2. Search Result
Search Result
Results for "

neuropathic

" in MCE Product Catalog:

138

Inhibitors & Agonists

10

Peptides

9

Natural
Products

4

Isotope-Labeled Compounds

1

Click Chemistry

Cat. No. Product Name Target Research Areas
  • HY-100771
    PCC0208009

    		Indoleamine 2,3-Dioxygenase (IDO) Cardiovascular Disease
    PCC0208009 is a potent IDO inhibitor with an IC50 value of 4.52 nM in HeLa cell. PCC0208009 alleviates neuropathic pain and comorbidities by regulating synaptic plasticity of anterior cingulate cortex (ACC) and amygdala .
  • HY-131004
    CB2R PAM

    		Cannabinoid Receptor Neurological Disease
    CB2R PAM is an orally active cannabinoid type-2 receptors (CB2Rs) positive allosteric modulator. CB2R PAM displays antinociceptive activity in vivo in an experimental mouse model of neuropathic pain.
  • HY-100080
    A-887826

    		Sodium Channel Neurological Disease
    A-887826 is a potent, selective, oral bioavailable and voltage-dependent Na(v)1.8 sodium channel blocker with an IC50 of 11 nM . A-887826 attenuates neuropathic tactile allodynia in vivo.
  • HY-12909
    MK-4409

    		FAAH Inflammation/Immunology Neurological Disease
    MK-4409 is a potent oxazole FAAH inhibitor and can be used for the research of inflammatory and neuropathic pain.
  • HY-113608
    VCP171

    		Adenosine Receptor Neurological Disease
    VCP171 is a potent adenosine A1 receptor (A1R) positive allosteric modulator (PAM). VCP171 is effective at decreasing excitatory synaptic currents in Lamina II of neuropathic pain model. VCP171 can be used for researching neuropathic pain.
  • HY-110036
    GW-405833

    L768242

    		 Cannabinoid Receptor Inflammation/Immunology Neurological Disease
    GW-405833 (L768242) is a potent, selective cannabinoid receptor 2 (CB2) agonist with an EC50 of 50.7 nM. GW-405833 also behaves as a noncompetitive CB1 antagonist. GW-405833 suppresses inflammatory and neuropathic pain.
  • HY-N0478
    Neoline
    1 Publications Verification

    Bullatine B

    		 Others Neurological Disease
    Neoline, the active ingredient of processed aconite root (PA), alleviated oxaliplatin-induced peripheral neuropathy in mice. Neoline can be used as a marker compound to determine the quality of the PA products for the treatment of neuropathic pain.
  • HY-143263
    FAAH/MAGL-IN-1

    		FAAH MAGL Neurological Disease
    FAAH/MAGL-IN-1 (compound SIH 3) is a potent FAAH and MAGL inhibitor with IC50s of 31 nM and 29 nM, respectively. FAAH/MAGL-IN-1 has the potential for the research of neuropathic pain.
  • HY-103344
    ZJ43

    		Aminopeptidase mGluR Inflammation/Immunology Neurological Disease
    ZJ43 is a potent NAAG peptidase inhibitor, with an IC50 of 2.4 nM and a Ki of 0.8 nM. ZJ43 sufficiently activates group II mGluR and reduces some of the behavioral effects of PCP. ZJ43 shows an analgesic effect in neuropathic and inflammatory and pain models.
  • HY-14897
    Rezatomidine

    AGN-203818

    		 Adrenergic Receptor Metabolic Disease Neurological Disease
    Rezatomidine (AGN-203818) is a potent and selective α2-AR agonist. Rezatomidine can be used for diabetic neuropathy and neuropathic pain research.
  • HY-15451
    MDA 19
    1 Publications Verification

    		 Cannabinoid Receptor Neurological Disease
    MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a Ki of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity.
  • HY-B0161E
    (±)-Duloxetine hydrochloride

    (Rac)-Duloxetine hydrochloride

    		 Serotonin Transporter Neurological Disease
    (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research.
  • HY-145584
    Nesuparib

    JPI-547/OCN-201

    		 PARP Neurological Disease Cardiovascular Disease
    Nesuparib is a potent inhibitor of PARP. Nesuparib is useful for the research of neuropathic pain, neurodegenerative disease, and cardiovascular disease (extracted from patent WO2016200101A2).
  • HY-147306
    ZLc-002

    		Others Neurological Disease
    ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain. ZLc-002 can be used for the research of anxiety disorder and inflammation.
  • HY-117714
    AZD-3161

    		Sodium Channel Neurological Disease
    AZD-3161 is a potent and selective blocker of NaV1.7 channel, with a pIC50 of 7.1. AZD-3161 can be used for the research of neuropathic and inflammatory pain.
  • HY-155616
    KSK94

    		Histamine Receptor Sigma Receptor Neurological Disease
    KSK94 is a high-affinity histamine H3 receptor antagonist, with Kis of 7.9, 2958, 75.2 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK94 can be used for research of nociceptive and neuropathic pain.
  • HY-132133
    Nav1.8-IN-1

    		Sodium Channel Inflammation/Immunology Neurological Disease
    Nav1.8-IN-1 (Compound 31) is a potent inhibitor of Na(v)1.8 sodium channel. Nav1.8-IN-1 has the potential for the research of inflammatory and neuropathic pain.
  • HY-155615
    KSK67

    		Histamine Receptor Sigma Receptor Neurological Disease
    KSK67 is a high-affinity dual sigma-2 and histamine H3 receptor antagonist, with Kis of 3.2, 1531, 101 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK67 can be used for research of nociceptive and neuropathic pain.
  • HY-143879
    MRGPRX1 agonist 3

    		Others Neurological Disease
    MRGPRX1 agonist 3 (compound 1f) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.22 μM. MRGPRX1 agonist 3 can be used for researching neuropathic pain.
  • HY-A0057
    Gabapentin
    Maximum Cited Publications
    8 Publications Verification

    		 Calcium Channel Neurological Disease Cancer
    Gabapentin is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain.
  • HY-A0057A
    Gabapentin hydrochloride
    Maximum Cited Publications
    8 Publications Verification

    		 Calcium Channel Neurological Disease Cancer
    Gabapentin hydrochloride is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain.
  • HY-14900
    Tedalinab

    GRC-10693

    		 Cannabinoid Receptor Inflammation/Immunology
    Tedalinab (GRC-10693) is a potent, orally active, and selective cannabinoid receptor 2 (CB2) agonist. Tedalinab has >4700-fold functional selectivity for CB2 over CB1. Tedalinab has potential for neuropathic pain and osteoarthritis treatment.
  • HY-143878
    MRGPRX1 agonist 2

    		Others Neurological Disease
    MRGPRX1 agonist 2 (compound 1a) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.48 μM. MRGPRX1 agonist 2 can be used for researching neuropathic pain.
  • HY-15078
    NS1219

    (R)-SPD502

    		 iGluR Neurological Disease
    NS1219 ((R)-SPD502) is the isomer of NS 1209 HY-15074. NS1209 is a selective AMPA receptor antagonist with neuroprotective activity. NS1209 can be used for the research of stroke, neuropathic pain and epilepsy.
  • HY-143880
    MRGPRX1 agonist 4

    		Others Neurological Disease
    MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain.
  • HY-155614
    KSK68

    		Histamine Receptor Sigma Receptor Neurological Disease
    KSK68 is a high-affinity dual sigma-1 and histamine H3 receptor antagonist, with Kis of 7.7, 3.6, 22.4 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK68 has negligible affinity at the other histamine receptor subtypes. KSK68 can be used for research of nociceptive and neuropathic pain.
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
  • HY-P3431A
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

    		iGluR Neurological Disease
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
  • HY-144301
    AAK1-IN-2

    		AAK1 Neurological Disease
    AAK1-IN-2 (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC50 of 5.8 nM. AAK1-IN-2 can be used for the research of neuropathic pain.
  • HY-107656
    PTAC oxalate

    		mAChR Neurological Disease
    PTAC oxalate is a selective muscarinic receptor ligand. PTAC oxalate is an partial agonist of M2 and M4 but antagonist of M1, M3, and M5 (Ki values of 0.2-2.8 nM for hM1-5 in CHO cells). PTAC oxalate alleviates the mechanical allodynia on the neuropathic pain and has antidepression effects.
  • HY-151391
    LPA5 antagonist 1

    		Others Neurological Disease
    LPA5 antagonist 1 (Compound 66) is a potent and selective lysophosphatidic acid receptor 5 (LPA5) antagonist (IC50=32 nM). LPA5 antagonist 1 shows high brain permeability and anti-nociceptive activity. LPA5 antagonist 1 can be used in inflammatory and neuropathic pain research.
  • HY-144301A
    AAK1-IN-2 TFA

    		AAK1 Neurological Disease
    AAK1-IN-2 TFA (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC50 of 5.8 nM. AAK1-IN-2 TFA can be used for the research of neuropathic pain.
  • HY-108449
    Acoltremon

    WS-12; AR-15512; AVX-012

    		 TRP Channel Cancer
    Acoltremon (WS-12; AR-15512) is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research.
  • HY-133130
    JNJ-42226314

    		MAGL Neurological Disease
    JNJ-42226314 is a competitive, highly selective and reversible non-covalent monoacylglycerol lipase (MAGL) inhibitor. JNJ-42226314 demonstrates dose-dependent enhancement of the major endocannabinoid 2-arachidonoylglycerol (2-AG) as well as efficacy in models of neuropathic and inflammatory pain.
  • HY-P0244
    Dermorphin

    		Opioid Receptor Neurological Disease
    Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.
  • HY-16935
    Mavatrep

    JNJ-39439335

    		 TRP Channel Neurological Disease
    Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca 2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain.
  • HY-129421
    PA-9

    		Others Inflammation/Immunology Neurological Disease
    PA-9 is a pituitary adenylate cyclase-activating polypeptide (PACAP) type I (PAC1) receptor antagonist. PA-9 dose dependently inhibits PACAP-induced cAMP elevation with an IC50 of 5.6 nM. PA-9 can be used for the research of neuropathic and/or inflammatory pain.
  • HY-P0244A
    Dermorphin TFA

    		Opioid Receptor Neurological Disease
    Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain.
  • HY-P3618
    Cortistatin 29

    		Somatostatin Receptor Neurological Disease
    Cortistatin 29 is a neuropeptide. Cortistatin 29 alleviates neuropathic pain. Cortistatin 29 binds with high affinity all somatostatin (SS) receptor subtypes and shows IC50 values of 2.8, 7.1, 0.2, 3.0, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin 29 shows anti-fibrotic effects.
  • HY-155184
    A3AR agonist 2

    		Adenosine Receptor Cancer Inflammation/Immunology Neurological Disease
    A3AR agonist 2 (Compound 19) a selective A3AR agonist (Ki: 22.1 nM). A3AR agonist 2 stimulates β-arrestin2 recruitment, with EC50 value of 4.36 nM. A3AR agonist 2 can be used for research of inflammatory diseases, ischemia, cancer, neuropathic pain, liver diseases, and other chronic conditions.
  • HY-143264
    FAAH/MAGL-IN-2

    		FAAH MAGL Neurological Disease
    FAAH/MAGL-IN-2 is a potent, reversible, orally active, and cross the blood-brain barrier FAAH and MAGL inhibitor with IC50s of 11 nM and 36 nM (Kis of 28 nM and 60 nM), respectively . FAAH/MAGL-IN-2 has the potential to research neuropathic pain without causing locomotion impairment.
  • HY-144302
    AAK1-IN-3

    		AAK1 Neurological Disease
    AAK1-IN-3, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC50 of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research.
  • HY-155183
    A3AR agonist 1

    		Adenosine Receptor Cancer Inflammation/Immunology
    A3AR agonist 1 (Compound 12) is an A3AR agonist (Ki: 25.8 nM). A3AR agonist 1 stimulates β-arrestin2 recruitment, with an EC50 value of 5.17 nM. A3AR agonist 1 can be used for research of inflammatory diseases, ischemia, cancer, neuropathic pain, liver diseases, etc.
  • HY-151392
    LPA5 antagonist 2

    		Others Inflammation/Immunology Neurological Disease
    LPA5 antagonist 2 (compound 65) is a high aqueous solubility LPA5 (lysophosphatidic acid receptor 5) antagonist. LPA5 antagonist 2 significantly attenuates nociceptive hypersensitivity and it can be used for the research of inflammatory and neuropathic pains.
  • HY-125111
    PSB-SB-487

    		GPR55 Cannabinoid Receptor Cancer Metabolic Disease Neurological Disease
    PSB-SB-487 is a potent GPR55 antagonist and CB2 agonist with an IC50 value of 0.113 µM for GPR55, and a Ki value of 0.292 µM for human CB2. PSB-SB-487 can be used for researching diabetes, Parkinson’s disease, neuropathic pain, and cancer.
  • HY-131019
    JF-NP-26

    		mGluR Neurological Disease
    JF-NP-26, an inactive photocaged derivative of raseglurant, is the first caged mGlu5 receptor negative allosteric modulator. Uncaging of JF-NP-26 is elicited with light pulses in the visible spectrum (405 nm). JF-NP-26 induces light-dependent analgesia in models of inflammatory and neuropathic pain in freely behaving animals.
  • HY-144302A
    AAK1-IN-3 TFA

    		AAK1 Neurological Disease
    AAK1-IN-3 TFA, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC50 of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research.
  • HY-103111
    MMPIP hydrochloride

    		mGluR Neurological Disease
    MMPIP hydrochloride is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (KB values 24 -30 nM). MMPIP hydrochloride acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP hydrochloride alleviates pain and normalizes affective and cognitive behavior in neuropathic mice.
  • HY-107503
    MMPIP

    		mGluR Neurological Disease
    MMPIP is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (KB values 24 -30 nM). MMPIP acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP alleviates pain and normalizes affective and cognitive behavior in neuropathic mice.
  • HY-136459
    NMDA receptor antagonist 2

    		iGluR Neurological Disease
    NMDA receptor antagonist 2 is a potent and orally active NR2B subtype-selective NMDA antagonist with an IC50 and a Ki of 1.0 nM and 0.88 nM, respectively. NMDA receptor antagonist 2 is used for the study of neuropathic pain and Parkinson’s disease.
  • HY-146280
    mGAT3/4-IN-1

    		GABA Receptor Metabolic Disease Neurological Disease
    mGAT3/4-IN-1 (compound 19b) is a potent mGAT3/mGAT4 inhibitor, with pIC50 values of 5.31 and 5.24, respectively. mGAT3/4-IN-1 exhibits a significant tactile allodynia reduction in diabetic neuropathic mice.
  • HY-145838
    AAK1-IN-4

    		AAK1 Neurological Disease
    AAK1-IN-4 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC50 of 4.6 nM, Filt Ki of 0.9 nM, and cell IC50 of 8.6 nM). AAK1-IN-4 has the potential for the research for neuropathic pain.
  • HY-145839
    AAK1-IN-5

    		AAK1 Neurological Disease
    AAK1-IN-5 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC50 of 1.2 nM, Filt Ki of 0.05 nM, and cell IC50 of 0.5 nM). AAK1-IN-4 has the potential for the research for neuropathic pain.
  • HY-N2573A
    Corydalmine hydrochloride

    L-Corydalmine hydrochloride; TLZ-16-CL

    		 Fungal CXCR Infection Neurological Disease
    Corydalmine hydrochloride inhibits spore germination of some plant pathogenic as well as saprophytic fungi. Corydalmine hydrochloride acts as an oral analgesic agent, exhibiting potent analgesic activity. Corydalmine hydrochloride alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway.
  • HY-143583
    ATX inhibitor 10

    		Others Cancer Neurological Disease
    ATX inhibitor 10 is a potent inhibitor of ATX. ATX inhibitor 10 is s nitrogen-containing heterocyclic compound. ATX plays a role in causing pathological conditions including fibrosis, arthritis, neurodegeneration, neuropathic pain, and cancer. ATX inhibitor 10 has the potential for the research of ATX related diseases (extracted from patent WO2021115375A1, compound 35).
  • HY-12844
    Ro 64-6198
    1 Publications Verification

    		 Opioid Receptor Neurological Disease
    Ro 64-6198 is a potent, selective, nonpeptide, high-affinity, high cellular permeability and brain penetration N/OFQ receptor (NOP) agonist with an EC50 value of 25.6 nM. Ro 64-6198 is at least 100 times more selective for the NOP receptor over the classic opioid receptors. Ro 64-6198 can be used for stress and anxiety, addiction, neuropathic pain, cough, and anorexia.
  • HY-118140
    ZCZ011

    		Cannabinoid Receptor Inflammation/Immunology Neurological Disease
    ZCZ011 is a potent and brain penetrant cannabinoid 1 (CB1) receptor positive allosteric modulator. ZCZ011 potentiates binding of CP55,940 to the CB1 receptor, enhances anandamide (AEA)-stimulated GTPγS binding in mouse brain membranes. ZCZ011 increases β-arrestin recruitment and ERK phosphorylation in hCB1 cells. ZCZ011 can be used for researching neuropathic and inflammatory pain.
  • HY-11079
    A-803467
    1 Publications Verification

    		 Sodium Channel Inflammation/Immunology Neurological Disease
    A-803467 is a potent and selective tetrodotoxin-resistant Nav1.8 sodium channel blocker (IC50=8 nM). A-803467 has shown significant anti-nociception in neuropathic and inflammatory pain models. A-803467 enhances the chemosensitivity of conventional anticancer agents through interaction with the ATP-binding cassette subfamily G member 2 (ABCG2) transporter.
  • HY-110143
    CLP257

