Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His)

Chemotaxis Inhibitory Protein (CIP) strategically counters the host defense mechanisms, inhibiting reactions of human neutrophils and monocytes to complement anaphylatoxin C5a and fMLP. As a molecular sentinel, CIP directly engages with C5aR and FPR, obstructing calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, finessefully thwarting bacterium phagocytosis. Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) is the recombinant Staphylococcus aureus-derived Chemotaxis inhibitory protein, expressed by P. pastoris , with N-His labeled tag. The total length of Chemotaxis inhibitory Protein, S. aureus (P.pastoris, His) is 121 a.a., with molecular weight of ~16.1 kDa.

Chemotaxis Inhibitory Protein (CIP) strategically navigates the realm of host defense mechanisms, specifically countering the initial lines of immune response. Its role unfolds in inhibiting the reactions of human neutrophils and monocytes to the complement anaphylatoxin C5a and formylated peptides, such as N-formyl-methionyl-leucyl-phenylalanine (fMLP). Functioning as a molecular sentinel, CIP directly engages with the C5a receptor (C5aR) and formylated peptide receptor (FPR), effectively obstructing the calcium responses induced by C5a and fMLP. In this tactical intervention, CIP acts as a guardian, thwarting the phagocytosis of the bacterium with finesse.

Staphylococcus aureus

P. pastoris

N-His

Q6GFB3 (29F-149Y)

/

FTFEPFPTNEEIESNKKMLEKEKAYKESFKNSGLPTTLGKLDERLRNYLKKGTKNSAQFEKMVILTENKGYYTVYLNTPLAEDRKNVELLGKMYKTYFFKKGESKSSYVINGPGKTNEYAY

Approximately 16.1 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.