1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs) Growth Differentiation Factor
  5. BMP-9/GDF-2
  6. BMP-9/GDF-2 Protein, Mouse (HEK293, Fc)

BMP-9/GDF-2 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P77580
COA Handling Instructions

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that signals through AVRL1, and endoglin/ENG is required for SMAD1 signaling in endothelial cells. As a homodimer with a disulfide-linked structure, BMP-9/GDF-2 forms a complex with AVRL1, BMPR2, and ACVR2B, which is critical for its signaling cascade. BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived BMP-9/GDF-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-50 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
20 μg $250 In-stock
50 μg $415 Get quote
100 μg $700 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BMP-9/GDF-2 protein is a potent inhibitor of angiogenesis that signals through AVRL1, and endoglin/ENG is required for SMAD1 signaling in endothelial cells. As a homodimer with a disulfide-linked structure, BMP-9/GDF-2 forms a complex with AVRL1, BMPR2, and ACVR2B, which is critical for its signaling cascade. BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived BMP-9/GDF-2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of BMP-9/GDF-2 Protein, Mouse (HEK293, Fc) is 110 a.a., with molecular weight of 47-50 kDa.

Background

BMP-9/GDF-2 Protein emerges as a potent circulating inhibitor of angiogenesis, signaling through the type I activin receptor ACVRL1 while excluding other Alks. In endothelial cells, its signaling through SMAD1 necessitates the presence of the TGF-beta coreceptor endoglin/ENG. Existing as a homodimer with disulfide-linked structures, BMP-9/GDF-2 is detected in extracellular fluid both as a mature homodimer and in complex with its propeptide. The protein engages in high-affinity interactions with ACVRL1, BMPR2, and ACVR2B, forming complexes pivotal for its signaling cascade. Additionally, BMP-9/GDF-2 interacts with ENG, forming a heterotetramer with a 2:2 stoichiometry, and can also engage in heteromeric complexes with ENG and ACVRL1. Notably, it interacts with the type I receptor ACVR1, adding another layer of complexity to its regulatory interactions within the TGF-beta signaling pathway.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9WV56 (S319-R428)

Gene ID

12165  [NCBI]

Molecular Construction
N-term
BMP-9 (S319-R428)
Accession # Q9WV56
hFc
C-term
Synonyms
GDF-2; BMP-9; GDF2; BMP9
AA Sequence

STGASSHCQKTSLRVNFEDIGWDSWIIAPKEYDAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISILYKDDMGVPTLKYHYEGMSVAECGCR

Molecular Weight

47-50 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution in 100 mM Glycine,40 mM Tris.100 mM NaCl, pH 8.14. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BMP-9/GDF-2 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77580
Quantity:
MCE Japan Authorized Agent: