1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-20
  6. Animal-Free FGF-20 Protein, Human (His)

Animal-Free FGF-20 Protein, Human (His)

Cat. No.: HY-P700062AF
COA Handling Instructions

FGF-20 protein, a homodimer, functions as a neurotrophic factor essential for regulating central nervous system development and function. It interacts with specific receptors, FGFR2 and FGFR4, with heparan sulfate glycosaminoglycans enhancing the binding affinity between fibroblast growth factors (FGFs) and their receptors, serving as coreceptors in this intricate signaling process. Animal-Free FGF-20 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-20 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-20 Protein, Human (His) is 209 a.a., with molecular weight of ~24.24 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $57 In-stock
10 μg $160 In-stock
50 μg $450 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FGF-20 protein, a homodimer, functions as a neurotrophic factor essential for regulating central nervous system development and function. It interacts with specific receptors, FGFR2 and FGFR4, with heparan sulfate glycosaminoglycans enhancing the binding affinity between fibroblast growth factors (FGFs) and their receptors, serving as coreceptors in this intricate signaling process. Animal-Free FGF-20 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-20 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-20 Protein, Human (His) is 209 a.a., with molecular weight of ~24.24 kDa.

Background

FGF-20 protein serves as a neurotrophic factor crucial for the regulation of central nervous system development and function. Operating as a homodimer, it interacts with specific receptors, namely FGFR2 and FGFR4. The binding affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by heparan sulfate glycosaminoglycans, acting as coreceptors in this intricate signaling process.

Biological Activity

The ED50 is 1.3-3.2 ng/mL as measure by its ability to induce 3T3 cells proliferation, corresponding to a specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9NP95 (P3-T211)

Gene ID
Molecular Construction
N-term
FGF-20 (P3-T211)
Accession # Q9NP95
His
C-term
Synonyms
Fibroblast growth factor 20; FGF20
AA Sequence

MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Molecular Weight

Approximately 24.24 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free FGF-20 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free FGF-20 Protein, Human (His)
Cat. No.:
HY-P700062AF
Quantity:
MCE Japan Authorized Agent: