ADWX 1 

ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC₅₀ value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases^[1][2].

ADWX 1 (1,10 nM, 1 h) inhibits IL-2 and IFN-γ productions, and inhibits humans CD4⁺ CCR7^- T_EM cells activation selectively^[2].
ADWX 1 (1,10 nM, 50 min) reduces [Ca²⁺] in activated CD4⁺ CCR7^- T_CM cells from EAE rats^[2].
ADWX 1 (1,10 nM, 1 h) reduces NF-κB activation and suppresses Kv1.3 expression at both mRNA and protein levels preferentially in myelin basic protein (MBP) (HY-P77995)-stimulated CD4⁺ CCR7^- T cells from EAE rats^[2].
ADWX 1 (1,10 nM, 3 days) suppresses Th17 activation but not differentiation in CD4⁺ CCR7^- T cells^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

ADWX 1 (100 μg/kg/day, s.c., 3 days) ameliorates the disease through the inhibition of IL-2 and IFN-γ productions and CCR7^- T_EM proliferation in experimental autoimmune encephalomyelitis (EAE) of Sprague-Dawley rats^[2].
ADWX 1 (5/10 mg/kg, s.c., 2 weeks) induces no pathological changes in the behavior or tissues of the rats (acute toxicity assay)^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

4071.85

C₁₆₉H₂₈₁N₅₇O₄₆S₇

Val-Gly-Ile-Asn-Val-Lys-Cys-Lys-His-Ser-Arg-Gln-Cys-Leu-Lys-Pro-Cys-Lys-Asp-Ala-Gly-Met-Arg-Phe-Gly-Lys-Cys-Thr-Asn-Gly-Lys-Cys-His-Cys-Thr-Pro-Lys (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)

VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK (Disulfide bonds: Cys7-Cys27, Cys13-Cys32, Cys17-Cys34)

Room temperature in continental US; may vary elsewhere.

Please store the product under the recommended conditions in the Certificate of Analysis.

• [1]. Han S, et al. Structural basis of a potent peptide inhibitor designed for Kv1.3 channel, a therapeutic target of autoimmune disease. J Biol Chem. 2008 Jul 4;283(27):19058-65.  [Content Brief]

  [2]. Li Z, et al. Selective inhibition of CCR7(-) effector memory T cell activation by a novel peptide targeting Kv1.3 channel in a rat experimental autoimmune encephalomyelitis model. J Biol Chem. 2012 Aug 24;287(35):29479-94.  [Content Brief]