    		Potassium Channel Neurological Disease
    CLP257 is a selective K +-Cl − cotransporter KCC2 activator with an EC50 of 616 nM. CLP257 is inactive against NKCC1, GABAA receptors, KCC1, KCC3 or KCC4. CLP257 restores impaired Cl − transport in neurons with diminished KCC2 activity. CLP257 alleviates hypersensitivity in rats with neuropathic pain. CLP257 modulates plasmalemmal KCC2 protein turnover post-translationally.
  • HY-B0563A
    Ropivacaine hydrochloride monohydrate
    3 Publications Verification

    		 Sodium Channel Potassium Channel Neurological Disease Cardiovascular Disease
    Ropivacaine hydrochloride monohydrate is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is widely used for regional anesthesia and neuropathic pain management in vivo.
  • HY-115681
    (2R/S)-6-PNG

    6-Prenylnaringenin; (±)-6-Prenylnaringenin

    		 Calcium Channel Neurological Disease
    (2R/S)-6-PNG (6-Prenylnaringenin) is a potent and reversible Cav3.2 T-type Ca 2+ channels (T-channels) blocker. (2R/S)-6-PNG can penetrate the blood-brain barrier (BBB). (2R/S)-6-PNG suppresses neuropathic and visceral pain in mice.
  • HY-144200
    CCR8 antagonist 2

    		CCR Cancer Neurological Disease
    CCR8 antagonist 2 is a potent antagonist of CCR8. CCR8 (C-C Motif Chemokine Receptor 8) is predominantly expressed on Treg cells and Th2 cells, but not on Th1 cells. CCR8 antagonist 2 inhibits CCR8 activity, which may be used in the research of diseases mediated by CCR8, such as cancer, and/or neuropathic pain (extracted from patent WO2022000443A1, compound 220).
  • HY-121333
    Dinactin

    		Antibiotic Wnt β-catenin Cancer Neurological Disease Infection
    Dinactin, an antibiotic ionophore produced by Streptomyces species, as an effective small molecule targeting Wnt/β-catenin signaling pathway in cancer cells. Dinactin shows marked inhibition of HCT-116 cell growth with an IC50 of 1.1 µM. Dinactin shows anti-proliferative activity against the cancer cells in apoptosis-independent manner. Dinactin is also an effective agent for the research of neuropathic pain.
  • HY-B0563
    Ropivacaine
    3 Publications Verification

    		 Sodium Channel Potassium Channel Neurological Disease Cardiovascular Disease
    Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is used for the research of neuropathic pain management.
  • HY-B0563B
    Ropivacaine hydrochloride
    3 Publications Verification

    		 Sodium Channel Potassium Channel Neurological Disease Cardiovascular Disease
    Ropivacaine hydrochloride is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is widely used for neuropathic pain management in vivo.
  • HY-103461
    FAAH-IN-6

    		FAAH Neurological Disease
    FAAH-IN-6 (compound 21d) is a potent, orally active and cross the blood-brain barrier fatty acid amide hydrolase (FAAH) inhibitor with IC50s of 0.72, 0.28 nM for hFAAH, rFAAH, respectively. FAAH-IN-6 shows dose-dependent analgesic efficacy in animal models of both neuropathic and inflammatory pain.
  • HY-B0563C
    Ropivacaine mesylate
    3 Publications Verification

    		 Sodium Channel Potassium Channel Neurological Disease Cardiovascular Disease
    Ropivacaine mesylate is a long-acting amide local anaesthetic agent for a spinal block and effectively blocks neuropathic pain. Ropivacaine blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibressup>[1]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane.
  • HY-125777A
    α-Conotoxin Vc1.1 TFA

    		nAChR Neurological Disease
    α-Conotoxin Vc1.1 TFA is a disulfide-bonded peptide isolated from Conus victoriae and is a selective nAChR antagonist. α-Conotoxin Vc1.1 TFA inhibits α3α5β2, α3β2 and α3β4 with IC50s of 7.2 μM, 7.3 μM and 4.2 μM, respectively, and has less inhibitory effect on other nAChR subtypes. α-Conotoxin Vc1.1 TFA has the potential for neuropathic pain reserach.
  • HY-100822
    (R)-(+)-HA-966

    (+)-HA-966

    		 iGluR Neurological Disease
    (R)-(+)-HA-966 ((+)-HA-966) is a partial agonist/antagonist of glycine site of the N-methyl-D-aspartate (NMDA) receptor complex. (R)-(+)-HA-966 selectively blocks the activation of the mesolimbic dopamine system by amphetamine. (R)-(+)-HA-966 can cross the blood-brain barrier and has the potential for neuropathic and acute pain.
  • HY-147560
    σ1 Receptor/μ Opioid receptor modulator 1

    		Sigma Receptor Opioid Receptor Neurological Disease
    σ1 Receptor/μ Opioid receptor modulator 1 (Compound 44) is a potent σ1 receptor antagonist and μ opioid receptor agonist with Kis of 1.86 nM and 2.1 nM, respectively.σ1 Receptor/μ Opioid receptor modulator 1 exhibits potent analgesic activity. σ1 Receptor/μ Opioid receptor modulator 1 can be used for the research of neuropathic pain.
  • HY-107794
    Clodronate disodium tetrahydrate

    Disodium clodronate tetrahydrate

    		 Others Inflammation/Immunology Neurological Disease Cancer
    Clodronate disodium tetrahydrate (Disodium clodronate tetrahydrate) is first-generation bisphosphonate, with anti-osteoporotic, anti-inflammatory and analgesic effects. Clodronate disodium tetrahydrate is a selective, potent, reversible and Cl - competitive vesicular nucleotide transporter (VNUT) inhibitor, with an IC50 of 15.6 nM. Clodronate disodium tetrahydrate inhibits vesicular ATP release from neurons and reduces chronic neuropathic and inflammatory pain.
  • HY-18099A
    S1RA hydrochloride
    1 Publications Verification

    E-52862 hydrochloride

    		 Sigma Receptor 5-HT Receptor Neurological Disease
    S1RA (E-52862) hydrochloride is an orally active and selective sigma-1 receptor (σ1R) antagonist with a Ki value of 17 nM. S1RA hydrochloride shows good selectivity against σ2R (Ki >1000 nM). S1RA hydrochloride is a human 5-HT2B receptor antagonist with an IC50 value of 4.7 μM. S1RA hydrochloride inhibits neuropathic pain and activity-induced spinal sensitization.
  • HY-B0563BS
    Ropivacaine-d7 hydrochloride

    		Isotope-Labeled Compounds Neurological Disease
    Ropivacaine-d7 hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B). Ropivacaine hydrochloride is a potent?sodium channel?blocker and blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane. Ropivacaine is widely used for neuropathic pain?management in vivo.
  • HY-P1220
    Huwentoxin-IV

    		Sodium Channel Neurological Disease
    Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain.
  • HY-15568A
    A-317491 sodium salt hydrate
    3 Publications Verification

    		 P2X Receptor Inflammation/Immunology Neurological Disease
    A-317491 sodium salt hydrate is a potent, selective and non-nucleotide antagonist of P2X3 and P2X2/3 receptors, with Kis of 22, 22, 9, and 92 nM for hP2X3, rP2X3, hP2X2/3, and rP2X2/3, respectively. A-317491 sodium salt hydrate is highly selective (IC50>10 μM) over other P2 receptors and other neurotransmitter receptors, ion channels, and enzymes. A-317491 sodium salt hydrate reduces inflammatory and neuropathic pain by blocking P2X3 and P2X2/3 receptor-mediated calcium flux.
  • HY-15568
    A-317491
    3 Publications Verification

    		 P2X Receptor Inflammation/Immunology Neurological Disease
    A-317491 is a potent, selective and non-nucleotide antagonist of P2X3 and P2X2/3 receptors, with Kis of 22, 22, 9, and 92 nM for hP2X3, rP2X3, hP2X2/3, and rP2X2/3, respectively. A-317491 is highly selective (IC50>10 μM) over other P2 receptors and other neurotransmitter receptors, ion channels, and enzymes. A-317491 reduces inflammatory and neuropathic pain by blocking P2X3 and P2X2/3 receptor-mediated calcium flux.
  • HY-B1191
    Nanofin

    2,6-Lupetidine

    		 Others Cardiovascular Disease
    Nanofin is neuropathic blocker, with antihypertensive effect, used for mild to moderate hypertension.
  • HY-P1220A
    Huwentoxin-IV TFA

    		Sodium Channel Neurological Disease
    Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain.
  • HY-148708
    Oleoyl-D-lysine

    		iGluR Neurological Disease
    Oleoyl-D-lysine is a selective Glycine Transporter-2 (GlyT2) inhibitor based on lipid. Oleoyl-D-lysine reverses neuropathic pain in mice, shows antidrowsiness effect on chronic neuropathic pain. Oleoyl-D-lysine is safe and effective without respiratory depression.
  • HY-P1626
    Acetyl tetrapeptide-15

    		Opioid Receptor Neurological Disease
    Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway.
  • HY-105283
    PF 04531083

    		Sodium Channel Neurological Disease
    PF 04531083 is a selective NaV1.8 blocker, and used for the research of neuropathic/inflammatory pain.
  • HY-B1583
    (Z)-Capsaicin

    Zucapsaicin; Civamide; cis-Capsaicin

    		 TRP Channel HSV Neurological Disease
    (Z)-Capsaicin is the cis isomer of capsaicin, acts as an orally active TRPV1 agonist, and is used in the research of neuropathic pain.
  • HY-101290A
    BMT-090605 hydrochloride

    		Cyclin G-associated Kinase (GAK) AAK1 Neurological Disease
    BMT-090605 hydrochloride is a potent, selective the adapter protein-2 associated kinase 1 (AAK1) inhibitor with an IC50 value of 0.6 nM. BMT-090605 hydrochloride shows antinociceptive activity. BMT-090605 hydrochloride inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50 values of 45 nM and 60 nM, respectively. BMT-090605 hydrochloride can be used for the research of neuropathic pain.
  • HY-101290
    BMT-090605

    		AAK1 Cyclin G-associated Kinase (GAK) Neurological Disease
    BMT-090605 is a potent, selective the adapter protein-2 associated kinase 1 (AAK1) inhibitor with an IC50 value of 0.6 nM. BMT-090605 shows antinociceptive activity. BMT-090605 inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50 values of 45 nM and 60 nM, respectively. BMT-090605 can be used for the research of neuropathic pain.
  • HY-112430
    TRPM8 antagonist 2
    1 Publications Verification

    		 TRP Channel Neurological Disease
    TRPM8 antagonist 2 is a potent and selective TRPM8 antagonist, with an IC50 of 0.2 nM, used in the research of neuropathic pain syndromes.
  • HY-N3710
    Dehydrocrenatidine

    Kumujian G; O-Methylpicrasidine I

    		 JAK Apoptosis Cancer Neurological Disease
    Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain.
  • HY-P1267
    α-Conotoxin PnIA

    		nAChR Neurological Disease
    α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease.
  • HY-149863
    DDO-8926

    		Epigenetic Reader Domain Neurological Disease
    DDO-8926 is a potent and selective BET inhibitor that can significantly reduce mechanical hypersensitivity by inhibiting the expression of pro-inflammatory cytokines and reducing excitability for neuropathic pain research.
  • HY-A0057S
    Gabapentin-d4

    		Calcium Channel Neurological Disease
    Gabapentin-d4 is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.
  • HY-135653
    EC5026

    BPN-19186

    		 Epoxide Hydrolase Neurological Disease
    EC5026 (BPN-19186) is a first-in-class, non-opioid and orally active soluble Epoxide Hydrolase (sEH) inhibitor. EC5026 shows efficacy for inflammatory and neuropathic pain.
  • HY-14777
    Radiprodil

    RGH-896

    		 iGluR Neurological Disease
    Radiprodil (RGH-896) is an orally active and selective NMDA NR2B antagonist. A potential therapeutic agent in treatment of neuropathic pain and possibly other chronic pain conditions.
  • HY-P1267A
    α-Conotoxin PnIA TFA

    		nAChR Neurological Disease
    α-Conotoxin PnIA TFA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease.
  • HY-106856
    Dimiracetam

    NT-11624

    		 Others Cancer
    Dimiracetam is an orally active compound, with anti-neuropathic activity. Dimiracetam inhibits hypersensitivity and neurological alterations, and inhibits Sorafenib (HY-10201)-induced neuropathy in cold stimulation rat models.
  • HY-147306A
    (S)-ZLc002

    		NO Synthase Neurological Disease
    (S)-ZLc002 is a S-enantiomer of ZLc-002. ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain.
  • HY-100933
    MY-5445

    		Phosphodiesterase (PDE) Cancer Inflammation/Immunology Cardiovascular Disease
    MY-5445 is a specific inhibitor of the cyclic GMP phosphodiesterase, phosphodiesterase type 5 (PDE5), with a Ki of 1.3 μM. MY-5445 inhibits human platelet aggregation. MY-5445 is a selective modulator of ATP-binding cassette (ABC) transporter ABCG2, with anti-proliferative effect.
  • HY-N0405
    Orientin
    2 Publications Verification

    		 Others Cancer Neurological Disease
    Orientin is a naturally occurring bioactive flavonoid that possesses diverse biological properties, including anti-inflammation, anti-oxidative, anti-tumor, and cardio protection. Orientin is a promising neuroprotective agent suitable for therapy for neuropathic pain.
  • HY-B0161ES
    (±)-Duloxetine-d3 hydrochloride

    (Rac)-Duloxetine-d3 (hydrochloride)

    		 Serotonin Transporter Neurological Disease
    (±)-Duloxetine-d3 (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research[1].
  • HY-131868
    TRPV3 antagonist 74a

    		TRP Channel Neurological Disease
    TRPV3 antagonist 74a is a potent and selective TRPV3 antagonist. TRPV3 antagonist 74a displays no significant activity against a panel of other ion channels. TRPV3 antagonist 74a can be used for the research of neuropathic pain.
  • HY-N0630
    Shanzhiside methyl ester

    		GCGR Neurological Disease
    Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance.
  • HY-101418
    JNJ-47965567
    3 Publications Verification

    		 P2X Receptor Neurological Disease
    JNJ-47965567 is a centrally permeable, high-affinity, selective P2X7 antagonist, with pKis of 7.9 and 8.7 for human and rat P2X7, respectively. JNJ-47965567 can be used to probe the role of central P2X7 in rodent models of CNS pathophysiology.
  • HY-124996
    (Rac)-ZLc-002

    		NO Synthase Cancer Inflammation/Immunology Neurological Disease
    (Rac)-ZLc-002, an inhibitor of nNOS interaction with nitric oxide synthase 1 adaptor protein (NOS1AP), suppresses inflammatory nociception and chemotherapy-induced neuropathic pain and synergizes with Paclitaxel (HY-B0015) to reduce tumor cell viability.
  • HY-A0270
    Diphenidol

    		Others Neurological Disease
    Diphenidol is an orally active antiemetic. Diphenidol reduces abnormal neuropathic pain and TNF-α overexpression in rats following chronic compression injury. Diphenidol also has local anaesthetic activity and inhibits sodium currents. Diphenidol can be used in studies of meniere′s disease, anti-vertigo, antiemetic and analgesia.
  • HY-113689
    GAT211

    		Cannabinoid Receptor Neurological Disease
    GAT211 is a cannabinoid 1 receptor (CB1R) positive allosteric modulator (PAM). GAT211 activates cAMP and β-arrestin2 with EC50 values of 260 nM and 650 nM, respectively. GAT211 inhibits GAT211 can be used for neuropathic and/or inflammatory pain research.
  • HY-124283A
    LEI-101

    		Cannabinoid Receptor Neurological Disease
    LEI-101 is a potent, selective, and orally bioavailable cannabinoid CB2 receptor agonist, with a pEC50 of 8 for hCB2, and a pKi of less than 4 for hERG. LEI-101 is ~100-fold more potent in binding to CB2 receptors than to CB1 receptors.
  • HY-N2573
    Corydalmine

    L-Corydalmine; TLZ-16

    		 Fungal CXCR Infection Neurological Disease
    Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi. Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity. Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway.
  • HY-13954
    A 839977
    1 Publications Verification

    		 P2X Receptor Neurological Disease Inflammation/Immunology
    A 839977 is a P2X7 selective antagonist; it blocks BzATP-evoked calcium influx at recombinant human, rat and mouse P2X7 receptors (IC50 values are 20 nM, 42 nM and 150 nM respectively) and reduces inflammatory and neuropathic pain in animal models; the antihyperalgesic effects of P2X7 receptor blockade are mediated by blocking the release of IL-1beta.
  • HY-N6967
    Levomenol

    (-)-α-Bisabolol

    		 Apoptosis Inflammation/Immunology Neurological Disease
    Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active.
  • HY-125821
    Sigma-1 receptor antagonist 1

    		Sigma Receptor Neurological Disease
    Sigma‑1 receptor antagonist 1 (compound 137) is a potent and selective sigma-1 receptor (σ1R) antagonist, with a high binding affinity to σ1R receptor (Ki = 1.06 nM). Sigma‑1 receptor antagonist 1 exhibits antineuropathic pain activity and acts as a promising agent for the treatment of neuropathic pain.
  • HY-B0563S1
    Ropivacaine-d7

    		Sodium Channel Potassium Channel Neurological Disease Cardiovascular Disease
    Ropivacaine-d7 is deuterium labeled Ropivacaine. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese[1][2]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane[3]. Ropivacaine is used for the research of neuropathic pain management[1].
  • HY-115510
    SPR inhibitor 3

