ECM1 Protein, Rat (HEK293, His)

The ECM1 protein is a multifaceted player that negatively regulates bone mineralization and affects endochondral bone formation. In addition to bone biology, it stimulates endothelial cell proliferation and angiogenesis and exerts regulatory control on MMP9 proteolytic activity. ECM1 Protein, Rat (HEK293, His) is the recombinant rat-derived ECM1 protein, expressed by HEK293 , with C-His labeled tag. The total length of ECM1 Protein, Rat (HEK293, His) is 543 a.a., with molecular weight of 75-80 kDa.

ECM1 protein emerges as a multifaceted participant in cellular processes, particularly influencing endochondral bone formation by acting as a negative regulator of bone mineralization. Beyond its role in bone biology, ECM1 extends its influence to endothelial cells, where it stimulates proliferation and fosters angiogenesis. Notably, it exercises regulatory control over MMP9 proteolytic activity, contributing to the intricate balance of molecular events. In its functional repertoire, ECM1 engages in molecular interactions, forming associations with HSPG2, EFEMP1/FBLN3, LAMB3, and MMP9, thereby participating in a network of molecular relationships that underscore its significance in diverse cellular contexts.

Measured by the ability of the immobilized protein to support the adhesion of the B16F1 mouse melanoma cells. The adhesion rate for this effect is 39.61% in the presence of 10 μg/mL Rat ECM-1.

Rat

HEK293

C-10*His

Q62894/NP_446334.1 (A20-E562)

116662  [NCBI]

ASEGAFKVSDQREMKPEHLFQHLHEVGYAAPPSPPQTRRLQVHHSETSPHDPPLFEEQKEVQPPSSPEDIPVYEEEWLTFLNPNVGKVDPALPQEAIPLQKEQPPPRIPIEQKEIDPPVQHQEEIVQSRQKEEKPPTLTGQHPPEPRTWNPARHCQQGRRGIWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGEALNLLETGYSRCCRCRSDTNRLDCVKLVWEDAMTQFCEAEFSVKTRPHLCCKQRGEERFSCFQKEAPRPDYLLRPCPIHQTGISSGTQLPFPPGLPTPDNVKNICLLRRFRSVPRNLPATDAIQRQLQALTRLETEFQRCCRQGHNHTCTWKAWEDTLDGYCDRELAIKTHPHSCCHYPPSPARDECFAHLAPYPNYDRDLLTVDLSRVTPNLMDHLCGNGRVLSKHKQIPGLIQNMTVRCCELPYPEQACCGEEEKLAFIEDLCGPRRNSWKDPALCCTLSPGDKQANCFNTNYLRNVALVAGDTGNATGLGQQGPTGGTNVGPAPGSKEE

Approximately 75-80 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.