CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His)

The CD81 protein is a member of the growth hormone/prolactin family and regulates a variety of physiological processes. Prolactin is mainly associated with mammary gland development and lactation, has pleiotropic effects, and affects immune responses, metabolism, and behavior. CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD81 protein, expressed by HEK293 , with N-His labeled tag. The total length of CD81 Protein, Cynomolgus/Rhesus Macaque (HEK293, His) is 86 a.a., with molecular weight of ~10 KDa.

Prolactin is a member of the somatotropin/prolactin family, playing a crucial role in regulating various physiological processes. As a hormone, prolactin is primarily associated with the modulation of mammary gland development and lactation in mammals. Beyond its reproductive functions, prolactin also exhibits pleiotropic effects, influencing immune responses, metabolism, and behavior. The somatotropin/prolactin family encompasses proteins that share structural and functional similarities, reflecting their evolutionary relationship and involvement in diverse biological pathways. Prolactin's versatility highlights its significance in orchestrating a range of physiological functions, making it a key player in maintaining homeostasis in different tissues and systems.

Rhesus Macaque/Cynomolgus

HEK293

N-6*His

A0A2K5UDJ9 (K116-K201)

102139656  [NCBI]

KDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLAALTTSVLKNNLCPSGSNIISNLLKKDCHQKIDELFSGK

Approximately 10 kDa.

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.