    SPRi3

    		 Others Inflammation/Immunology
    SPR inhibitor 3 (SPRi3) is a potent sepiapterin reductase (SPR) inhibitor. SPR inhibitor 3 (SPRi3) displays high binding affinity to human SPR in a cell-free assay (IC50=74 nM) and efficiently reduces biopterin levels in a cell-based assay (IC50=5.2 μM). SPR inhibitor 3 (SPRi3) reduces neuropathic and inflammatory pain through a reduction of BH4 levels.
  • HY-125820
    Sigma-1 receptor antagonist 3

    		Sigma Receptor Potassium Channel Neurological Disease
    Sigma-1 receptor antagonist 3 (compound135) is a potent and selective Sigma-1 (σ1) receptor antagonist with a Ki of 1.14 nM. Sigma-1 receptor antagonist 3 inhibits Human Ether-a-go-go-Related Gene (hERG) with an IC50 of 1.54 μM. Sigma-1 receptor antagonist 3 has the potential for the neuropathic pain.
  • HY-135891
    AZD2423

    		CCR Neurological Disease
    AZD2423 is a potent, selective, orally bioavailable, and non-competitive CCR2 chemokine receptor negative allosteric modulator. AZD2423 has an IC50 of 1.2 nM for CCR2 Ca 2+ flux .
  • HY-13106A
    Olodanrigan sodium
    1 Publications Verification

    EMA401 sodium; PD-126055 sodium

    		 Angiotensin Receptor Endocrinology Neurological Disease
    Olodanrigan (EMA401) sodium is a highly selective, orally active, peripherally restricted angiotensin II type 2 receptor (AT2R) antagonist. Olodanrigan sodium is under development as a neuropathic pain therapeutic agent. Olodanrigan sodium analgesic action appears to involve inhibition of augmented AngII/AT2R induced p38 and p42/p44 MAPK activation, and hence inhibition of DRG neuron hyperexcitability and sprouting of DRG neurons.
  • HY-146383
    H3R antagonist 2

    		Histamine Receptor Cholinesterase (ChE) Monoamine Oxidase Neurological Disease
    H3R antagonist 2 (Compound 23) is a multitarget histamine H3 receptor (H3R) antagonist with a Ki of 170 nM for hH3R . H3R antagonist 2 shows inhibitory effects with IC50 values of 180, 880 and 775 nM for acetylcholinesterase, butyrylcholinesterase and human monoamine oxidase B (hMAO B), respectively. H3R antagonist 2 shows favorable anti-neuropathic pain and memory-enhancing effects. H3R can across BBB.
  • HY-117626
    LP-935509

    		AAK1 Cyclin G-associated Kinase (GAK) SARS-CoV Infection Inflammation/Immunology Neurological Disease
    LP-935509 is an orally active, potent, selective, ATP-competitive and brain-penetrant inhibitor of adaptor protein-2 associated kinase 1 (AAK1) with an IC50 of 3.3 nM and a Ki of 0.9 nM, respectively. LP-935509 is also a potent inhibitor of BIKE (IC50=14 nM) and a modest inhibitor of GAK (IC50=320 nM). LP-935509 shows antinociceptive activity. LP-935509 can be used for neuropathic pain and SARS-CoV-2 research.
  • HY-13106
    Olodanrigan
    1 Publications Verification

    EMA401; PD-126055

    		 Angiotensin Receptor Neurological Disease Endocrinology
    Olodanrigan (EMA401) is a highly selective, orally active, peripherally restricted angiotensin II type 2 receptor (AT2R) antagonist. It is under development as a neuropathic pain therapeutic agent. Olodanrigan (EMA401) analgesic action appears to involve inhibition of augmented AngII/AT2R induced p38 and p42/p44 MAPK activation, and hence inhibition of DRG neuron hyperexcitability and sprouting of DRG neurons.
  • HY-108656
    MRS2365

    		P2Y Receptor Arrestin Cardiovascular Disease
    MRS2365 is a potent and selective P2Y1 receptor (EC50=0.4 nM) /[ 35S]GTPγS binding/β-arrestin 2 recruitment agonist with an EC50 of 0.4 nM. MRS2365 relieves mechanical allodynia and increases mechanical sensitivity. MRS2365 shows little agonist or antagonist activity at the P2Y12 or P2Y13 receptors.
  • HY-108656A
    MRS2365 trisodium

    		P2Y Receptor Arrestin Cardiovascular Disease
    MRS2365 trisodium is a potent and selective P2Y1 receptor (EC50=0.4 nM)/[ 35S]GTPγS binding/β-arrestin 2 recruitment agonist. MRS2365 trisodium relieves mechanical allodynia and increases mechanical sensitivity.
  • HY-136363
    MDR-652

    		TRP Channel Neurological Disease
    MDR-652 is a highly specific and efficacious transient receptor potential vanilloid 1 (TRPV1) ligand with agonist activity. The Kis are 11.4 and 23.8 nM for hTRPV1 and rTRPV1, respectively. The EC50s are 5.05 and 93 nM for hTRPV1 and rTRPV1, respectively. Potent topical analgesic activity.
  • HY-106199
    Adenosine A1 receptor activator T62
    1 Publications Verification

    		 Adenosine Receptor Inflammation/Immunology Neurological Disease
    Adenosine A1 receptor activator T62 is an allosteric enhancer of adenosine A1 receptor. Adenosine A1 receptor activator T62 produces antinociception in animal models of acute pain and also reduces hypersensitivity in models of inflammatory and nerve-injury pain.
  • HY-135871
    BMT-124110

    		AAK1 Neurological Disease
    BMT-124110 is a potent, selective AAK1 inhibitor with an IC50 of 0.9 nM. BMT-124110 shows antinociceptive activity. BMT-090605 inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50s of 17 and 99 nM, respectively.
  • HY-149335
    Sigma-1 receptor antagonist 5

    		Sigma Receptor Histamine Receptor Neurological Disease
    Sigma-1 receptor antagonist 5 (compound 12)，a 4-pyridylpiperidine derivative with analgesic activity，is an antagonist of sigma receptor (Ki=4.5 nM (σ1R)，10 nM (σ2R)) and histamine H3 (hH3R，Ki=7.7 nM，IC50=215 nM). Sigma-1 receptor antagonist 5 suppresses Capsaicin-induced nociception with antinociceptive activity and shows potent efficacy in nociceptive and neuropathic pain models.
  • HY-143390
    NMDA receptor modulator 2

    		iGluR Neurological Disease
    NMDA receptor modulator 2 (Compound 1) is a potent NMDA receptor modulator. NMDA receptor modulator 2 can be used for neurological disorder research.
  • HY-B0527A
    Amitriptyline hydrochloride
    3 Publications Verification

    		 Serotonin Transporter 5-HT Receptor Histamine Receptor mAChR Adrenergic Receptor Sodium Channel Trk Receptor Neurological Disease
    Amitriptyline hydrochloride is an inhibitor of serotonin reuptake transporter (SERT) and noradrenaline reuptake transporter (NET), with Kis of 3.45 nM and 13.3 nM for human SERT and NET, respectively. Amitriptyline hydrochloride also weakly binds to dopamine reuptake transporter (DAT) with a Ki of 2.58 μM. Amitriptyline hydrochloride also inhibits adrenergic, muscarinic, histamine and 5-HT receptors. Amitriptyline hydrochloride is a TrkA and TrkB receptors agonist with potent neurotrophic activity. Amitriptyline hydrochloride has antidepressant activity.
  • HY-143396
    NMDA receptor modulator 5

    		iGluR Neurological Disease
    NMDA receptor modulator 5 (Compound 195) is a potent NMDA receptor modulator. NMDA receptor modulator 5 can be used for neurological disorder research.
  • HY-143393
    NMDA receptor modulator 4

    		iGluR Neurological Disease
    NMDA receptor modulator 4 (Compound 169) is a potent NMDA receptor modulator. NMDA receptor modulator 4 can be used for neurological disorder research.
  • HY-143391
    NMDA receptor modulator 3

    		iGluR Neurological Disease
    NMDA receptor modulator 3 (Compound 99) is a potent NMDA receptor modulator. NMDA receptor modulator 3 can be used for neurological disorder research.
  • HY-143397
    NMDA receptor modulator 6

    		iGluR Neurological Disease
    NMDA receptor modulator 6 (Compound 183) is a potent NMDA receptor modulator. NMDA receptor modulator 6 can be used for neurological disorder research.
  • HY-147638
    MONIRO-1

    		Calcium Channel Neurological Disease
    MONIRO-1 is a T-type and N-type calcium channel blocker with IC50 values of 34, 3.3, 1.7 and 7.2 µM against hCav2.2, hCav3.1, hCav3.2 and hCav3.3, respectively.
  • HY-14485
    Ro-51

    		P2X Receptor Neurological Disease
    Ro-51 is a potent and selective dual P2X3/P2X2/3 antagonist, with IC50 of 2 nM and 5 nM for P2X3 and P2X2/3, respectively. Ro-51 can be used for the research for pain.
  • HY-146281
    mGAT3/4-IN-2

    		GABA Receptor Metabolic Disease Neurological Disease
    mGAT3/4-IN-2 (compound 27b) is a potent mGAT3/mGAT4 inhibitor, with pIC50 values of 5.44 and 5.25, respectively.
  • HY-148236
    BAY-390

    		TRP Channel Inflammation/Immunology
    BAY-390 is a selective, across species active and brain penetrating TRPA1 inhibitor. BAY-390 inhibits hTRPA1 FLIPR, hTRPA1 Ephys, rTRPA1 FLIPR and rDRG Ephys with IC50s of 16, 82, 63 and 35 nM, respectively. BAY-390 can be used for the research of inflammation.
  • HY-17387
    (-)-Huperzine A
    3 Publications Verification

    Huperzine A

    		 Cholinesterase (ChE) Apoptosis iGluR Neurological Disease
    (-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC50 of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease.
  • HY-128971
    LHVS

    		Cathepsin Parasite Infection Neurological Disease
    LHVS is a potent, non-selective, irreversible, cell-permeable cysteine protease and cathepsin inhibitor. LHVS decreases actin ring formation. LHVS inhibits T. gondii invasion with an IC50 of 10 μM.
  • HY-147352
    NMDA receptor potentiator-1

    		iGluR Neurological Disease
    NMDA receptor potentiator-1 (Compound 1368) is a subunit selective NMDA receptor potentiator with IC50s of 4 μM and 5 μM against NR2C and NR2D expression, respectively.
  • HY-146282
    mGAT-IN-1

    		GABA Receptor Neurological Disease
    mGAT-IN-1 (compound 28) is a potent and non-selective GAT inhibitor. mGAT-IN-1 has a high inhibitory potency toward mGAT3, with an IC50 of 2.5 μM and pIC50 of 5.61.
  • HY-107620
    PD 198306

    		MEK Neurological Disease
    PD 198306 is a selective MAPK/ERK-kinase (MEK) inhibitor. PD 198306 results in an observable reduction in the Streptozocin induced increase in the level of active ERK1 and 2. Antihyperalgesic effects.
  • HY-122575
    Aurintricarboxylic acid
    1 Publications Verification

    		 P2X Receptor Influenza Virus Topoisomerase MicroRNA Apoptosis Infection Inflammation/Immunology Neurological Disease
    Aurintricarboxylic acid is a nanomolar-potency, allosteric antagonist with selectivity towards αβ-methylene-ATP-sensitive P2X1Rs and P2X3Rs, with IC50s of 8.6 nM and 72.9 nM for rP2X1R and rP2X3R, respectively. Aurintricarboxylic acid is a potent anti-influenza agent by directly inhibiting the neuraminidase. Aurintricarboxylic acid is an inhibitor of topoisomerase II and apoptosis. Aurintricarboxylic acid is a selective inhibitor of the TWEAK-Fn14 signaling pathway. Aurintricarboxylic acid also acts as a cystathionine-lyase (CSE) inhibitor with an IC50 of 0.6 μM. Aurintricarboxylic acid is a modifier of miRNAs that regulate miRNA function, with an IC50 of 0.47 µM.