1. Recombinant Proteins
  2. Receptor Proteins
  3. G-Protein-Coupled Receptors (GPCRs)
  4. Frizzled
  5. Frizzled-1
  6. Frizzled-1 Protein, Mouse (HEK293, Fc)

Frizzled-1 Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P70210
COA Handling Instructions

Frizzled-1 is a Wnt receptor that is primarily activated by WNT7B and to varying degrees by WNT3A, WNT3, WNT1, and WNT2, while resisting activation by other Wnt proteins. Its fundamental role in canonical Wnt/β-catenin signaling involves promiscuous activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Frizzled-1 Protein, Mouse (HEK293, Fc) is 180 a.a., with molecular weight of 55-70 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $92 In-stock
50 μg $240 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Frizzled-1 is a Wnt receptor that is primarily activated by WNT7B and to varying degrees by WNT3A, WNT3, WNT1, and WNT2, while resisting activation by other Wnt proteins. Its fundamental role in canonical Wnt/β-catenin signaling involves promiscuous activation, GSK-3 kinase inhibition, nuclear β-catenin accumulation, and Wnt target gene activation. Frizzled-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Frizzled-1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Frizzled-1 Protein, Mouse (HEK293, Fc) is 180 a.a., with molecular weight of 55-70 kDa.

Background

Frizzled-1, a receptor for Wnt proteins, is prominently activated by WNT7B and, to varying degrees, by WNT3A, WNT3, WNT1, and WNT2, while showing resistance to activation by WNT4, WNT5A, WNT5B, WNT6, WNT7A, or WNT7B in certain contexts. Its involvement in the canonical Wnt/beta-catenin signaling pathway is fundamental, instigating the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and subsequent activation of Wnt target genes. The presence of an alternative signaling pathway involving PKC and calcium fluxes adds intricacy, with unresolved questions regarding its integration with the canonical pathway. Frizzled-1 may play a crucial role in transducing polarity information during tissue morphogenesis and in differentiated tissues, underscoring its multifaceted contributions. Notably, interactions with MYOC and WNT7B further emphasize its intricate involvement in diverse cellular processes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

O70421 (V69-H248)

Gene ID

14362  [NCBI]

Molecular Construction
N-term
Frizzled-1 (V69-H248)
Accession # O70421
hFc
C-term
Synonyms
rMuFrizzled-1/Fz-1, Fc; Frizzled-1; Fz-1; mFz1; Fzd1; Frizzled homolog 1
AA Sequence

VRAQAAGQVSGPGQQAPPPPQPQQSGQQYNGERGISIPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQH

Molecular Weight

55-70 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Frizzled-1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Frizzled-1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70210
Quantity:
MCE Japan Authorized Agent: