hypocretin-1) (human, rat, mouse) acetate is a hypothalamic neuropeptide with analgesic properties (crosses the blood-brain barrier). Orexin A (human, rat, mouse) acetate is also an OX1R agonist that induces the expression of BDNF and TH proteins in SH-SY5Y cells in a time- and dose-dependent manner. Orexin A (human, rat, mouse) acetate can be used in studies of appetite regulation, neurodegenerative diseases and modulation of injurious messaging .
|
- HY-P1266
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin EI is a selective nicotinic acetylcholine α1β1γδ receptor (nAChR) antagonist (IC50=187 nM) and an α3β4 receptor inhibitor. α-Conotoxin EI can block muscle and ganglionic receptors .
|
- HY-103277
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
- HY-P1960
-
|
Apoptosis
Reactive Oxygen Species
|
Cancer
|
Epidermal growth factor (EGF) is the key regulatory factor in promoting cell survival. Epidermal growth factor (EGF) signaling pathways are related with apoptosis. Loss of Epidermal growth factor (EGF) leads to embryonic or perinatal lethality with abnormalities in multiple organs. Epidermal growth factor (EGF) can stimulate reactive oxygen species (ROS) production for a short period of time in cells. Epidermal growth factor (EGF) can be used to research development and cancer .
|
- HY-P1219
-
β-TRTX-Cj1α
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-III is a potent and selective blocker of Nav1.5 channels, with an IC50 of 348 nM, and shows no effect on other sodium channel isoforms. Jingzhaotoxin-III can selectively inhibit the activation of cardiac sodium channel but not neuronal subtypes, and hopefully represents an important ligand for discriminating cardiac VGSC subtype .
|
- HY-P5164
-
|
Sodium Channel
|
Neurological Disease
|
GrTx1 is a peptide toxin originally isolated from the venom of the spider Grammostola rosea. GrTx1 blocks sodium channel, with IC50s of 0.63 µM, 0.23 µM, 0.77 µM, 1.29 µM, 0.63 µM and 0.37 µM for Nav1.1, Nav1.2, Nav1.3, Nav1.4, Nav1.6 and Nav1.7, repectively .GrTx1 can be used for neurological disease research .
|
- HY-P1409
-
|
Potassium Channel
|
Inflammation/Immunology
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
- HY-P5153
-
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
- HY-P5010
-
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-P1604
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
- HY-P3071
-
|
Potassium Channel
|
Inflammation/Immunology
|
ShK toxin blocks voltage-dependent potassium channel (Kv1.3 channel). ShK toxin can be isolated from the whole body extract of the Caribbean sea anemone (Stichodactylu helianthus). ShK toxin competes with dendrotoxin I and α-dendrotoxin for binding to synaptosomal membranes of rat brain, facilitates acetylcholine release. ShK toxin suppresses K+ currents in cultured rat dorsal root ganglion neurons. ShK toxin also inhibits T lymphocyte proliferation .
|
- HY-P5160
-
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P5167
-
|
Peptides
|
Inflammation/Immunology
|
GsAF-1 is a peptide toxin containing three disulfide bonds. GsAF-1 can be isolated from the venom of the Chilean pink tarantula. GsAF-1 can be used for research of moderate-to-severe pain .
|
- HY-P5183
-
|
Sodium Channel
|
Neurological Disease
|
Hm1a is a disulfide-rich spider-venom peptide, and a NaV1.1 activator. Hm1a restores the function of inhibitory interneurons in Dravet syndrome (DS) mouse model .
|
- HY-P3479
-
- HY-P3213
-
- HY-P5854
-
|
Potassium Channel
|
Neurological Disease
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
- HY-P5857
-
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
- HY-P5860
-
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
- HY-P5861
-
- HY-P5862
-
Mu-Conotoxin BuIIIB
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIB (Mu-Conotoxin BuIIIB) is a mammalian neuronal voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIB can be obtained from the venom of Cone snails and is a probe for ion channel function research. μ-Conotoxin BuIIIB can be used in the study of neurological diseases such as pain .
|
- HY-P5868
-
|
Sodium Channel
|
Neurological Disease
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
- HY-P3065
-
|
Calcium Channel
|
Neurological Disease
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
- HY-P3111
-
|
Potassium Channel
|
Others
|
Slotoxin, a peptide from Centruroides noxius Hoffmann scorpion venom, blocks high conductance calcium-activated potassium channel, with Kd of 1.5 nM[1].
|
- HY-P5799
-
SNX-238
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIID (SNX-238) is a Conus peptide that blocks an ω-Conotoxin-GVIA-sensitive, high-threshold Ca 2+ current in fish retinal ganglion cells .
|
- HY-P5681
-
|
Bacterial
|
Infection
Inflammation/Immunology
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
- HY-P5817
-
|
Sodium Channel
|
Neurological Disease
|
ω-Conotoxin CVIB is a non-selective N- and P/Q-type voltage-gated calcium channels (VGCCs) antagonist. ω-Conotoxin CVIB inhibits depolarization-activated whole-cell VGCC currents in dorsal root ganglion (DRG) neurons with a pIC50 of 7.64 .
|
- HY-P5821
-
- HY-P5921
-
TsTx-Kα
|
Peptides
|
Neurological Disease
|
Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons .
|
- HY-P5802
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin FVIA is an N-type Ca 2+channel (Ca v 2.2)
inhibitor. ω-Conotoxin FVIA reduces mechanical and thermal pain abnormalities
in a rat model of caudal nerve injury. ω-Conotoxin FVIA can be used in the
study of highly effective pain relievers with low side effects
.
|
- HY-P5805
-
- HY-P5916
-
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Peptides
|
Neurological Disease
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
- HY-P5179
-
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
- HY-P5177
-
- HY-P1604A
-
|
Sodium Channel
|
Inflammation/Immunology
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
- HY-103277A
-
|
Bombesin Receptor
|
Neurological Disease
Metabolic Disease
|
BIM 23042 TFA, a certain somatostatin (SS) octapeptide analogue, is a selective neuropeptide neuromedin B receptor (NMB-R, BB1) antagonist. BIM 23042 has 100-fold lower affinity for gastrin-releasing peptide (GRP) receptor (BB2). BIM 23042 inhibits Neuromedin B (HY-P0241), ICI 216140 and DPDM-bombesin ethylamide-induced Ca 2+ release .
|
- HY-P0028
-
|
Fluorescent Dye
|
Others
|
Phalloidin is a mushroom-derived toxin which can be used to label F-actin of the cytoskeleton with fluorochrome
.
|
- HY-P1202
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
- HY-P1202A
-
|
Somatostatin Receptor
|
Endocrinology
|
CYN 154806 TFA, a cyclic octapeptide, is a potent and selective somatostatin sst2 receptor antagonist, with pIC50 values of 8.58, 5.41, 6.07, 5.76 and 6.48 for human recombinant sst2, sst1, sst3, sst4 and sst5 receptors respectively .
|
- HY-P1329
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP is a potent and highly selective μ-opioid receptor antagonist. CTOP antagonizes the acute morphine-induced analgesic effect and hypermotility. CTOP enhances extracellular dopamine levels in the nucleus accumbens. CTOP dose-dependently enhances locomotor activity .
|
- HY-P1329A
-
|
Opioid Receptor
|
Neurological Disease
|
CTOP TFA is a potent and highly selective μ-opioid receptor antagonist. CTOP TFA antagonizes the acute analgesic effect and hypermotility. CTOP TFA enhances extracellular dopamine levels in the nucleus accumbens. CTOP TFA dose-dependently enhances locomotor activity .
|
- HY-P0188A
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin MVIIC TFA is a N- and P/Q-type Ca 2+ channel blocker, significantly suppresses the 11-keto-βboswellic acid-mediated inhibition of glutamate release .
|
- HY-P0191A
-
- HY-P1213A
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363 TFA, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC363 TFA blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
- HY-106244
-
|
Peptides
|
Cancer
|
DOTATATE is a DOTA-conjugated peptide. DOTATATE can be labelled with radionuclides for positron emission tomography (PET) imaging and peptide receptor radionuclide research (PRRT) .
|
- HY-P1213
-
|
Melanocortin Receptor
|
Neurological Disease
|
JKC363, a selective melanocortin MC4 receptor antagonist, has a 90-fold higher affinity at the MC4 receptor (IC50=0.5 nM) than at the MC3 receptor (44.9 nM). JKC-363 blocks the stimulatory effect of α-MSH on TRH release. Anti-hyperalgesic effect .
|
- HY-P3350
-
|
Bacterial
|
Infection
|
LS-BF1 is a stable and low toxic cationic antimicrobial peptide. LS-BF1 displays broad spectrum of antibacterial activity, including the challenging ESKAPE pathogens, by cell membrane disruptive mechanism. LS-BF1 shows good in vivo efficacy for elimination of bacteria in a mouse infection model[1].
|
- HY-P3546
-
- HY-P3064
-
Leiurotoxin I
|
Potassium Channel
|
Neurological Disease
|
Scyllatoxin (Leiurotoxin I) is a peptide toxin, it can be isolated from the venom of the scorpion (Leiurus quinquestriatus hebraeus). Scyllatoxin is a blocker of small-conductance KCa (SK) channel. Scyllatoxin enhances both norepinephrine (NE) and epinephrine (Epi) release in vivo .
|
- HY-P2588
-
|
Peptides
|
Inflammation/Immunology
Cancer
|
Osteocalcin (1-49) (human) is a vitamin K-dependent bone specific protein. Osteocalcin (1-49) (human) is chemotactic for several of the cell types frequently found at bone remodeling surfaces .
|
- HY-P4742
-
6-FAM-AEEAC-SHK
|
Biochemical Assay Reagents
|
Others
|
6-FAM-AEEAc-Stichodactyla helianthus Neurotoxin (ShK) (6-FAM-AEEAC-SHK) is a polypeptide that can be used as a Biochemical Assay Reagents.
|
- HY-P2112
-
DOTA-Nal3-octreotide
|
Somatostatin Receptor
|
Others
|
DOTA-NOC (DOTA-Nal3-octreotide) is a high-affinity ligand of somatostatin receptor subtypes 2, 3 and 5. DOTA-NOC can be used for labeling with various radiometals, and development of radiopeptide imaging .
|
- HY-P1426
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P5154
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5147
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin GID is a paralytic peptide neurotoxin and a selective antagonist of nAChR, with IC50s of 5 nM (α7), 3 nM (α3β2), 150 nM (α4β2), respectively. α-Conotoxin GID is small disulfide-rich peptide, with potential to inhibit chronic pain. α-Conotoxin GID contains a C-terminal carboxylate, thus substitution with a C-terminal carboxamide results in loss of α4β2 nAChR. α-Conotoxin GID can be isolated from the Conus species .
|
- HY-P5155
-
|
Potassium Channel
|
Neurological Disease
|
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats .
|
- HY-P5184
-
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
- HY-P5162
-
|
Sodium Channel
|
Inflammation/Immunology
|
Dc1a potently promotes opening of the German cockroach Nav channel (BgNav1). Dc1a is a toxin can be isolated from the desert bush spider Diguetia canities .
|
- HY-P5154A
-
|
Potassium Channel
|
Neurological Disease
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5336
-
- HY-P1264F
-
|
nAChR
|
Neurological Disease
|
FITC-α-Bungarotoxin is the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P1264F1
-
|
nAChR
|
Neurological Disease
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P5804
-
|
Calcium Channel
|
Neurological Disease
|
ω-Conotoxin CVIF is a selective Cav2.2 channel inhibitor with an IC50 of 34.3 nM in rat isolated DRG neurons. ω-Conotoxin CVIF block of Cav2.2 channels is weakly reversible .
|
- HY-P5852
-
Alpha-conotoxin EIIB
|
nAChR
|
Neurological Disease
|
α-Conotoxin EIIB (Alpha-conotoxin EIIB) is a toxin peptide that can be obtained from Conus ermineus. α-Conotoxin EIIB binds to nAChR (Ki=2.2 nM). α-Conotoxin EIIB can be used in the study of neurological diseases such as schizophrenia, drug addiction, Alzheimer's disease, and Parkinson's disease .
|
- HY-P5858
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin SIIIA is a tetrodotoxin (TTX)-resistant sodium channel blocker. μ-Conotoxin SIIIA is a toxic peptide that can be obtained from the venom of Conus snails. μ-Conotoxin SIIIA can be used in the study of neurological diseases, such as neuropathic pain .
|
- HY-P5864
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin BuIIIA (Mu-Conotoxin BuIIIA) is a voltage-gated sodium channel (VGSC) blocker. μ-Conotoxin BuIIIA is a toxic peptide that can be obtained from the venom of Cone snails. μ-Conotoxin BuIIIA can be used in the study of neurological diseases .
