Bcl-2-like protein 2 Protein, Human (His)

Bcl-2-like protein 2 is a key regulator that promotes cell survival and prevents dexamethasone-induced apoptosis, which is critical for postmitotic Sertoli cells. It inhibits BAX, emphasizing its role in survival mechanisms. Bcl-2-like protein 2 Protein, Human (His) is the recombinant human-derived Bcl-2-like protein 2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of Bcl-2-like protein 2 Protein, Human (His) is 171 a.a., with molecular weight of ~18.0 kDa.

Bcl-2-like protein 2, a crucial player in cellular dynamics, exerts its influence by promoting cell survival and effectively blocking dexamethasone-induced apoptosis. This multifunctional protein plays a pivotal role in the survival of postmitotic Sertoli cells, where it suppresses the death-promoting activity of BAX. The intricate molecular network extends to interactions with HIF3A through its C-terminus domain, emphasizing its involvement in complex signaling pathways. Additionally, Bcl-2-like protein 2 engages in interactions with BOP, further highlighting its role in cellular homeostasis. The nuanced functions of Bcl-2-like protein 2 underscore its significance in orchestrating cell survival mechanisms and warrant further exploration to comprehensively understand its molecular contributions in diverse cellular contexts.

Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED₅₀ for this effect is 10.09 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized BID at 5 μg/mL (100 μL/well) can bind human Bcl-2-like protein 2. The ED₅₀ for this effect is 10.09 ng/mL.

Human

E. coli

C-6*His

AAI13523.1 (A2-T172)

599  [NCBI]

ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT

Approximately 18.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filter solution of 25 mM HEPES, 100 mM KCl, 20% Glycerol, pH 7.5 or 20 mM HEPES, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Liu HN, et al. MiR-93 Inhibits Trophoblast Cell Proliferation and Promotes Cell Apoptosis by Targeting BCL2L2 in Recurrent Spontaneous Abortion. Reprod Sci. 2020;27(1):152-162.  [Content Brief]

  [2]. Hartman ML, et al. BCL-w: apoptotic and non-apoptotic role in health and disease. Cell Death Dis. 2020;11(4):260. Published 2020 Apr 21.  [Content Brief]