FGF-4 Protein, Human (136a.a)

FGF-4 Protein orchestrates embryonic development, cell proliferation, and differentiation, crucial for normal limb and cardiac valve development. FGF-4 may contribute to embryonic molar tooth bud development by inducing key gene expressions. Engaging with FGFRs, FGF-4 forms molecular alliances vital for signaling cascades. The potentiated binding affinity with heparan sulfate glycosaminoglycans serves as indispensable coreceptors, highlighting the multifaceted and essential role of FGF-4 in fundamental developmental processes. FGF-4 Protein, Human (136a.a) is the recombinant human-derived FGF-4 protein, expressed by E. coli, with tag free. The total length of FGF-4 Protein, Human (136a.a) is 136 a.a., with molecular weight of ~16 kDa.

FGF-4 Protein assumes a pivotal role in orchestrating embryonic development, cell proliferation, and cell differentiation. Its indispensability is evident in the normal development of limbs and cardiac valves during embryogenesis. Additionally, FGF-4 may contribute to embryonic molar tooth bud development by inducing the expression of key genes, including MSX1, MSX2, and SDC1, in dental mesenchyme cells, thus highlighting its diverse regulatory functions. FGF-4 engages in intricate interactions with FGFR1, FGFR2, FGFR3, and FGFR4, forming molecular alliances critical for signaling cascades. The binding affinity between FGF-4 and its receptors is potentiated by heparan sulfate glycosaminoglycans, serving as indispensable coreceptors in this complex regulatory network. These interactions underscore the multifaceted and essential role of FGF-4 in driving fundamental processes during development.

Measured in a cell proliferation assay using NIH-3T3 cells. The ED₅₀ this effect is 0.1245 ng/mL, corresponding to a specific activity is 8.03×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using NIH-3T3 cells. The ED₅₀ this effect is 0.1245 ng/mL, corresponding to a specific activity is 8.03×10⁶ units/mg.

Human

E. coli

Tag Free

P08620 (S71-L206)

2249  [NCBI]

SGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL

Approximately16 KDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 5% Trehalose, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

< 0.1 ng/µg (1 EU/µg) as determined by LAL test.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.