|
- HY-P1410B
-
- HY-P2785
-
- HY-P5944
-
|
Peptides
|
Others
|
Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943) .
|
- HY-P5180
-
|
Sodium Channel
|
Neurological Disease
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
- HY-P5626
-
|
Bacterial
|
Infection
|
Seabream hepcidin is an antimicrobial peptide with anti-bacterial (V.anguillarum), fungal (S.cerevisiae) and viral hemorrhagic septicemia virus activity .
|
- HY-P5459
-
|
Bacterial
Elastase
|
Infection
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
- HY-P2786A
-
- HY-P5172
-
|
Sodium Channel
|
Neurological Disease
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
- HY-P10046
-
|
Vasopressin Receptor
|
Metabolic Disease
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
- HY-P1410C
-
- HY-P10126
-
|
Peptides
|
Others
|
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .
|
- HY-P2785A
-
- HY-P1156A
-
- HY-P10014
-
- HY-P0061
-
- HY-P0061A
-
RC-160 acetate; BMY-41606 acetate
|
Neurokinin Receptor
|
Cancer
|
Vapreotide acetate (RC-160 acetate; BMY-41606 acetate) is a neurokinin-1 (NK1) receptor antagonist, with an IC50 of 330 nM.
|
- HY-P0036
-
SMS 201-995
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide (SMS 201-995) can bind to the somatostatin receptor and mainly subtypes 2, 3, and 5, increases Gi activity, and reduces intracellular cAMP production. Octreotide (SMS 201-995) has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P1959A
-
BIM 23014 acetate
|
Peptides
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) acetate is a somatostatin analogue with antineoplastic activity. Lanreotide acetate can be used for the research of carcinoid syndrome .
|
- HY-P1215
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, and 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
- HY-P1215A
-
|
Melanocortin Receptor
|
Metabolic Disease
|
HS024 is a selective MC4 receptor antagonist, with Kis of 0.29, 3.29, 5.45, 18.6 nM for MC4, MC5, MC3, and MC1, respectively. HS024 increase food intake .
|
- HY-P1980
-
|
Apoptosis
|
Metabolic Disease
|
A-71915 (TFA) is a selective inhibitor of ANP receptor (atrial natriuretic peptide-receptor), induces apoptosis and decreases insulin secretion in RINm5F pancreatic β-cells .
|
- HY-103048A
-
|
PD-1/PD-L1
|
Cancer
|
PD-1/PD-L1-IN 3 TFA, a macrocyclic peptide, is a potent and selective inhibitor of the PD-1/PD-L1 and CD80/PD-L1 interactions extracted from patent WO2014151634A1, compound No.1. PD-1/PD-L1-IN 3 TFA interferes with PD-L1 binding to PD-1 and CD80 by binding to PD-L1, with IC50s of 5.60 nM and 7.04 nM, respectively. PD-1/PD-L1-IN 3 TFA can be used for the research of various diseases, including cancer and infectious diseases .
|
- HY-P3143
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P3143A
-
|
PD-1/PD-L1
|
Cancer
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68 nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P2026
-
|
Peptides
|
Cardiovascular Disease
|
A 71915 is a highly potent and competitive natriuretic peptide receptor A (ANP, NPRA) antagonist (pKi= 9.18). A 71915 displaces [ 125I]ANP dose dependently, with a Ki of 0.65 nM. A71915( pA2= 9.48) against rat ANP-induced cGMP production in NB-OK-1 cells .
|
- HY-P0036B
-
SMS 201-995 pamoate
|
Somatostatin Receptor
Apoptosis
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
Octreotide (SMS 201-995) pamoate is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue. Octreotide pamoate can bind to the somatostatin receptors which are mainly subtypes 2, 3 and 5. Octreotide pamoate increases Gi activity and reduces intracellular cAMP production. Octreotide pamoate has antitumor activity, mediates apoptosis and may also be used in disease studies in acromegaly .
|
- HY-P1959
-
BIM 23014
|
Peptides
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) is a somatostatin analogue with antineoplastic activity. Lanreotide can be used for the research of carcinoid syndrome .
|
- HY-P1959B
-
BIM 23014 diTFA
|
Peptides
|
Endocrinology
Cancer
|
Lanreotide (BIM 23014) diTFA is a somatostatin analogue with antineoplastic activity. Lanreotide diTFA can be used for the research of carcinoid syndrome .
|
- HY-P3499
-
|
Guanylate Cyclase
|
Inflammation/Immunology
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
- HY-106216
-
|
Elastase
|
Infection
Inflammation/Immunology
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
- HY-P3955
-
- HY-P4372
-
|
Peptides
|
Others
|
Hepcidin-22 (human) is an inactive degradation product of hepcidin-25 that is present in the urine .
|
- HY-P4925
-
|
Peptides
|
Others
|
Biotinyl-(Arg8)-Vasopressin is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1408
-
|
Integrin
|
Cancer
|
Obtustatin is a non-RGD disintegrin of 41 residues. Obtustatin can be isolated from Vipera lebetina obtusa venom. Obtustatin is a potent and selective inhibitor of the adhesion of integrin α1β1 to collagen IV. Obtustatin inhibits angiogenesis, and can be used for research of cancer .
|
- HY-P1442
-
|
Adrenergic Receptor
|
Cancer
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
- HY-P1952
-
|
Sodium Channel
|
Inflammation/Immunology
|
μ-Conotoxin-CnIIIC is a 22-residue conopeptide that can be isolated from Conus consors. μ-Conotoxin-CnIIIC is a potent and persistent blocker of NaV1.4 channel. μ-Conotoxin-CnIIIC has analgesic, anaesthetic and myorelaxant properties .
|
- HY-P2700
-
|
Sodium Channel
|
Neurological Disease
|
μ-Conotoxin GIIIB is a 22-residue polypeptide that can be isolated from the venom of piscivorous cone snail Conus geographus. μ-Conotoxin GIIIB is a NaV1.4 channel inhibitor. μ-Conotoxin GIIIB blocks muscle cell's contraction .
|
- HY-P5140
-
|
Calcium Channel
|
Metabolic Disease
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P5143
-
|
Calcium Channel
|
Inflammation/Immunology
|
ω-Conotoxin SO3 is a blocker of N-type voltage-sensitive calcium channel. ω-Conotoxin SO3 is an analgesicω-conotoxin that can be isolated from the venom of C. striatus .
|
- HY-P5144
-
- HY-P5149
-
αC-PrXA
|
nAChR
|
Neurological Disease
|
αC-Conotoxin PrXA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 1.8 nM (α1β1εδ, adult) and 3.0 nM (α1β1γδ, fetal), respectively. αC-Conotoxin PrXA competes with α-bungarotoxin at the α/δ and α/γ subunit interfaces of the nAChR, shows high specificity against neuromuscular nAChR .
|
- HY-P5151
-
|
Peptides
|
Others
|
LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae .
|
- HY-P1285
-
Con-R
|
iGluR
|
Neurological Disease
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
- HY-P5849
-
αA-OIVA
|
nAChR
|
Neurological Disease
|
αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR. αA-Conotoxin OIVA is a peptide that can be derived from conotoxin. αA-Conotoxin OIVA paralyzes muscles .
|
- HY-P5902
-
- HY-P1952A
-
|
Sodium Channel
|
Neurological Disease
|
µ-Conotoxin-CnIIIC acetate, a 22-residue conopeptide, is a potent antagonist of the voltage-gated NaV1.4 sodium channel with an IC50 of 1.3 nM acting at the neuromuscular junction. µ-Conotoxin-CnIIIC acetate has myorelaxant and analgesic effects .
|
- HY-P1408A
-
|
Integrin
|
Cancer
|
Obtustatin triacetate is a 41-residue non-RGD disintegrin. Obtustatin triacetate can be isolated from the venom of Vipera lebetina obtusa. Obtustatin triacetate is a potent and selective inhibitor of integrin α1β1 adhesion to type IV collagen. Obtustatin triacetate inhibits angiogenesis and may be used in cancer research .
|
- HY-P5085
-
|
Peptides
|
Others
|
Acetyl-octreotide is a reduced linear peptide. Acetyl-octreotide can synthesize Re(V)-cyclized peptides in aqueous methanol solutions with low Sst receptor binding affinities .
|
- HY-P5822
-
- HY-P5175
-
|
mAChR
|
Neurological Disease
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
- HY-P5176
-
LtTx-1a
|
Peptides
|
Neurological Disease
|
Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity .
|
- HY-P1335
-
|
Opioid Receptor
|
Neurological Disease
|
CTAP is a potent, highly selective, and BBB penetrant μ opioid receptor antagonist, with an IC50 of 3.5 nM. CTAP displays over 1200-fold selectivity over δ opioid (IC50=4500 nM) and somatostatin receptors. CTAP can be used for the study of L-DOPA-induced dyskinesia (LID) and opiate overdose or addiction .
|
- HY-P1726A
-
|
Melanocortin Receptor
|
|
MSG606 TFA is a potent human MC1 receptor antagonist (IC50=17 nM). MSG606 TFA also partial agonist at human MC3 and MC5 receptors (EC50 values are 59 and 1300 nM, respectively). MSG606 TFA exhibits binding affinity for A375 melanoma cells in vitro. MSG606 TFA reverses the induced hyperalgesia in female mice, with no effect in male mice.
|
- HY-P4897
-
|
Peptides
|
Others
|
[Gly9-OH]-Atosiban is the analogue of Atosiban (HY-17572).
|
- HY-P1330
-
|
P2X Receptor
|
Inflammation/Immunology
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
- HY-P1443
-
|
Sodium Channel
|
Cancer
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
- HY-P5150
-
|
Peptides
|
Neurological Disease
|
alpha-Cobratoxin is a neurotoxin, which can be isolated from the venom of the Thailand cobra. alpha-Cobratoxin exhibits neuromodulatory, antiviral, and analgesic activity. alpha-Cobratoxin also shows potent immunosuppressive activity for acute and chronic multiple sclerosis. alpha-Cobratoxin is further on research in adrenomyeloneuropathy .
|
- HY-P5152
-
|
Sodium Channel
|
Neurological Disease
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
- HY-P5165
-
|
Potassium Channel
|
Inflammation/Immunology
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
- HY-P5833
-
κ-Bgt
|
nAChR
|
Neurological Disease
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
- HY-P4764
-
|
Melanocortin Receptor
|
Cardiovascular Disease
|
Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 is a cyclic octapeptide with MC4R agonism. Ac-DArg-c[Cys-Glu-His-DPhe-Arg-Trp-Cys]-NH 2 significantly increases heart rate and blood pressure .
|
- HY-P5568
-
- HY-P5931
-
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
- HY-P5182
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P5917
-
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
- HY-P5920
-
α-KTx 6.21
|
Peptides
|
Neurological Disease
|
Urotoxin is an inhibitor of the potassium channel. Urotoxin has a selective affinity for hKv1.2 channel .
|
- HY-P1426A
-
|
Potassium Channel
|
Inflammation/Immunology
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P5182A
-
|
Potassium Channel
|
Inflammation/Immunology
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P1682A
-
POL6326 TFA
|
CXCR
Arrestin
|
Cancer
|
Balixafortide TFA (POL6326 TFA) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide TFA shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide TFA blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide TFA is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-P1682
-
POL6326
|
CXCR
Arrestin
|
Cancer
|
Balixafortide (POL6326) is a potent, selective, well-tolerated peptidic CXCR4 antagonist with an IC50 < 10 nM. Balixafortide shows 1000-fold selective for CXCR4 than a large panel of receptors including CXCR7. Balixafortide blocks β-arrestin recruitment and calcium flux with IC50s < 10 nM. Balixafortide is also a potent hematopoietic stem and progenitor cell (HSPC) mobilizing agent. Anti-cancer effects .
|
- HY-P1102A
-
|
CXCR
HIV
|
Infection
Cancer
|
TC14012 TFA, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 TFA is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 TFA has anti-HIV activity and anti-cancer activity .
|
- HY-P1102
-
TC14012
2 Publications Verification
|
CXCR
HIV
|
Infection
Cancer
|
TC14012, a serum-stable derivative of T140, is a selective and peptidomimetic CXCR4 antagonist with an IC50 of 19.3 nM. TC14012 is a potent CXCR7 agonist with an EC50 of 350 nM for recruiting β-arrestin 2 to CXCR7. TC14012 has anti-HIV activity and anti-cancer activity .
|
- HY-P4745
-
|
MCHR1 (GPR24)
|
Metabolic Disease
|
hMCH-1R antagonist 1 (Compound 30) is an effective and selective antagonist of human melanin-concentrating hormone receptor 1 (hMCHR1) with an KB value of 3.6 nM. HMCH-1R antagonist 1 can bind to hMCHR1 and hMCHR2 with IC50 values of 65 nM and 49 nM, respectively. HMCH-1R antagonistist 1 can be used for metabolic research .
|
- HY-P2005
-
|
Peptides
|
Others
|
Malformin C is an algicidal peptide can be isolated from Aspergillus and exhibits dose-dependent algicidal activity. Malformin C induces a significant increase in ROS levels in algal cells, resulting in impaired SOD activity and high production of MDA content .
|
- HY-P5174
-
|
Sodium Channel
|
Neurological Disease
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
- HY-P10016
-
HS-20039; EPO-018B
|
Peptides
|
Endocrinology
|
Pegmolesatide(HS-20039; EPO-018B) a synthetic peptide-based erythropoiesis-stimulating agent, can be used for ??the study of anemia in chronic kidney disease .
|
- HY-P2244A
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 TFA is a potent and competitive peptide inhibitor of YAP-TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 TFA is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd= 40 nM) .
|
- HY-P1717A
-
Cp40 TFA
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 TFA (Cp40 TFA), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P1717
-
Cp40
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 (Cp40), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 (Cp40) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P1717B
-
Cp40 acetate
|
Complement System
SARS-CoV
|
Inflammation/Immunology
|
AMY-101 acetate (Cp40 acetate), a peptidic inhibitor of the central complement component C3 (KD = 0.5 nM), inhibits naturally occurring periodontitis in non-human primates (NHPs). AMY-101 acetate (Cp40 acetate) exhibits a favorable anti-inflammatory activity in models with COVID-19 severe pneumonia with systemic hyper inflammation .
|
- HY-P3066
-
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
- HY-P2244
-
|
YAP
|
Cancer
|
YAP-TEAD-IN-1 is a potent and competitive inhibitor of YAP–TEAD interaction (IC50=25 nM). YAP-TEAD-IN-1 is a 17mer peptide and shows a higher the binding affinity to TEAD1 (Kd=15 nM) than YAP (50-171) (Kd=40 nM) .
|
- HY-108719
-
- HY-P3561
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P4398
-
|
Peptides
|
Others
|
(Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4555
-
|
Somatostatin Receptor
|
Neurological Disease
|
(D-Phe5,Cys6,11,N-Me-D-Trp8)-Somatostatin-14 (5-12) amide (Compound 4) is a somatostatin analog with Kds of 0.61, 11.05, 23.5, 1200 and >1000 nM for SSTR5, SSTR3, SSTR2, SSTR1 and SSTR4, respectively .
|
- HY-P4397
-
|
Oxytocin Receptor
|
Endocrinology
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
- HY-P5006
-
d(CH2)5[Tyr(Me)2, Dab5]AVP
|
Vasopressin Receptor
|
Cardiovascular Disease
|
(d(CH2)51,Tyr(Me)2,Dab5,Arg8)-Vasopressin (d(CH2)5[Tyr(Me)2, Dab5]AVP) is a specific antagonist of vasopressin V1a receptor, with a pA2 of 6.71 .
|
- HY-P5954
-
|
Peptides
|
Others
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
- HY-P3561A
-
|
Melanocortin Receptor
|
Neurological Disease
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P3222
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3215
-
|
Peptides
|
Endocrinology
|
Oxytocin parallel dimer is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3215A
-
|
Peptides
|
Endocrinology
|
Oxytocin parallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P3222A
-
|
Peptides
|
Endocrinology
|
Oxytocin antiparallel dimer TFA is the disulfide-bridged homo peptide dimer. Oxytocin dimer has oxytocin and vasopressin-like activity with less toxic than oxytocin .
|
- HY-P4957
-
|
Peptides
|
Others
|
Octreotide dimer parallel is a dimer parallel of Octreotide. Octreotide (HY-P0036) is a somatostatin receptor agonist and synthetic octapeptide endogenous somatostatin analogue .
|
- HY-P5856
-
|
nAChR
|
Neurological Disease
|
αA-Conotoxin PIVA is a selective mouse musclenAChR inhibitor with IC50 for adult and fetal mouse musclenAChR sub> values are 2.3 nM and 22 nM respectively. αA-Conotoxin PIVA can be used in the study of neurological diseases.
|
- HY-P4980
-
|
Peptides
|
Others
|
Acetyl-Lys5-octreotide is a biologically active peptide .
|
- HY-P0189A
-
- HY-P5145
-
- HY-P1162
-
- HY-P5808
-
|
Peptides
|
Neurological Disease
|
lota-conotoxin RXIA is an agonist of voltage-gated
sodium channels (Nav1.2, 1.6, 1.7). Iota-conotoxin RXIA
can induce repetitive action potential and seizure in motor axons of frogs
after intracranial injection in mice .
|
- HY-P5808A
-
- HY-P1270
-
|
nAChR
|
Neurological Disease
|
α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors. α-Conotoxin Im-I is toxic and induces seizures in rodents. α-Conotoxin Im-I is a tool for studying neuronal nAChR .
|
- HY-P4469
-
- HY-P5825
-
- HY-P5173
-
|
Peptides
|
Others
|
MitTx-beta is a peptide can be isolated from the venom of the Texas coral snake (Micrurus tener tener). MitTx-beta can form a complex with MitTx-α, MitTx. MitTx has ASIC1 channel activating activity on capsaicin-sensitive nerve fibers .
|
- HY-P3124A
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190 hydrochloride, a somatostatin analog, a selective SSRT2 and SSRT5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P3124
-
|
Somatostatin Receptor
|
Cancer
|
BIM-23190, a somatostatin analog, a selective SSTR2 and SSTR5 agonist, exhibits Ki values of 0.34 nM and 11.1 nM for SSTR2 and SSTR5, respectively. BIM-23190 can be used in the study for cancer and acromegaly .
|
- HY-P2434
-
|
Somatostatin Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
AP102 is a dual SSTR2/SSTR5-specific somatostatin analog (SSA). AP102 is a disulfide-bridged octapeptide SSA containing synthetic iodinated amino acids. AP102 binds with subnanomolar affinity to SSTR2 and SSTR5 (IC50: 0.63 and 0.65 nM, respectively). AP102 does not bind to SSTR1 or SSTR3. AP102 can be used for acromegaly and neuroendocrine tumors research .
|
- HY-P10204
-
|
Wnt
|
Cancer
|
FZD7 antagonist 1 (peptide 34) is a dFz7-21 analogue. FZD7 antagonist 1 is an FZD7 antagonist that inhibits the wnt3a with IC50 value of 9.2 nM. FZD7 antagonist 1 blocks TcdB−FZD interaction via targeting FZD receptors .
|
- HY-P0171
-
BKT140 (4-fluorobenzoyl); BL-8040; TF14016
|
CXCR
|
Endocrinology
Cancer
|
Motixafortide (BKT140 4-fluorobenzoyl) is a novel CXCR4 antagonist with an IC50 vakue of ~1 nM.
|
- HY-P4895
-
|
Oxytocin Receptor
|
Neurological Disease
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
- HY-P5828
-
- HY-P4452
-
- HY-P5362
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-P5362A
-
|
Somatostatin Receptor
|
Cancer
|
NODAGA-LM3 TFA can be labeled by 68Ga for PET imaging. 68Ga-NODAGA-LM3 TFA is a SSTR2 antagonist, and can be used for imaging of SSTR positive paragangliomas .
|
- HY-P4890
-
- HY-P4890A
-
- HY-P1955
-
AMG 416; KAI-4169
|
CaSR
|
Endocrinology
|
Etelcalcetide (AMG 416) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
- HY-P1955A
-
AMG 416 hydrochloride; KAI-4169 hydrochloride
|
CaSR
|
Endocrinology
|
Etelcalcetide hydrochloride (AMG 416 hydrochloride) is a synthetic peptide as an activator of the calcium sensing receptor (CaSR). Etelcalcetide hydrochloride is effective in lowering parathyroid hormone (PTH) concentrations in patients receiving dialysis with secondary hyperparathyroidism receiving hemodialysis .
|
- HY-P0041A
-
- HY-P3432
-
|
Peptides
|
Others
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
- HY-P1607
-
- HY-P4903
-
|
Peptides
|
Cancer
|
RGD-targeted Proapoptotic Peptide is a peptide. The C-terminal RGD-4C peptide (ACDCRGDCFC) binds preferentially to integrins at sites of tumor angiogenesis.
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: