40S Ribosomal Protein S3/RPS3 Protein, Human (His)

40S ribosomal protein S3 (RPS3) is an important component of the small ribosomal subunit and is integral to cellular protein synthesis. In addition to its ribosomal function, RPS3 exhibits endonuclease activity and plays a role in DNA repair. 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is the recombinant human-derived 40S Ribosomal protein S3/RPS3 protein, expressed by E. coli , with C-His labeled tag. The total length of 40S Ribosomal Protein S3/RPS3 Protein, Human (His) is 242 a.a., with molecular weight of ~32 kDa.

40S Ribosomal Protein S3 (RPS3), an integral component of the small ribosomal subunit, contributes to the cellular machinery responsible for protein synthesis. Apart from its ribosomal role, RPS3 exhibits endonuclease activity, participating in the repair of damaged DNA. Demonstrating broad substrate specificity, it cleaves phosphodiester bonds in DNAs containing altered bases and displays a higher efficiency in cleaving supercoiled DNA compared to relaxed DNA. RPS3 exhibits a strong affinity for 7,8-dihydro-8-oxoguanine (8-oxoG), a common DNA lesion induced by reactive oxygen species. Furthermore, it influences DNA repair processes by stimulating the activities of base excision proteins, such as OGG1 and UNG1, and promoting the cleavage of the phosphodiester backbone by APEX1. Beyond its role in DNA repair, RPS3 participates in various cellular functions, including transcriptional regulation as part of the NF-kappa-B p65-p50 complex, modulation of spindle formation and chromosome movement during mitosis through regulation of microtubule polymerization, and induction of apoptosis through interactions with key apoptotic factors like CASP8 and E2F1. Additionally, RPS3 has been implicated in protecting TP53/p53 from MDM2-mediated ubiquitination and negatively regulating DNA repair in response to hydrogen peroxide exposure.

Human

E. coli

C-His

P23396 (A2-A243)

6188  [NCBI]

AVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIMESGAKGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA

Approximately 32 kDa

• 
  Greater than 92% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.