2. Recombinant Proteins
  3. Others
  4. CART Protein, Human (HEK293)

CART Protein, Human (HEK293)

Cat. No.: HY-P74351
Handling Instructions

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free. The total length of CART Protein, Human (HEK293) is 89 a.a., with molecular weight of ~11 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock
5 μg $56 Ask For Quote & Lead Time
10 μg $95 Ask For Quote & Lead Time
50 μg $265 Ask For Quote & Lead Time
100 μg $450 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CART Protein, a satiety factor, intricately regulates feeding in connection with leptin and neuropeptide Y. It effectively suppresses regular and starvation-triggered feeding, robustly inhibiting neuropeptide Y-initiated feeding within the hypothalamus. Additionally, CART protein plays a pivotal role in fostering neuronal development and survival in vitro, extending beyond its appetite regulation function. CART Protein, Human (HEK293) is the recombinant human-derived CART protein, expressed by HEK293 , with tag free. The total length of CART Protein, Human (HEK293) is 89 a.a., with molecular weight of ~11 kDa.
Background

CART protein, a satiety factor intricately linked to the functions of leptin and neuropeptide Y, acts as an anorectic peptide by effectively suppressing both regular and starvation-triggered feeding. Furthermore, it robustly inhibits the feeding response initiated by neuropeptide Y and governed by leptin within the hypothalamus. Beyond its role in appetite regulation, CART protein also plays a pivotal role in fostering neuronal development and survival when studied in vitro.
Species

Human
Source

HEK293
Tag

Tag Free
Accession

Q16568 (Q28-L116)
Gene ID
Molecular Construction
N-term
CART (Q28-L116)
Accession # Q16568
C-term
Synonyms
Cocaine- and amphetamine-regulated transcript protein; CART; CARTPT
AA Sequence

QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

Molecular Weight

Approximately 11 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

CART Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CART Protein, Human (HEK293)
Cat. No.:
HY-P74351
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.