1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion-related CD Proteins
  4. CD99/MIC2
  5. CD99L2 Protein, Mouse (HEK293, His)

CD99L2 Protein, Mouse (HEK293, His)

Cat. No.: HY-P76814
Handling Instructions

CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD99L2 Protein, Mouse (HEK293, His) is 139 a.a., with molecular weight of 24-30 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD99L2 Protein is crucial in aiding leukocytes during a late stage of extravasation by facilitating the overcoming of the endothelial basement membrane barrier. Independently acting at the same site as PECAM1, CD99L2 serves as a homophilic adhesion molecule, even though its interactions may not be essential for cell aggregation. CD99L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD99L2 protein, expressed by HEK293 , with C-His labeled tag. The total length of CD99L2 Protein, Mouse (HEK293, His) is 139 a.a., with molecular weight of 24-30 kDa.

Background

The CD99L2 protein plays a vital role in facilitating a late step of leukocyte extravasation, aiding cells in overcoming the endothelial basement membrane barrier. It acts at the same site as PECAM1, although independently, to promote this process. CD99L2 functions as a homophilic adhesion molecule, although its interactions may not be necessary for cell aggregation.

Species

Mouse

Source

HEK293

Accession

Q8BIF0-1 (D26-A164)

Gene ID

171486  [NCBI]

Molecular Construction
N-term
CD99L2 (D26-A164)
Accession # Q8BIF0
His
C-term
Synonyms
CD99 Antigen-Like Protein 2; MIC2-Like Protein 1; CD99; CD99L2; MIC2L1
AA Sequence

DTDGFNLEDALKETSSVKQRWDHFSTTTRRPVTTRAPANPAERWDHVATTTTRRPGTTRAPSNPMELDGFDLEDALDDRNDLDGPKKPSAGEAGGWSDKDLEDIVEGGGYKPDKNKGGGGYGSNDDPGSGISTETGTIA

Molecular Weight

Approximately 24-30 kDa due to the glycosylation.

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD99L2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76814
Quantity:
MCE Japan Authorized Agent: