CD83 Protein, Rat (HEK293, His)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, His) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD83 Protein, Rat (HEK293, His) is 134 a.a., with molecular weight of 27-35 kDa.

CD83 Protein is suggested to play a significant role, potentially contributing to antigen presentation or mediating cellular interactions that ensue following lymphocyte activation. The specific mechanisms through which CD83 influences these processes, particularly in the context of immune responses, remain to be fully elucidated. As a monomer, CD83 may participate in distinct molecular events that impact antigen presentation and cellular interactions, highlighting its potential as a key regulatory element in modulating immune responses. In-depth investigations are needed to unravel the intricacies of CD83's function and its implications in the orchestration of immune processes.

Measured by the ability of the immobilized protein to support the adhesion of human monocyte-derived dendritic cells. When 5 x 10⁴ cells/well are added to Rat CD83 coated plates (5 µg/mL, 100 µL/well), approximately 68.76% adhered after 30 minutes at 37° C.

Rat

HEK293

C-6*His

B2GV95 (M22-A134)

361226  [NCBI]

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Approximately 27-35 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.